F395650

General Info

Members Datasets Scaffolds Average Seq Length
300 215 600 323

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2929199973|2929201871
Length 371
Sequence AAVAGSEPLHVSILAIPEAVVSTLSGIFDVMNAFAILPPPGNAPGQAPPFRVEIVGLQPGPLQLASGVPTSVHRGIASLEATDIVIVPSVLLGPDGWQKGRHLELVEWLRAMHGRGALLCSACSGVFLLAETGLFDGMNATVHFGYARAFAAAYPAVPIHPERVLVVAGRREELITSGASMTWHDLVLYLIARHAGATAAQAMARFFALQWHQDGLAPYIVFEGRSDHGDRAVQAAQDWLATHFSVADPLQGMLRQTGLTERTFKRRFTGATGLSPIAYVQRLRVEDAKRRLERTEASVDEISWKVGYEEPAFFRRLFRRLTGLAPGAYRRRFRIPDYARPRQEAQEDRSGGKPAMTAGVMAPGKIRAGRP

Samples

Sample ID Description Type Environment
1 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
107 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
178 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
179 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
180 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
181 2643221597 Microbacterium sp. Root180 Isolate Unclassified
182 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
183 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
184 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
185 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
186 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
187 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
188 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
189 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
190 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
191 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
192 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
193 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
194 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
195 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
196 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
197 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
198 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
199 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
200 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
201 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
202 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
203 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
204 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
205 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
206 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
207 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
208 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
209 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
210 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
211 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
212 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
213 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
214 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
215 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87
Metatranscriptomes 0
Isolates 13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 7.67
Rhizoplane 3
Rhizosphere 71.67
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000103 3300002739 Bacteria 19779
