F395209

General Info

Members Datasets Scaffolds Average Seq Length
300 167 294 130

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100521823|Ga0070660_1005218231
Length 156
Sequence VQQKSNFEEVFFYSSSHLYISKQQNSFKMKIKLVSVLVDDQDKALKFYTDVLGFVKKTEVPMGKHKWLTVVSKDERDGAELVLEPISFEPAKVFQKELFNAGIPWTAFNVDNVDKEYERLTNLGVTFSMKPTEMGPTKLAVFNDTCGNNIQIFEVL

Samples

Sample ID Description Type Environment
1 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
2 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
3 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
6 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
145 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
146 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
147 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 0.33
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10249136 3300003320 Bacteria 2436
2 rootL2_10047213 3300003322 Bacteria 5202
3 rootL2_10231404 3300003322 Bacteria 3502
4 rootH1_10101256 3300003323 Bacteria 11149
5 Ga0065165_1003325 3300005262 Bacteria 11490
6 Ga0065704_10320525 3300005289 Bacteria 853
7 Ga0065712_10163086 3300005290 Bacteria 1285
8 Ga0065712_10255182 3300005290 Unclassified 950
9 Ga0065715_10246349 3300005293 Bacteria 1177
10 Ga0065715_10575188 3300005293 Bacteria 724
11 Ga0065707_10303266 3300005295 Bacteria 1000
12 Ga0070676_10295048 3300005328 Bacteria 1097
13 Ga0070676_10336053 3300005328 Unclassified 1034
14 Ga0070676_10430192 3300005328 Bacteria 924
15 Ga0070676_10506563 3300005328 Bacteria 858
16 Ga0070683_100007262 3300005329 Bacteria 9346
17 Ga0070670_100244778 3300005331 Bacteria 1561
18 Ga0070670_101215590 3300005331 Bacteria 689
19 Ga0068869_100146582 3300005334 Bacteria 1827
20 Ga0068869_100582526 3300005334 Bacteria 943
21 Ga0070666_10044141 3300005335 Bacteria 2985
22 Ga0070666_10132642 3300005335 Bacteria 1732
23 Ga0070666_11460637 3300005335 Unclassified 511
24 Ga0068868_100289878 3300005338 Bacteria 1387
25 Ga0070660_100521823 3300005339 Bacteria 989
26 Ga0070660_101770606 3300005339 Bacteria 526
27 Ga0070689_102151294 3300005340 Bacteria 511
28 Ga0070661_100002162 3300005344 Bacteria 13543
29 Ga0070661_100616069 3300005344 Bacteria 879
30 Ga0070668_100246435 3300005347 Bacteria 1482
31 Ga0070668_100680369 3300005347 Bacteria 906
32 Ga0070669_100094023 3300005353 Bacteria 2252
33 Ga0070669_100195482 3300005353 Bacteria 1589
34 Ga0070675_100021380 3300005354 Bacteria 5170
35 Ga0070675_100024443 3300005354 Bacteria 4838
36 Ga0070675_100232703 3300005354 Bacteria 1608
37 Ga0070671_100087442 3300005355 Bacteria 2608
38 Ga0070674_100074664 3300005356 Bacteria 2406
39 Ga0070674_100411680 3300005356 Bacteria 1107
40 Ga0070674_100472243 3300005356 Bacteria 1039
41 Ga0070673_100085469 3300005364 Bacteria 2568
42 Ga0070673_100105836 3300005364 Bacteria 2325
43 Ga0070688_100256617 3300005365 Bacteria 1247
44 Ga0070659_100068413 3300005366 Bacteria 2817
45 Ga0070659_100334636 3300005366 Bacteria 1268
46 Ga0070667_100430981 3300005367 Bacteria 1203
47 Ga0070667_101802411 3300005367 Unclassified 576
48 Ga0070701_10542239 3300005438 Bacteria 762
49 Ga0070705_100748959 3300005440 Bacteria 772
50 Ga0070700_100286713 3300005441 Bacteria 1196
51 Ga0070700_101559288 3300005441 Unclassified 563
52 Ga0070662_100285932 3300005457 Bacteria 1336
53 Ga0070662_100346107 3300005457 Bacteria 1217
54 Ga0068867_100094823 3300005459 Bacteria 2270
55 Ga0068867_100658622 3300005459 Unclassified 919
56 Ga0068867_101225989 3300005459 Bacteria 690
57 Ga0070684_100007172 3300005535 Bacteria 8661
58 Ga0068853_100036950 3300005539 Bacteria 4154
59 Ga0068853_100280325 3300005539 Bacteria 1537
60 Ga0070672_100487051 3300005543 Bacteria 1065
61 Ga0070672_100865995 3300005543 Bacteria 797
