F395726

General Info

Members Datasets Scaffolds Average Seq Length
301 160 602 248

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100003004|Ga0070660_1000030042
Length 273
Sequence MPRYFIEVSYKGTAYAGFQIQKNSNTIQAEVEKALKTLFKQAFSLTGASRTDTGVHALQNYFHFDSVQLLTVNKKGKKRQDSKVHPHEISTGIAEAVYNLNAILPRDIVIKRIYQVADEAHCRFDAVSREYKYFIYQNKNPFLEGRAYYFPYKLNLENLNKAAAIILQHQDFTSFSKKNTQVNNFICKMIISEWIIENNVLVYNVKANRFLRGMVKGMVATMLKVGTGKISLEEFDAILKSRDCSKADFSAPSHGLFLVGVEYKNGLFMNTNN

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
160 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0.33
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100003004 3300005339 Bacteria 11618
2 rootH1_10163640 3300003316 Bacteria 1361
3 rootH2_10092077 3300003320 Bacteria 3349
4 rootH1_10172836 3300003323 Bacteria 3124
5 Ga0065712_10001731 3300005290 Bacteria 5474
6 Ga0065712_10002118 3300005290 Bacteria 9321
7 Ga0065712_10146001 3300005290 Bacteria 1405
8 Ga0065707_10119376 3300005295 Bacteria 2160
9 Ga0070658_10127582 3300005327 Unclassified 2118
10 Ga0070658_10170493 3300005327 Bacteria 1828
11 Ga0070676_10036055 3300005328 Bacteria 2847
12 Ga0070676_10112455 3300005328 Bacteria 1697
13 Ga0070683_100000581 3300005329 Bacteria 26110
14 Ga0070683_100086580 3300005329 Bacteria 2937
15 Ga0070690_100108048 3300005330 Bacteria 1853
16 Ga0070690_100312617 3300005330 Bacteria 1130
17 Ga0070690_100562773 3300005330 Bacteria 861
18 Ga0070670_100122010 3300005331 Bacteria 2248
19 Ga0068869_100158682 3300005334 Bacteria 1759
20 Ga0068869_100216909 3300005334 Bacteria 1515
21 Ga0070666_10064122 3300005335 Bacteria 2491
22 Ga0070666_10367895 3300005335 Bacteria 1031
23 Ga0070680_100018132 3300005336 Bacteria 5561
24 Ga0070682_100000005 3300005337 Bacteria 386439
25 Ga0070682_100383345 3300005337 Bacteria 1058
26 Ga0068868_100022201 3300005338 Bacteria 4788
27 Ga0070660_100125334 3300005339 Bacteria 2052
28 Ga0070660_100233504 3300005339 Bacteria 1496
29 Ga0070689_100030123 3300005340 Bacteria 4116
30 Ga0070689_100070488 3300005340 Bacteria 2729
31 Ga0070689_100209583 3300005340 Bacteria 1594
32 Ga0070689_100614035 3300005340 Bacteria 943
33 Ga0070689_100778025 3300005340 Bacteria 840
34 Ga0070661_100007660 3300005344 Bacteria 7453
35 Ga0070661_100014509 3300005344 Bacteria 5551
36 Ga0070692_10027031 3300005345 Bacteria 2841
37 Ga0070675_100022640 3300005354 Bacteria 5021
38 Ga0070675_100048712 3300005354 Bacteria 3475
39 Ga0070675_100655067 3300005354 Bacteria 954
40 Ga0070671_100139355 3300005355 Bacteria 2046
41 Ga0070671_100262623 3300005355 Bacteria 1467
42 Ga0070673_100020618 3300005364 Bacteria 4756
43 Ga0070673_100183694 3300005364 Bacteria 1791
44 Ga0070673_100383058 3300005364 Bacteria 1254
45 Ga0070688_100010889 3300005365 Bacteria 5033
46 Ga0070688_100027820 3300005365 Bacteria 3369
47 Ga0070659_100002863 3300005366 Bacteria 12282
48 Ga0070659_100040993 3300005366 Bacteria 3618
49 Ga0070659_100101950 3300005366 Bacteria 2310