2 JGI25152J39213_1001663 3300002773 Bacteria 9220
3 JGI25159J45721_1002524 3300002987 Bacteria 6887
4 JGI25153J46596_10001918 3300003215 Bacteria 12342
5 rootH1_10111124 3300003323 Bacteria 1495
6 JGI25161J50226_1000728 3300003374 Bacteria 12762
7 Ga0055526_1002123 3300003771 Bacteria 13606
8 Ga0055524_1007402 3300003775 Bacteria 4668
9 Ga0055524_1012271 3300003775 Bacteria 3297
10 Ga0055528_1001966 3300003790 Bacteria 11609
11 Ga0055540_1008717 3300003792 Bacteria 3608
12 Ga0055543_1000105 3300004625 Bacteria 73426
13 Ga0065165_1009584 3300005262 Bacteria 4319
14 Ga0065707_10091378 3300005295 Bacteria 3957
15 Ga0070676_10035129 3300005328 Unclassified 2881
16 Ga0070683_100044569 3300005329 Bacteria 4090
17 Ga0070666_10084959 3300005335 Bacteria 2167
18 Ga0068868_100056498 3300005338 Unclassified 3099
19 Ga0070687_100002486 3300005343 Bacteria 6936
20 Ga0070692_10006615 3300005345 Bacteria 5043
21 Ga0070668_100007883 3300005347 Bacteria 7906
22 Ga0070668_100037500 3300005347 Unclassified 3701
23 Ga0070668_100205076 3300005347 Bacteria 1620
24 Ga0070669_100034269 3300005353 Bacteria 3676
25 Ga0070669_100119820 3300005353 Bacteria 2006
26 Ga0070675_100011349 3300005354 Bacteria 6972
27 Ga0070675_100050180 3300005354 Bacteria 3426
28 Ga0070673_100013427 3300005364 Bacteria 5665
29 Ga0070688_100059094 3300005365 Bacteria 2416
30 Ga0070678_100151010 3300005456 Bacteria 1871
31 Ga0070662_100131008 3300005457 Bacteria 1933
32 Ga0070698_100076918 3300005471 Bacteria 3338
33 Ga0068853_100006004 3300005539 Bacteria 9605
34 Ga0070672_100115930 3300005543 Bacteria 2188
35 Ga0070665_100204661 3300005548 Bacteria 1974
36 Ga0068855_100047100 3300005563 Bacteria 5095
37 Ga0068854_100338182 3300005578 Bacteria 1229
38 Ga0068852_100021823 3300005616 Bacteria 5122
39 Ga0068859_100066607 3300005617 Bacteria 3636
40 Ga0068859_100138705 3300005617 Bacteria 2505
41 Ga0068863_100030872 3300005841 Bacteria 5117
42 Ga0068860_100015080 3300005843 Bacteria 7552
43 Ga0068862_100137302 3300005844 Bacteria 2168
44 Ga0081538_10004904 3300005981 Bacteria 12192
45 Ga0075363_100083937 3300006048 Bacteria 1746
46 Ga0075428_100008311 3300006844 Bacteria 11502
47 Ga0075428_100359236 3300006844 Bacteria 1563
48 Ga0075430_100058414 3300006846 Bacteria 3243
49 Ga0075430_100110781 3300006846 Bacteria 2289
50 Ga0075431_100001102 3300006847 Bacteria 24204
51 Ga0075431_100073218 3300006847 Bacteria 3534
52 Ga0075433_10047865 3300006852 Unclassified 3719
53 Ga0075434_100035999 3300006871 Bacteria 4895
54 Ga0075429_100014657 3300006880 Bacteria 6797
55 Ga0075429_100019697 3300006880 Bacteria 5850
56 Ga0075429_100099447 3300006880 Bacteria 2538
57 Ga0075429_100202913 3300006880 Bacteria 1737
58 Ga0068865_100046451 3300006881 Unclassified 2979
59 Ga0097620_100066610 3300006931 Bacteria 3636
60 Ga0097620_100138701 3300006931 Bacteria 2505
61 Ga0079104_1000013 3300006946 Bacteria 349477
62 Ga0079104_1002912 3300006946 Bacteria 8518
63 Ga0111539_10003635 3300009094 Bacteria 20316
64 Ga0114129_10000142 3300009147 Bacteria 75322
65 Ga0105241_10330183 3300009174 Bacteria 1318
66 Ga0105248_10010042 3300009177 Bacteria 10425