62 Ga0070693_100639352 3300005547 Bacteria 772
63 Ga0070693_100649908 3300005547 Unclassified 767
64 Ga0070665_100005261 3300005548 Bacteria 13375
65 Ga0070664_100027779 3300005564 Bacteria 4704
66 Ga0068857_100016956 3300005577 Bacteria 6383
67 Ga0068857_100069481 3300005577 Bacteria 3136
68 Ga0068857_100323381 3300005577 Bacteria 1425
69 Ga0068857_101391008 3300005577 Unclassified 682
70 Ga0068854_100797556 3300005578 Bacteria 823
71 Ga0068856_100000023 3300005614 Bacteria 141671
72 Ga0068856_100184432 3300005614 Bacteria 2100
73 Ga0068852_100192977 3300005616 Bacteria 1923
74 Ga0068852_100801707 3300005616 Bacteria 956
75 Ga0068859_100017290 3300005617 Bacteria 7242
76 Ga0068859_100086583 3300005617 Bacteria 3180
77 Ga0068864_100266411 3300005618 Bacteria 1595
78 Ga0068864_100305962 3300005618 Bacteria 1489
79 Ga0068864_100469509 3300005618 Bacteria 1206
80 Ga0068866_10203789 3300005718 Bacteria 1184
81 Ga0068866_10390712 3300005718 Unclassified 895
82 Ga0068861_100224699 3300005719 Bacteria 1589
83 Ga0068861_100358616 3300005719 Bacteria 1281
84 Ga0068861_100501836 3300005719 Bacteria 1097
85 Ga0068861_100610250 3300005719 Bacteria 1003
86 Ga0068861_101041382 3300005719 Unclassified 783
87 Ga0068861_101309342 3300005719 Bacteria 705
88 Ga0068870_10060137 3300005840 Bacteria 2039
89 Ga0068863_100270954 3300005841 Bacteria 1643
90 Ga0068863_101366665 3300005841 Bacteria 716
91 Ga0068860_100049635 3300005843 Bacteria 3996
92 Ga0068860_100646953 3300005843 Bacteria 1065
93 Ga0068862_102504941 3300005844 Unclassified 528
94 Ga0081540_1019719 3300005983 Bacteria 4084
95 Ga0075366_10461643 3300006195 Unclassified 784
96 Ga0097621_100616356 3300006237 Unclassified 993
97 Ga0097621_100672460 3300006237 Bacteria 951
98 Ga0068871_100482861 3300006358 Bacteria 1115
99 Ga0075429_100945933 3300006880 Bacteria 754
100 Ga0068865_100213905 3300006881 Bacteria 1504
101 Ga0068865_100541410 3300006881 Bacteria 976
102 Ga0068865_101656316 3300006881 Unclassified 576
103 Ga0097620_100017290 3300006931 Bacteria 7242
104 Ga0097620_100086588 3300006931 Bacteria 3180
105 Ga0105244_10000292 3300009036 Bacteria 49061
106 Ga0105240_10002159 3300009093 Bacteria 32133
107 Ga0105240_10125253 3300009093 Unclassified 3089
108 Ga0105240_11192680 3300009093 Bacteria 806
109 Ga0111539_10086667 3300009094 Unclassified 3679
110 Ga0111539_10180611 3300009094 Bacteria 2464
111 Ga0111539_11076668 3300009094 Bacteria 934
112 Ga0105241_10178760 3300009174 Bacteria 1758
113 Ga0105242_10173700 3300009176 Bacteria 1895
114 Ga0105242_10267701 3300009176 Bacteria 1546
115 Ga0105237_10000171 3300009545 Bacteria 90778
116 Ga0105237_10069948 3300009545 Bacteria 3505
117 Ga0105237_11743234 3300009545 Bacteria 630
118 Ga0105237_12233467 3300009545 Unclassified 557
119 Ga0105249_10100728 3300009553 Bacteria 2716
120 Ga0105249_11680904 3300009553 Bacteria 707
121 Ga0105249_12384662 3300009553 Bacteria 602
122 Ga0105249_12590493 3300009553 Unclassified 579
123 Ga0105239_10004967 3300010375 Bacteria 15708
124 Ga0105239_10020635 3300010375 Bacteria 7270
125 Ga0105239_11162072 3300010375 Bacteria 889
126 Ga0105246_10017566 3300011119 Bacteria 4549
127 Ga0105246_10914837 3300011119 Bacteria 788
128 Ga0157373_10274308 3300013100 Bacteria 1194
129 Ga0157371_10127134 3300013102 Bacteria 1813
130 Ga0157370_10345350 3300013104 Bacteria 1372
131 Ga0157370_10796898 3300013104 Unclassified 860
132 Ga0157370_11027552 3300013104 Unclassified 746
133 Ga0157374_10008783 3300013296 Bacteria 8646
134 Ga0157374_10153473 3300013296 Bacteria 2240
135 Ga0157374_12299273 3300013296 Bacteria 566
136 Ga0157378_10100214 3300013297 Bacteria 2644
137 Ga0157378_10234094 3300013297 Bacteria 1752
138 Ga0157378_10298958 3300013297 Unclassified 1557