50 Ga0070667_100108184 3300005367 Bacteria 2408
51 Ga0070700_100252841 3300005441 Bacteria 1265
52 Ga0070700_100426044 3300005441 Bacteria 1004
53 Ga0070678_100417004 3300005456 Bacteria 1169
54 Ga0070662_100024818 3300005457 Bacteria 4134
55 Ga0070662_100115622 3300005457 Bacteria 2049
56 Ga0070662_100503427 3300005457 Bacteria 1010
57 Ga0070681_10010658 3300005458 Bacteria 9085
58 Ga0070681_10046288 3300005458 Bacteria 4349
59 Ga0068867_100074269 3300005459 Bacteria 2548
60 Ga0068867_100210473 3300005459 Bacteria 1561
61 Ga0068867_100299754 3300005459 Bacteria 1325
62 Ga0070685_10055041 3300005466 Bacteria 2310
63 Ga0070685_10129091 3300005466 Bacteria 1578
64 Ga0070679_100113460 3300005530 Bacteria 2695
65 Ga0070679_100115382 3300005530 Bacteria 2671
66 Ga0070684_100002069 3300005535 Bacteria 14795
67 Ga0070684_100066265 3300005535 Bacteria 3170
68 Ga0068853_100114363 3300005539 Bacteria 2400
69 Ga0070672_100240824 3300005543 Bacteria 1521
70 Ga0070686_100170859 3300005544 Bacteria 1537
71 Ga0070665_100324991 3300005548 Bacteria 1542
72 Ga0070704_100327128 3300005549 Bacteria 1286
73 Ga0068855_100000145 3300005563 Bacteria 91452
74 Ga0068855_100085707 3300005563 Bacteria 3644
75 Ga0070664_100001123 3300005564 Bacteria 21175
76 Ga0070664_100252629 3300005564 Bacteria 1585
77 Ga0070664_100276921 3300005564 Bacteria 1512
78 Ga0070664_100355933 3300005564 Bacteria 1333
79 Ga0068857_100022130 3300005577 Bacteria 5592
80 Ga0068857_100580351 3300005577 Bacteria 1058
81 Ga0068854_100033893 3300005578 Unclassified 3562
82 Ga0068854_100093581 3300005578 Bacteria 2240
83 Ga0068856_100145500 3300005614 Bacteria 2378
84 Ga0070702_100093939 3300005615 Bacteria 1825
85 Ga0068852_100200831 3300005616 Bacteria 1887
86 Ga0068859_100059196 3300005617 Bacteria 3859
87 Ga0068859_100173754 3300005617 Bacteria 2236
88 Ga0068859_100827435 3300005617 Bacteria 1012
89 Ga0068864_100024060 3300005618 Bacteria 5120
90 Ga0068864_100245717 3300005618 Bacteria 1659
91 Ga0068864_100386991 3300005618 Bacteria 1327
92 Ga0068861_100106884 3300005719 Bacteria 2236
93 Ga0068851_10021916 3300005834 Bacteria 3105
94 Ga0068870_10091087 3300005840 Bacteria 1705
95 Ga0068863_100412906 3300005841 Bacteria 1321
96 Ga0068858_100862343 3300005842 Bacteria 885
97 Ga0068862_100023456 3300005844 Bacteria 5170
98 Ga0097621_100015099 3300006237 Bacteria 5800
99 Ga0097621_100042302 3300006237 Bacteria 3669
100 Ga0097621_100082945 3300006237 Bacteria 2670
101 Ga0097621_100282455 3300006237 Bacteria 1461
102 Ga0068871_100060815 3300006358 Bacteria 3082
103 Ga0068871_100256659 3300006358 Bacteria 1524
104 Ga0075428_100309534 3300006844 Bacteria 1698
105 Ga0075428_100379521 3300006844 Bacteria 1515
106 Ga0075429_100036995 3300006880 Bacteria 4248
107 Ga0075429_100758147 3300006880 Bacteria 850
108 Ga0068865_100282592 3300006881 Bacteria 1322
109 Ga0097620_100059194 3300006931 Bacteria 3859
110 Ga0097620_100173766 3300006931 Bacteria 2236