67 Ga0105238_10310356 3300009551 Bacteria 1562
68 Ga0105249_10065856 3300009553 Bacteria 3334
69 Ga0163162_10001281 3300013306 Bacteria 23539
70 Ga0163162_10003975 3300013306 Bacteria 14175
71 Ga0157372_10016850 3300013307 Bacteria 7844
72 Ga0157380_10171761 3300014326 Bacteria 1895
73 Ga0157379_10028892 3300014968 Bacteria 4932
74 Ga0163161_10023302 3300017792 Bacteria 4367
75 Ga0209436_100022 3300025208 Bacteria 96695
76 Ga0209129_1000508 3300025258 Bacteria 27984
77 Ga0209673_1000688 3300025273 Bacteria 48492
78 Ga0209130_1000002 3300025284 Bacteria 722648
79 Ga0209675_1001115 3300025291 Bacteria 16357
80 Ga0209025_1017023 3300025294 Bacteria 4233
81 Ga0209564_1000262 3300025295 Bacteria 112256
82 Ga0209758_1006922 3300025297 Bacteria 7912
83 Ga0209256_1002147 3300025299 Bacteria 17031
84 Ga0209256_1004436 3300025299 Bacteria 8819
85 Ga0207426_1000013 3300025302 Bacteria 721897
86 Ga0209051_1003203 3300025303 Bacteria 10925
87 Ga0207688_10023604 3300025901 Bacteria 3370
88 Ga0207647_10059542 3300025904 Bacteria 2337
89 Ga0207645_10001351 3300025907 Bacteria 20143
90 Ga0207662_10025564 3300025918 Unclassified 3401
91 Ga0207657_10024278 3300025919 Bacteria 5620
92 Ga0207659_10218293 3300025926 Bacteria 1531
93 Ga0207644_10080785 3300025931 Bacteria 2401
94 Ga0207706_10000350 3300025933 Bacteria 49761
95 Ga0207706_10115958 3300025933 Bacteria 2356
96 Ga0207670_10049102 3300025936 Bacteria 2820
97 Ga0207704_10018885 3300025938 Bacteria 3609
98 Ga0207691_10015803 3300025940 Bacteria 7172
99 Ga0207691_10059227 3300025940 Bacteria 3482
100 Ga0207711_10033435 3300025941 Bacteria 4351
101 Ga0207667_10032761 3300025949 Bacteria 5595
102 Ga0207651_10203820 3300025960 Bacteria 1587
103 Ga0207712_10039853 3300025961 Unclassified 3221
104 Ga0207668_10004812 3300025972 Bacteria 7946
105 Ga0207668_10017827 3300025972 Bacteria 4456
106 Ga0207658_10072951 3300025986 Bacteria 2604
107 Ga0207708_10014148 3300026075 Bacteria 5965
108 Ga0207698_10068725 3300026142 Unclassified 2798
109 Ga0209281_1000076 3300027111 Bacteria 263350
110 Ga0209281_1002139 3300027111 Bacteria 8695
111 Ga0268266_10074062 3300028379 Bacteria 2957
112 Ga0268266_10130893 3300028379 Bacteria 2244
113 Ga0307515_10000006 3300028794 Bacteria 725810
114 Ga0307513_10222512 3300031456 Bacteria 1707
115 Ga0307513_10308055 3300031456 Bacteria 1347
116 Ga0307408_100223443 3300031548 Bacteria 1538
117 Ga0316576_10033700 3300031727 Bacteria 3647
118 Ga0307405_10003973 3300031731 Bacteria 6924
119 Ga0307405_10070324 3300031731 Bacteria 2247
120 Ga0307413_10064218 3300031824 Bacteria 2280
121 Ga0307413_10072764 3300031824 Bacteria 2170
122 Ga0307413_10204209 3300031824 Bacteria 1429
123 Ga0307410_10020503 3300031852 Bacteria 4044
124 Ga0307410_10041847 3300031852 Bacteria 3024
125 Ga0307410_10082674 3300031852 Bacteria 2259
126 Ga0307406_10024381 3300031901 Bacteria 3613
127 Ga0307406_10280122 3300031901 Bacteria 1271
128 Ga0307406_10303878 3300031901 Bacteria 1227
129 Ga0307407_10008276 3300031903 Bacteria 4765
130 Ga0307407_10009132 3300031903 Bacteria 4600
131 Ga0307407_10012341 3300031903 Bacteria 4102
132 Ga0307407_10030794 3300031903 Bacteria 2898
133 Ga0307412_10260208 3300031911 Bacteria 1352
134 Ga0307409_100089428 3300031995 Bacteria 2517
135 Ga0307409_100257782 3300031995 Bacteria 1598
136 Ga0307416_100107304 3300032002 Bacteria 2450
137 Ga0307416_100284566 3300032002 Bacteria 1632
138 Ga0307414_10055972 3300032004 Bacteria 2764
139 Ga0307414_10084413 3300032004 Bacteria 2336
140 Ga0307414_10106408 3300032004 Bacteria 2123
141 Ga0316584_0167648 3300036712 Bacteria 1630
142 Ga0439436_0007469 3300041404 Bacteria 3363
143 Ga0439439_0018493 3300041406 Bacteria 1722
144 Ga0439465_0011041 3300041413 Bacteria 2834
145 Ga0439445_0005558 3300042004 Unclassified 2875
146 Ga0439449_0018316 3300042007 Bacteria 2628
147 Ga0439462_0004152 3300042015 Bacteria 3521
148 Ga0439435_0008046 3300042436 Bacteria 2436
149 Ga0439435_0023788 3300042436 Bacteria 1611
150 Ga0450918_023879 3300042531 Unclassified 1069
151 Ga0451577_0279295 3300042876 Bacteria 1513
152 Ga0453684_0121797 3300044712 Bacteria 3148
153 Ga0451576_0025197 3300045051 Bacteria 6411
154 Ga0451576_0112510 3300045051 Bacteria 2833
155 Ga0451576_0179678 3300045051 Unclassified 2209
156 Ga0495603_0216531 3300046455 Bacteria 1105
157 Ga0495638_0011712 3300046460 Bacteria 6041
158 Ga0495650_0013588 3300046471 Bacteria 4296
159 Ga0495605_0010083 3300046474 Bacteria 5293
160 Ga0495610_0112517 3300046512 Bacteria 1204
161 Ga0495643_0071925 3300046522 Bacteria 1814
162 Ga0495621_0006044 3300046539 Bacteria 3515
163 Ga0495670_0010986 3300046691 Bacteria 4451
164 Ga0495589_0007491 3300046794 Bacteria 5721
165 Ga0495660_0106276 3300046810 Bacteria 1438
166 Ga0495626_0013801 3300048091 Bacteria 4190
167 Ga0496102_0038980 3300048905 Bacteria 4291
168 Ga0496103_0082203 3300048906 Bacteria 2027
169 Ga0496105_0158568 3300048908 Bacteria 1858
170 Ga0496106_0019366 3300048909 Bacteria 5047
171 Ga0496106_0050408 3300048909 Bacteria 3138
172 Ga0496106_0101972 3300048909 Bacteria 2226
173 Ga0496108_0301292 3300048911 Bacteria 1396
174 Ga0496110_0032402 3300048913 Bacteria 4513
175 Ga0496114_0125957 3300048917 Bacteria 2208
176 Ga0501032_0042424 3300049569 Bacteria 3086
177 Ga0501032_0093734 3300049569 Bacteria 1991
178 Ga0501032_0225612 3300049569 Bacteria 1219
179 Ga0501034_0171204 3300049571 Bacteria 2139
180 Ga0501036_0004752 3300049572 Bacteria 10966
181 Ga0501036_0082235 3300049572 Bacteria 2722
182 Ga0501038_0002784 3300049574 Bacteria 16268
183 Ga0501038_0083833 3300049574 Bacteria 2683
184 Ga0501038_0255937 3300049574 Bacteria 1385
185 Ga0501039_0001310 3300049575 Bacteria 18197
186 Ga0501040_0005087 3300049576 Bacteria 8500
187 Ga0501041_0183493 3300049577 Bacteria 1310
188 Ga0501042_0005091 3300049578 Bacteria 8433
189 Ga0501042_0020699 3300049578 Bacteria 4580
190 Ga0501043_0270749 3300049579 Bacteria 1304
191 Ga0501046_0016630 3300049580 Bacteria 6156
192 Ga0501046_0017606 3300049580 Bacteria 5960
193 Ga0501047_0045889 3300049581 Bacteria 4224
194 Ga0501047_0062622 3300049581 Bacteria 3588
195 Ga0501048_0030971 3300049582 Bacteria 3872
196 Ga0501048_0053985 3300049582 Bacteria 2855
197 Ga0501067_0083837 3300049583 Bacteria 1768
198 Ga0501068_0142824 3300049584 Bacteria 1501