111 Ga0097620_100827428 3300006931 Bacteria 1012
112 Ga0111539_10046988 3300009094 Bacteria 5161
113 Ga0111539_10518973 3300009094 Bacteria 1388
114 Ga0105247_10106048 3300009101 Bacteria 1802
115 Ga0114129_11142873 3300009147 Bacteria 973
116 Ga0105242_10032512 3300009176 Bacteria 4172
117 Ga0105242_10099826 3300009176 Bacteria 2457
118 Ga0105242_10166953 3300009176 Bacteria 1932
119 Ga0105242_10428216 3300009176 Bacteria 1242
120 Ga0105237_10099274 3300009545 Bacteria 2903
121 Ga0105249_10356148 3300009553 Unclassified 1484
122 Ga0105239_10127797 3300010375 Bacteria 2826
123 Ga0105246_10131755 3300011119 Bacteria 1868
124 Ga0105246_10778278 3300011119 Unclassified 847
125 Ga0157373_10007726 3300013100 Bacteria 7993
126 Ga0157373_10016542 3300013100 Bacteria 5378
127 Ga0157373_10053988 3300013100 Bacteria 2856
128 Ga0157373_10131796 3300013100 Bacteria 1758
129 Ga0157373_10133009 3300013100 Bacteria 1749
130 Ga0157371_10000807 3300013102 Bacteria 35968
131 Ga0157371_10006056 3300013102 Bacteria 10063
132 Ga0157371_10013884 3300013102 Bacteria 6101
133 Ga0157371_10022595 3300013102 Bacteria 4605
134 Ga0157371_10038590 3300013102 Bacteria 3417
135 Ga0157371_10042089 3300013102 Bacteria 3256
136 Ga0157371_10059033 3300013102 Bacteria 2721
137 Ga0157371_10074556 3300013102 Bacteria 2403
138 Ga0157371_10186798 3300013102 Bacteria 1483
139 Ga0157370_10018200 3300013104 Bacteria 7071
140 Ga0157370_10022768 3300013104 Bacteria 6232
141 Ga0157370_10307029 3300013104 Bacteria 1464
142 Ga0157369_10034553 3300013105 Bacteria 5547
143 Ga0157369_10148608 3300013105 Unclassified 2477
144 Ga0157374_10030435 3300013296 Bacteria 4901
145 Ga0157374_10190085 3300013296 Bacteria 2008
146 Ga0157378_10106039 3300013297 Bacteria 2570
147 Ga0163162_10001411 3300013306 Bacteria 22340
148 Ga0163162_10050623 3300013306 Bacteria 4165
149 Ga0163162_10369951 3300013306 Bacteria 1566
150 Ga0157372_10035869 3300013307 Bacteria 5461
151 Ga0157372_10036989 3300013307 Bacteria 5382
152 Ga0157372_10082790 3300013307 Bacteria 3633
153 Ga0157372_10175535 3300013307 Bacteria 2480
154 Ga0157372_10457003 3300013307 Bacteria 1488
155 Ga0157372_10624811 3300013307 Bacteria 1255
156 Ga0157372_10905617 3300013307 Bacteria 1023
157 Ga0157375_10126587 3300013308 Bacteria 2670
158 Ga0157375_10315630 3300013308 Bacteria 1727
159 Ga0157375_10382794 3300013308 Bacteria 1573
160 Ga0157375_10577438 3300013308 Bacteria 1285
161 Ga0157375_11082671 3300013308 Bacteria 938
162 Ga0163163_10003038 3300014325 Bacteria 14217
163 Ga0163163_10308168 3300014325 Bacteria 1636
164 Ga0163163_10424058 3300014325 Bacteria 1389
165 Ga0157380_10024748 3300014326 Bacteria 4547
166 Ga0157380_10490323 3300014326 Bacteria 1191
167 Ga0157377_10010498 3300014745 Bacteria 4583
168 Ga0157377_10038797 3300014745 Bacteria 2632
169 Ga0157379_10064716 3300014968 Bacteria 3268
170 Ga0157379_10072137 3300014968 Unclassified 3089
171 Ga0157379_10074576 3300014968 Bacteria 3037