199 Ga0501068_0168766 3300049584 Bacteria 1380
200 Ga0501071_0011960 3300049587 Bacteria 5863
201 Ga0501072_0005486 3300049588 Bacteria 9656
202 Ga0501072_0020219 3300049588 Bacteria 5156
203 Ga0501072_0114567 3300049588 Bacteria 2146
204 Ga0501072_0296097 3300049588 Bacteria 1286
205 Ga0501073_0070306 3300049589 Bacteria 2438
206 Ga0501073_0125931 3300049589 Bacteria 1776
207 Ga0501074_0041690 3300049590 Bacteria 3323
208 Ga0501075_0002432 3300049591 Bacteria 12396
209 Ga0501075_0052750 3300049591 Bacteria 3058
210 Ga0501075_0090415 3300049591 Bacteria 2322
211 Ga0501075_0151662 3300049591 Bacteria 1766
212 Ga0501076_0001612 3300049592 Bacteria 15200
213 Ga0501076_0005418 3300049592 Bacteria 9173
214 Ga0501076_0013687 3300049592 Bacteria 6086
215 Ga0501077_0002773 3300049593 Bacteria 10510
216 Ga0501077_0010897 3300049593 Bacteria 5665
217 Ga0501077_0146527 3300049593 Bacteria 1498
218 Ga0501257_008394 3300049686 Bacteria 2320
219 Ga0501079_0004348 3300049741 Bacteria 10514
220 Ga0501079_0295209 3300049741 Bacteria 1268
221 Ga0501080_0004709 3300049742 Bacteria 12178
222 Ga0501080_0009515 3300049742 Bacteria 8867
223 Ga0501080_0017072 3300049742 Bacteria 6704
224 Ga0501081_0000881 3300049743 Bacteria 17721
225 Ga0501081_0045741 3300049743 Bacteria 3006
226 Ga0501083_0036988 3300049744 Bacteria 3327
227 Ga0501035_0022819 3300049822 Bacteria 5747
228 Ga0501045_0003227 3300049824 Bacteria 11142
229 Ga0501045_0017955 3300049824 Bacteria 5024
230 Ga0501045_0019961 3300049824 Bacteria 4783
231 nmdc:mga05p37_46_c1 3300050507 Bacteria 105665
232 nmdc:mga09592_2154_c1 3300050508 Bacteria 15884
233 nmdc:mga09592_283177_c1 3300050508 Bacteria 1438
234 nmdc:mga09592_5002_c1 3300050508 Bacteria 10744
235 nmdc:mga0qj67_120031_c1 3300050509 Bacteria 2126
236 nmdc:mga0qj67_41530_c1 3300050509 Bacteria 3618
237 nmdc:mga06r32_1750_c1 3300050510 Bacteria 19511
238 nmdc:mga06r32_26085_c1 3300050510 Bacteria 5445
239 nmdc:mga08y16_2064_c1 3300050511 Bacteria 20583
240 nmdc:mga0n895_11844_c1 3300050512 Bacteria 7798
241 nmdc:mga0n895_203976_c1 3300050512 Bacteria 2008
242 Ga0500644_0086533 3300053088 Bacteria 1164
243 Ga0500658_0028450 3300053134 Bacteria 2169
244 Ga0500568_0000654 3300053139 Bacteria 24999
245 Ga0500616_0000181 3300053153 Bacteria 104316
246 Ga0500622_0005192 3300053156 Bacteria 7885
247 Ga0501084_0002853 3300054114 Bacteria 13968
248 Ga0501084_0009094 3300054114 Bacteria 8220
249 Ga0501084_0079863 3300054114 Bacteria 2742
250 Ga0501084_0206314 3300054114 Bacteria 1658
251 Ga0501082_0003210 3300060353 Bacteria 14247
252 Ga0501082_0031776 3300060353 Bacteria 4553
253 Ga0501082_0034399 3300060353 Bacteria 4369
254 Ga0501082_0040788 3300060353 Bacteria 4003
255 Ga0501082_0048216 3300060353 Bacteria 3671
256 Ga0501082_0146863 3300060353 Bacteria 2047
257 Ga0501082_0177135 3300060353 Bacteria 1854
258 Ga0530510_0006768 3300061734 Bacteria 7987
259 Ga0530510_0006773 3300061734 Bacteria 7983
260 Ga0530510_0036151 3300061734 Bacteria 3560
261 Ga0530510_0175952 3300061734 Bacteria 1586
262 2929201871 2929199973 Bacteria 7260745
263 2509110762 2508501122 Bacteria 6292184
264 2515611913 2515154107 Bacteria 6795637
265 2599414617 2599185170 Bacteria 7295545
266 2643996777 2643221597 Bacteria 3347721
267 2644029451 2643221603 Bacteria 6147767
268 2657681226 2657244999 Bacteria 5946535
269 2776269154 2775506902 Bacteria 6208009
270 2776283707 2775506904 Bacteria 5954060
271 2792623414 2791355091 Bacteria 6135441
272 2792630253 2791355092 Bacteria 6248105
273 2804752426 2802429268 Bacteria 6094027
274 2838036978 2838035591 Bacteria 7166484
275 2838079490 2838074704 Bacteria 6785777
276 2840768770 2840764183 Bacteria 6358399
277 2847690146 2847686936 Bacteria 6278406
278 2848998794 2848992105 Bacteria 6810864
279 2850083999 2850079185 Bacteria 6848280
280 2854897890 2854896431 Bacteria 5869725
281 2854920667 2854916844 Bacteria 5725939
282 2855873037 2855872281 Bacteria 6964271
283 2874104495 2874102143 Bacteria 6342645
284 2889795919 2889790730 Bacteria 5689708
285 2896384954 2896384573 Bacteria 7700774
286 2906333995 2906328253 Bacteria 6585166
287 2920765817 2920760137 Bacteria 7427611
288 2937897985 2937891427 Bacteria 6357007
289 2958120317 2958115193 Bacteria 6923548
290 2965062482 2965062239 Bacteria 7412989
291 2968093429 2968091066 Bacteria 6052692
292 2968098142 2968097103 Bacteria 6107094
293 2968129552 2968128360 Bacteria 6270294
294 2977862814 2977858184 Bacteria 6215359
295 2979785261 2979779861 Bacteria 6219781
296 3005450151 3005445848 Bacteria 6906074
297 8004447724 8004445564 Bacteria 6322258
298 8004706527 8004703790 Bacteria 8006957
299 8049295163 8049293176 Bacteria 6128433
300 8055910860 8055909800 Bacteria 7278581
301 JGI25158J39367_1000103
302 JGI25152J39213_1001663
303 JGI25159J45721_1002524
304 JGI25153J46596_10001918
305 rootH1_10111124
306 JGI25161J50226_1000728
307 Ga0055526_1002123
308 Ga0055524_1007402
309 Ga0055524_1012271
310 Ga0055528_1001966
311 Ga0055540_1008717
312 Ga0055543_1000105
313 Ga0065165_1009584
314 Ga0065707_10091378
315 Ga0070676_10035129
316 Ga0070683_100044569
317 Ga0070666_10084959
318 Ga0068868_100056498
319 Ga0070687_100002486
320 Ga0070692_10006615
321 Ga0070668_100007883
322 Ga0070668_100037500
323 Ga0070668_100205076
324 Ga0070669_100034269
325 Ga0070669_100119820
326 Ga0070675_100011349
327 Ga0070675_100050180
328 Ga0070673_100013427
329 Ga0070688_100059094
330 Ga0070678_100151010
331 Ga0070662_100131008
332 Ga0070698_100076918
333 Ga0068853_100006004
334 Ga0070672_100115930
335 Ga0070665_100204661
336 Ga0068855_100047100
337 Ga0068854_100338182
338 Ga0068852_100021823
339 Ga0068859_100066607
340 Ga0068859_100138705
341 Ga0068863_100030872
342 Ga0068860_100015080
343 Ga0068862_100137302
344 Ga0081538_10004904
345 Ga0075363_100083937
346 Ga0075428_100008311
347 Ga0075428_100359236
348 Ga0075430_100058414
349 Ga0075430_100110781
350 Ga0075431_100001102
351 Ga0075431_100073218
352 Ga0075433_10047865
353 Ga0075434_100035999
354 Ga0075429_100014657
355 Ga0075429_100019697
356 Ga0075429_100099447
357 Ga0075429_100202913
358 Ga0068865_100046451
359 Ga0097620_100066610
360 Ga0097620_100138701
361 Ga0079104_1000013
362 Ga0079104_1002912
363 Ga0111539_10003635
364 Ga0114129_10000142
365 Ga0105241_10330183
366 Ga0105248_10010042
367 Ga0105238_10310356