172 Ga0157379_10123180 3300014968 Bacteria 2333
173 Ga0157379_10474574 3300014968 Bacteria 1157
174 Ga0157376_10077451 3300014969 Bacteria 2844
175 Ga0157376_10294380 3300014969 Bacteria 1534
176 Ga0163161_10099804 3300017792 Bacteria 2159
177 Ga0207656_10025366 3300025321 Bacteria 2406
178 Ga0207680_10237880 3300025903 Bacteria 1254
179 Ga0207647_10022167 3300025904 Unclassified 4224
180 Ga0207647_10043277 3300025904 Bacteria 2818
181 Ga0207643_10117515 3300025908 Bacteria 1572
182 Ga0207705_10027499 3300025909 Bacteria 4056
183 Ga0207705_10155334 3300025909 Bacteria 1716
184 Ga0207705_10192410 3300025909 Bacteria 1543
185 Ga0207707_10033294 3300025912 Bacteria 4510
186 Ga0207707_10177594 3300025912 Bacteria 1860
187 Ga0207660_10173210 3300025917 Bacteria 1671
188 Ga0207660_10297068 3300025917 Bacteria 1285
189 Ga0207657_10004627 3300025919 Bacteria 14535
190 Ga0207657_10103982 3300025919 Bacteria 2353
191 Ga0207657_10156666 3300025919 Bacteria 1852
192 Ga0207649_10001576 3300025920 Bacteria 13289
193 Ga0207649_10017177 3300025920 Bacteria 4098
194 Ga0207652_10000329 3300025921 Bacteria 49068
195 Ga0207652_10019855 3300025921 Bacteria 5532
196 Ga0207652_10087096 3300025921 Bacteria 2739
197 Ga0207652_10459270 3300025921 Bacteria 1148
198 Ga0207681_10019543 3300025923 Bacteria 4281
199 Ga0207650_10045279 3300025925 Bacteria 3237
200 Ga0207659_10043999 3300025926 Bacteria 3140
201 Ga0207644_10049440 3300025931 Bacteria 3011
202 Ga0207644_10614505 3300025931 Bacteria 903
203 Ga0207690_10009864 3300025932 Bacteria 5672
204 Ga0207706_10042546 3300025933 Bacteria 4026
205 Ga0207706_10106547 3300025933 Bacteria 2467
206 Ga0207706_10360936 3300025933 Bacteria 1262
207 Ga0207706_10547409 3300025933 Unclassified 996
208 Ga0207686_10009236 3300025934 Bacteria 5346
209 Ga0207670_10051887 3300025936 Bacteria 2756
210 Ga0207670_10140902 3300025936 Bacteria 1778
211 Ga0207691_10407933 3300025940 Unclassified 1159
212 Ga0207689_10178218 3300025942 Bacteria 1753
213 Ga0207689_10343421 3300025942 Bacteria 1240
214 Ga0207661_10020527 3300025944 Bacteria 4939
215 Ga0207661_10199736 3300025944 Bacteria 1757
216 Ga0207661_10294550 3300025944 Bacteria 1453
217 Ga0207679_10001887 3300025945 Bacteria 13021
218 Ga0207679_10407432 3300025945 Bacteria 1197
219 Ga0207679_10490740 3300025945 Bacteria 1095
220 Ga0207667_10000935 3300025949 Bacteria 37245
221 Ga0207667_10192191 3300025949 Bacteria 2094
222 Ga0207651_10023077 3300025960 Bacteria 3819
223 Ga0207651_10418456 3300025960 Bacteria 1143
224 Ga0207668_10014429 3300025972 Bacteria 4890
225 Ga0207703_10336807 3300026035 Bacteria 1385
226 Ga0207639_10044973 3300026041 Bacteria 3323
227 Ga0207678_10011923 3300026067 Bacteria 7635
228 Ga0207708_10157480 3300026075 Bacteria 1792
229 Ga0207702_10029232 3300026078 Bacteria 4585
230 Ga0207648_10113454 3300026089 Bacteria 2380
231 Ga0207648_10259445 3300026089 Bacteria 1551
232 Ga0207648_10297419 3300026089 Bacteria 1447