368 Ga0105249_10065856
369 Ga0163162_10001281
370 Ga0163162_10003975
371 Ga0157372_10016850
372 Ga0157380_10171761
373 Ga0157379_10028892
374 Ga0163161_10023302
375 Ga0209436_100022
376 Ga0209129_1000508
377 Ga0209673_1000688
378 Ga0209130_1000002
379 Ga0209675_1001115
380 Ga0209025_1017023
381 Ga0209564_1000262
382 Ga0209758_1006922
383 Ga0209256_1002147
384 Ga0209256_1004436
385 Ga0207426_1000013
386 Ga0209051_1003203
387 Ga0207688_10023604
388 Ga0207647_10059542
389 Ga0207645_10001351
390 Ga0207662_10025564
391 Ga0207657_10024278
392 Ga0207659_10218293
393 Ga0207644_10080785
394 Ga0207706_10000350
395 Ga0207706_10115958
396 Ga0207670_10049102
397 Ga0207704_10018885
398 Ga0207691_10015803
399 Ga0207691_10059227
400 Ga0207711_10033435
401 Ga0207667_10032761
402 Ga0207651_10203820
403 Ga0207712_10039853
404 Ga0207668_10004812
405 Ga0207668_10017827
406 Ga0207658_10072951
407 Ga0207708_10014148
408 Ga0207698_10068725
409 Ga0209281_1000076
410 Ga0209281_1002139
411 Ga0268266_10074062
412 Ga0268266_10130893
413 Ga0307515_10000006
414 Ga0307513_10222512
415 Ga0307513_10308055
416 Ga0307408_100223443
417 Ga0316576_10033700
418 Ga0307405_10003973
419 Ga0307405_10070324
420 Ga0307413_10064218
421 Ga0307413_10072764
422 Ga0307413_10204209
423 Ga0307410_10020503
424 Ga0307410_10041847
425 Ga0307410_10082674
426 Ga0307406_10024381
427 Ga0307406_10280122
428 Ga0307406_10303878
429 Ga0307407_10008276
430 Ga0307407_10009132
431 Ga0307407_10012341
432 Ga0307407_10030794
433 Ga0307412_10260208
434 Ga0307409_100089428
435 Ga0307409_100257782
436 Ga0307416_100107304
437 Ga0307416_100284566
438 Ga0307414_10055972
439 Ga0307414_10084413
440 Ga0307414_10106408
441 Ga0316584_0167648
442 Ga0439436_0007469
443 Ga0439439_0018493
444 Ga0439465_0011041
445 Ga0439445_0005558
446 Ga0439449_0018316
447 Ga0439462_0004152
448 Ga0439435_0008046
449 Ga0439435_0023788
450 Ga0450918_023879
451 Ga0451577_0279295
452 Ga0453684_0121797
453 Ga0451576_0025197
454 Ga0451576_0112510
455 Ga0451576_0179678
456 Ga0495603_0216531
457 Ga0495638_0011712
458 Ga0495650_0013588
459 Ga0495605_0010083
460 Ga0495610_0112517
461 Ga0495643_0071925
462 Ga0495621_0006044
463 Ga0495670_0010986
464 Ga0495589_0007491
465 Ga0495660_0106276
466 Ga0495626_0013801
467 Ga0496102_0038980
468 Ga0496103_0082203
469 Ga0496105_0158568
470 Ga0496106_0019366
471 Ga0496106_0050408
472 Ga0496106_0101972
473 Ga0496108_0301292
474 Ga0496110_0032402
475 Ga0496114_0125957
476 Ga0501032_0042424
477 Ga0501032_0093734
478 Ga0501032_0225612
479 Ga0501034_0171204
480 Ga0501036_0004752
481 Ga0501036_0082235
482 Ga0501038_0002784
483 Ga0501038_0083833
484 Ga0501038_0255937
485 Ga0501039_0001310
486 Ga0501040_0005087
487 Ga0501041_0183493
488 Ga0501042_0005091
489 Ga0501042_0020699
490 Ga0501043_0270749
491 Ga0501046_0016630
492 Ga0501046_0017606
493 Ga0501047_0045889
494 Ga0501047_0062622
495 Ga0501048_0030971
496 Ga0501048_0053985
497 Ga0501067_0083837
498 Ga0501068_0142824
499 Ga0501068_0168766
500 Ga0501071_0011960
501 Ga0501072_0005486
502 Ga0501072_0020219
503 Ga0501072_0114567
504 Ga0501072_0296097
505 Ga0501073_0070306
506 Ga0501073_0125931
507 Ga0501074_0041690