233 Ga0207676_10018213 3300026095 Bacteria 5102
234 Ga0207674_10027375 3300026116 Bacteria 6032
235 Ga0207674_10362706 3300026116 Bacteria 1400
236 Ga0207674_10457263 3300026116 Bacteria 1234
237 Ga0207675_100001208 3300026118 Bacteria 25725
238 Ga0207683_10091750 3300026121 Bacteria 2706
239 Ga0207428_10069115 3300027907 Bacteria 2777
240 Ga0268266_10322876 3300028379 Bacteria 1445
241 Ga0268265_10995402 3300028380 Bacteria 828
242 Ga0268264_10199885 3300028381 Bacteria 1828
243 Ga0268264_10323797 3300028381 Bacteria 1458
244 Ga0268264_10475364 3300028381 Bacteria 1215
245 Ga0268264_10824579 3300028381 Bacteria 928
246 Ga0307414_10070134 3300032004 Bacteria 2523
247 Ga0373944_0045247 3300035089 Bacteria 1373
248 Ga0373957_0040589 3300035120 Bacteria 1750
249 Ga0373955_0121955 3300035172 Bacteria 1516
250 Ga0373937_0020544 3300036401 Bacteria 5919
251 Ga0395899_0007973 3300037312 Bacteria 8158
252 Ga0395899_0012715 3300037312 Bacteria 6449
253 Ga0395899_0060824 3300037312 Bacteria 2782
254 Ga0395899_0210387 3300037312 Unclassified 1352
255 Ga0395900_0018367 3300037418 Bacteria 7132
256 Ga0395900_0058124 3300037418 Bacteria 3981
257 Ga0395900_0078119 3300037418 Bacteria 3401
258 Ga0395900_0181943 3300037418 Bacteria 2135
259 Ga0395898_0017242 3300037466 Bacteria 7374
260 Ga0395898_0023218 3300037466 Bacteria 6268
261 Ga0395898_0107055 3300037466 Bacteria 2681
262 Ga0395898_0227383 3300037466 Bacteria 1779
263 Ga0395905_0248594 3300037471 Bacteria 1661
264 Ga0395905_0764799 3300037471 Unclassified 869
265 Ga0395901_0001045 3300038443 Bacteria 29867
266 Ga0395901_0021296 3300038443 Bacteria 6640
267 Ga0395901_0097694 3300038443 Bacteria 3079
268 Ga0395901_0361626 3300038443 Bacteria 1496
269 Ga0395901_0440601 3300038443 Bacteria 1333
270 Ga0439439_0007899 3300041406 Bacteria 2500
271 Ga0439465_0032192 3300041413 Bacteria 1673
272 Ga0450898_000147 3300042134 Bacteria 7109
273 Ga0450899_002612 3300042135 Bacteria 1945
274 Ga0451577_0039691 3300042876 Bacteria 4230
275 Ga0451577_0616761 3300042876 Unclassified 984
276 Ga0466972_0153438 3300044658 Bacteria 1082
277 Ga0453683_0479642 3300044673 Unclassified 806
278 Ga0453684_0016378 3300044712 Bacteria 11598
279 Ga0451576_0325402 3300045051 Bacteria 1609
280 Ga0495645_0493890 3300046543 Bacteria 766
281 Ga0495668_0002132 3300046616 Bacteria 17045
282 Ga0495657_0093076 3300046675 Bacteria 1930
283 Ga0495613_0121709 3300046689 Bacteria 1874
284 Ga0496112_0276555 3300048915 Bacteria 1627
285 Ga0501032_0024841 3300049569 Bacteria 4134
286 Ga0501032_0551735 3300049569 Unclassified 735
287 Ga0501034_0034595 3300049571 Bacteria 5122
288 Ga0501039_0064622 3300049575 Bacteria 2837
289 Ga0501043_0039255 3300049579 Bacteria 3720
290 Ga0501046_0006347 3300049580 Bacteria 10481
291 Ga0501067_0007875 3300049583 Bacteria 5921
292 Ga0501070_0148671 3300049586 Bacteria 1933
293 Ga0501073_0006992 3300049589 Bacteria 8405
294 Ga0501080_0205302 3300049742 Unclassified 1807
295 Ga0501035_0194446 3300049822 Bacteria 1743
296 Ga0501044_0649720 3300049823 Bacteria 944
297 nmdc:mga09592_523002_c1 3300050508 Bacteria 1020
298 nmdc:mga09592_81418_c1 3300050508 Bacteria 2759
299 nmdc:mga08y16_107019_c1 3300050511 Bacteria 2911
300 Ga0500628_009850 3300053129 Bacteria 1695
301 2819590347 2818991444 Bacteria 6968812
302 Ga0070660_100003004
303 rootH1_10163640
304 rootH2_10092077
305 rootH1_10172836
306 Ga0065712_10001731
307 Ga0065712_10002118
308 Ga0065712_10146001
309 Ga0065707_10119376
310 Ga0070658_10127582
311 Ga0070658_10170493
312 Ga0070676_10036055
313 Ga0070676_10112455
314 Ga0070683_100000581
315 Ga0070683_100086580
316 Ga0070690_100108048
317 Ga0070690_100312617
318 Ga0070690_100562773
319 Ga0070670_100122010
320 Ga0068869_100158682
321 Ga0068869_100216909
322 Ga0070666_10064122
323 Ga0070666_10367895
324 Ga0070680_100018132
325 Ga0070682_100000005
326 Ga0070682_100383345
327 Ga0068868_100022201
328 Ga0070660_100125334
329 Ga0070660_100233504
330 Ga0070689_100030123
331 Ga0070689_100070488
332 Ga0070689_100209583
333 Ga0070689_100614035
334 Ga0070689_100778025
335 Ga0070661_100007660
336 Ga0070661_100014509
337 Ga0070692_10027031
338 Ga0070675_100022640
339 Ga0070675_100048712
340 Ga0070675_100655067
341 Ga0070671_100139355
342 Ga0070671_100262623
343 Ga0070673_100020618
344 Ga0070673_100183694
345 Ga0070673_100383058
346 Ga0070688_100010889
347 Ga0070688_100027820
348 Ga0070659_100002863
349 Ga0070659_100040993
350 Ga0070659_100101950
351 Ga0070667_100108184
352 Ga0070700_100252841
353 Ga0070700_100426044
354 Ga0070678_100417004
355 Ga0070662_100024818
356 Ga0070662_100115622
357 Ga0070662_100503427
358 Ga0070681_10010658
359 Ga0070681_10046288
360 Ga0068867_100074269
361 Ga0068867_100210473
362 Ga0068867_100299754
363 Ga0070685_10055041
364 Ga0070685_10129091
365 Ga0070679_100113460
366 Ga0070679_100115382
367 Ga0070684_100002069
368 Ga0070684_100066265
369 Ga0068853_100114363
370 Ga0070672_100240824
371 Ga0070686_100170859
372 Ga0070665_100324991
373 Ga0070704_100327128
374 Ga0068855_100000145
375 Ga0068855_100085707
376 Ga0070664_100001123
377 Ga0070664_100252629
378 Ga0070664_100276921
379 Ga0070664_100355933
380 Ga0068857_100022130
381 Ga0068857_100580351
382 Ga0068854_100033893
383 Ga0068854_100093581
384 Ga0068856_100145500
385 Ga0070702_100093939
386 Ga0068852_100200831
387 Ga0068859_100059196
388 Ga0068859_100173754
389 Ga0068859_100827435
390 Ga0068864_100024060
391 Ga0068864_100245717
392 Ga0068864_100386991
393 Ga0068861_100106884
394 Ga0068851_10021916
395 Ga0068870_10091087
396 Ga0068863_100412906
397 Ga0068858_100862343
398 Ga0068862_100023456
399 Ga0097621_100015099
400 Ga0097621_100042302
401 Ga0097621_100082945
402 Ga0097621_100282455
403 Ga0068871_100060815
404 Ga0068871_100256659
405 Ga0075428_100309534
406 Ga0075428_100379521
407 Ga0075429_100036995
408 Ga0075429_100758147
409 Ga0068865_100282592
410 Ga0097620_100059194
411 Ga0097620_100173766