508 Ga0501075_0002432
509 Ga0501075_0052750
510 Ga0501075_0090415
511 Ga0501075_0151662
512 Ga0501076_0001612
513 Ga0501076_0005418
514 Ga0501076_0013687
515 Ga0501077_0002773
516 Ga0501077_0010897
517 Ga0501077_0146527
518 Ga0501257_008394
519 Ga0501079_0004348
520 Ga0501079_0295209
521 Ga0501080_0004709
522 Ga0501080_0009515
523 Ga0501080_0017072
524 Ga0501081_0000881
525 Ga0501081_0045741
526 Ga0501083_0036988
527 Ga0501035_0022819
528 Ga0501045_0003227
529 Ga0501045_0017955
530 Ga0501045_0019961
531 nmdc:mga05p37_46_c1
532 nmdc:mga09592_2154_c1
533 nmdc:mga09592_283177_c1
534 nmdc:mga09592_5002_c1
535 nmdc:mga0qj67_120031_c1
536 nmdc:mga0qj67_41530_c1
537 nmdc:mga06r32_1750_c1
538 nmdc:mga06r32_26085_c1
539 nmdc:mga08y16_2064_c1
540 nmdc:mga0n895_11844_c1
541 nmdc:mga0n895_203976_c1
542 Ga0500644_0086533
543 Ga0500658_0028450
544 Ga0500568_0000654
545 Ga0500616_0000181
546 Ga0500622_0005192
547 Ga0501084_0002853
548 Ga0501084_0009094
549 Ga0501084_0079863
550 Ga0501084_0206314
551 Ga0501082_0003210
552 Ga0501082_0031776
553 Ga0501082_0034399
554 Ga0501082_0040788
555 Ga0501082_0048216
556 Ga0501082_0146863
557 Ga0501082_0177135
558 Ga0530510_0006768
559 Ga0530510_0006773
560 Ga0530510_0036151
561 Ga0530510_0175952
562 2929201871
563 2509110762
564 2515611913
565 2599414617
566 2643996777
567 2644029451
568 2657681226
569 2776269154
570 2776283707
571 2792623414
572 2792630253
573 2804752426
574 2838036978
575 2838079490
576 2840768770
577 2847690146
578 2848998794
579 2850083999
580 2854897890
581 2854920667
582 2855873037
583 2874104495
584 2889795919
585 2896384954
586 2906333995
587 2920765817
588 2937897985
589 2958120317
590 2965062482
591 2968093429
592 2968098142
593 2968129552
594 2977862814
595 2979785261
596 3005450151
597 8004447724
598 8004706527
599 8049295163
600 8055910860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

253

332

0.97

PF01965

DJ-1_PfpI

DJ-1/PfpI family

46

193

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.8898 237 312
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.8896 236 312
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8668 235 313
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.866 235 312
1bl0-assembly1.cif.gz_A multiple antibiotic resistance protein (mara)/dna complex 0.8656 234 313
ID Description Score Start End Superfamily
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9032 235 291 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9013 237 312 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8898 237 312 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8768 231 312 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8644 235 312 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A529HQA1-F1-model_v4 Transcriptional regulator 0.959 66 201 GO:0006355
AF-A0A529HQA1-F1-model_v4 Transcriptional regulator 0.9453 66 201 GO:0006355
AF-A0A353D1Y4-F1-model_v4 AraC family transcriptional regulator 0.9339 10 216 GO:0006355
AF-A0A511N4N4-F1-model_v4 Glutamine amidotransferase 0.9159 13 212 GO:0006355
GO:0016740
AF-A0A7T2S1W1-F1-model_v4 DJ-1/PfpI family protein 0.907 11 212 GO:0006355

Map