412 Ga0097620_100827428
413 Ga0111539_10046988
414 Ga0111539_10518973
415 Ga0105247_10106048
416 Ga0114129_11142873
417 Ga0105242_10032512
418 Ga0105242_10099826
419 Ga0105242_10166953
420 Ga0105242_10428216
421 Ga0105237_10099274
422 Ga0105249_10356148
423 Ga0105239_10127797
424 Ga0105246_10131755
425 Ga0105246_10778278
426 Ga0157373_10007726
427 Ga0157373_10016542
428 Ga0157373_10053988
429 Ga0157373_10131796
430 Ga0157373_10133009
431 Ga0157371_10000807
432 Ga0157371_10006056
433 Ga0157371_10013884
434 Ga0157371_10022595
435 Ga0157371_10038590
436 Ga0157371_10042089
437 Ga0157371_10059033
438 Ga0157371_10074556
439 Ga0157371_10186798
440 Ga0157370_10018200
441 Ga0157370_10022768
442 Ga0157370_10307029
443 Ga0157369_10034553
444 Ga0157369_10148608
445 Ga0157374_10030435
446 Ga0157374_10190085
447 Ga0157378_10106039
448 Ga0163162_10001411
449 Ga0163162_10050623
450 Ga0163162_10369951
451 Ga0157372_10035869
452 Ga0157372_10036989
453 Ga0157372_10082790
454 Ga0157372_10175535
455 Ga0157372_10457003
456 Ga0157372_10624811
457 Ga0157372_10905617
458 Ga0157375_10126587
459 Ga0157375_10315630
460 Ga0157375_10382794
461 Ga0157375_10577438
462 Ga0157375_11082671
463 Ga0163163_10003038
464 Ga0163163_10308168
465 Ga0163163_10424058
466 Ga0157380_10024748
467 Ga0157380_10490323
468 Ga0157377_10010498
469 Ga0157377_10038797
470 Ga0157379_10064716
471 Ga0157379_10072137
472 Ga0157379_10074576
473 Ga0157379_10123180
474 Ga0157379_10474574
475 Ga0157376_10077451
476 Ga0157376_10294380
477 Ga0163161_10099804
478 Ga0207656_10025366
479 Ga0207680_10237880
480 Ga0207647_10022167
481 Ga0207647_10043277
482 Ga0207643_10117515
483 Ga0207705_10027499
484 Ga0207705_10155334
485 Ga0207705_10192410
486 Ga0207707_10033294
487 Ga0207707_10177594
488 Ga0207660_10173210
489 Ga0207660_10297068
490 Ga0207657_10004627
491 Ga0207657_10103982
492 Ga0207657_10156666
493 Ga0207649_10001576
494 Ga0207649_10017177
495 Ga0207652_10000329
496 Ga0207652_10019855
497 Ga0207652_10087096
498 Ga0207652_10459270
499 Ga0207681_10019543
500 Ga0207650_10045279
501 Ga0207659_10043999
502 Ga0207644_10049440
503 Ga0207644_10614505
504 Ga0207690_10009864
505 Ga0207706_10042546
506 Ga0207706_10106547
507 Ga0207706_10360936
508 Ga0207706_10547409
509 Ga0207686_10009236
510 Ga0207670_10051887
511 Ga0207670_10140902
512 Ga0207691_10407933
513 Ga0207689_10178218
514 Ga0207689_10343421
515 Ga0207661_10020527
516 Ga0207661_10199736
517 Ga0207661_10294550
518 Ga0207679_10001887
519 Ga0207679_10407432
520 Ga0207679_10490740
521 Ga0207667_10000935
522 Ga0207667_10192191
523 Ga0207651_10023077
524 Ga0207651_10418456
525 Ga0207668_10014429
526 Ga0207703_10336807
527 Ga0207639_10044973
528 Ga0207678_10011923
529 Ga0207708_10157480
530 Ga0207702_10029232
531 Ga0207648_10113454
532 Ga0207648_10259445
533 Ga0207648_10297419
534 Ga0207676_10018213
535 Ga0207674_10027375
536 Ga0207674_10362706
537 Ga0207674_10457263
538 Ga0207675_100001208
539 Ga0207683_10091750
540 Ga0207428_10069115
541 Ga0268266_10322876
542 Ga0268265_10995402
543 Ga0268264_10199885
544 Ga0268264_10323797
545 Ga0268264_10475364
546 Ga0268264_10824579
547 Ga0307414_10070134
548 Ga0373944_0045247
549 Ga0373957_0040589
550 Ga0373955_0121955
551 Ga0373937_0020544
552 Ga0395899_0007973
553 Ga0395899_0012715
554 Ga0395899_0060824
555 Ga0395899_0210387
556 Ga0395900_0018367
557 Ga0395900_0058124
558 Ga0395900_0078119
559 Ga0395900_0181943
560 Ga0395898_0017242
561 Ga0395898_0023218
562 Ga0395898_0107055
563 Ga0395898_0227383
564 Ga0395905_0248594
565 Ga0395905_0764799
566 Ga0395901_0001045
567 Ga0395901_0021296
568 Ga0395901_0097694
569 Ga0395901_0361626
570 Ga0395901_0440601
571 Ga0439439_0007899
572 Ga0439465_0032192
573 Ga0450898_000147
574 Ga0450899_002612
575 Ga0451577_0039691
576 Ga0451577_0616761
577 Ga0466972_0153438
578 Ga0453683_0479642
579 Ga0453684_0016378
580 Ga0451576_0325402
581 Ga0495645_0493890
582 Ga0495668_0002132
583 Ga0495657_0093076
584 Ga0495613_0121709
585 Ga0496112_0276555
586 Ga0501032_0024841
587 Ga0501032_0551735
588 Ga0501034_0034595
589 Ga0501039_0064622
590 Ga0501043_0039255
591 Ga0501046_0006347
592 Ga0501067_0007875
593 Ga0501070_0148671
594 Ga0501073_0006992
595 Ga0501080_0205302
596 Ga0501035_0194446
597 Ga0501044_0649720
598 nmdc:mga09592_523002_c1
599 nmdc:mga09592_81418_c1
600 nmdc:mga08y16_107019_c1
601 Ga0500628_009850
602 2819590347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

162

264

0.93

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

6

125

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8691 2 227
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8448 2 227
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8229 3 227
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.8174 1 227
6sgb-assembly1.cif.gz_FB mt-ssu assemblosome of trypanosoma brucei 0.8054 3 227
ID Description Score Start End Superfamily
af_Q54RR6_124_343_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9157 89 229 3.30.70.660
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.8961 90 220 3.30.70.660
1vs3B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.8867 89 227 3.30.70.660
af_A0A1D6HBJ9_162_299_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.8867 89 218 3.30.70.660
2nreA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.8812 89 223 3.30.70.660
ID Description Score Start End GO Terms
AF-A0A519UJY0-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9544 79 232 GO:0003723
GO:0031119
GO:0160147
AF-A0A4Q5HCY3-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9521 93 230 GO:0003723
GO:0031119
GO:0160147
AF-A0A521PIW6-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9515 90 227 GO:0003723
GO:0031119
GO:0160147
AF-A0A519K7A1-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9496 81 232 GO:0003723
GO:0031119
GO:0160147
AF-A0A6L3JRK0-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9489 115 232 GO:0003723
GO:0031119
GO:0160147

Map