139 Ga0157378_10835556 3300013297 Bacteria 949
140 Ga0157378_11827047 3300013297 Bacteria 656
141 Ga0163162_10025268 3300013306 Bacteria 5869
142 Ga0163162_10410084 3300013306 Bacteria 1487
143 Ga0163162_10600982 3300013306 Bacteria 1226
144 Ga0163162_11406302 3300013306 Unclassified 794
145 Ga0157372_10066017 3300013307 Bacteria 4065
146 Ga0157372_10517650 3300013307 Bacteria 1391
147 Ga0157375_10101801 3300013308 Viruses 2956
148 Ga0157375_10389148 3300013308 Bacteria 1561
149 Ga0157375_10671572 3300013308 Bacteria 1191
150 Ga0163163_10436958 3300014325 Bacteria 1368
151 Ga0163163_10647773 3300014325 Unclassified 1120
152 Ga0157380_10028930 3300014326 Bacteria 4231
153 Ga0157380_10065800 3300014326 Bacteria 2914
154 Ga0157380_10128548 3300014326 Bacteria 2158
155 Ga0157380_10366439 3300014326 Bacteria 1354
156 Ga0157380_10376793 3300014326 Bacteria 1338
157 Ga0157380_11158261 3300014326 Bacteria 815
158 Ga0157377_10064430 3300014745 Bacteria 2102
159 Ga0157377_10255404 3300014745 Unclassified 1138
160 Ga0157377_10264025 3300014745 Bacteria 1121
161 Ga0157379_11052858 3300014968 Unclassified 777
162 Ga0157379_12090791 3300014968 Bacteria 561
163 Ga0157376_10393567 3300014969 Bacteria 1338
164 Ga0163161_10000061 3300017792 Bacteria 112295
165 Ga0207666_1046653 3300025271 Bacteria 683
166 Ga0207697_10113820 3300025315 Bacteria 1160
167 Ga0207655_1000012 3300025728 Bacteria 640488
168 Ga0207688_10061501 3300025901 Bacteria 2117
169 Ga0207680_10066074 3300025903 Unclassified 2223
170 Ga0207680_10253089 3300025903 Bacteria 1217
171 Ga0207680_11130243 3300025903 Unclassified 560
172 Ga0207647_10038266 3300025904 Bacteria 3034
173 Ga0207647_10154777 3300025904 Bacteria 1339
174 Ga0207647_10529788 3300025904 Bacteria 655
175 Ga0207645_10229331 3300025907 Bacteria 1226
176 Ga0207645_10481576 3300025907 Bacteria 839
177 Ga0207645_11145653 3300025907 Bacteria 523
178 Ga0207643_10090240 3300025908 Bacteria 1786
179 Ga0207643_10096363 3300025908 Bacteria 1730
180 Ga0207705_10445137 3300025909 Bacteria 1004
181 Ga0207654_10337734 3300025911 Bacteria 1034
182 Ga0207654_11209666 3300025911 Bacteria 551
183 Ga0207707_10582202 3300025912 Bacteria 949
184 Ga0207695_10101654 3300025913 Bacteria 2869
185 Ga0207671_10008202 3300025914 Bacteria 8900
186 Ga0207660_10354148 3300025917 Bacteria 1177
187 Ga0207660_10787624 3300025917 Bacteria 776
188 Ga0207657_10484590 3300025919 Bacteria 969
189 Ga0207657_10639021 3300025919 Bacteria 829
190 Ga0207657_11177667 3300025919 Bacteria 583
191 Ga0207649_10001633 3300025920 Bacteria 13025
192 Ga0207649_10541651 3300025920 Bacteria 889
193 Ga0207652_10127094 3300025921 Bacteria 2271
194 Ga0207681_10055347 3300025923 Bacteria 2702
195 Ga0207681_10085092 3300025923 Bacteria 2243
196 Ga0207650_10600210 3300025925 Bacteria 926
197 Ga0207650_11636281 3300025925 Bacteria 546
198 Ga0207659_10121335 3300025926 Bacteria 2003
199 Ga0207659_10161677 3300025926 Bacteria 1759
200 Ga0207644_10328599 3300025931 Bacteria 1238
201 Ga0207690_10055021 3300025932 Bacteria 2678
202 Ga0207706_10157618 3300025933 Bacteria 1996
203 Ga0207706_10364362 3300025933 Bacteria 1255
204 Ga0207706_11116034 3300025933 Unclassified 658
205 Ga0207686_10468959 3300025934 Bacteria 972
206 Ga0207669_10355069 3300025937 Bacteria 1134
207 Ga0207669_10428171 3300025937 Bacteria 1043
208 Ga0207704_10128358 3300025938 Bacteria 1750
209 Ga0207704_10664284 3300025938 Unclassified 860
210 Ga0207691_10230806 3300025940 Bacteria 1603
211 Ga0207691_10267724 3300025940 Bacteria 1472
212 Ga0207689_10005081 3300025942 Bacteria 11844
213 Ga0207689_10118865 3300025942 Bacteria 2174
214 Ga0207689_10515139 3300025942 Bacteria 1003
215 Ga0207689_10740621 3300025942 Bacteria 829
216 Ga0207661_10000183 3300025944 Bacteria 40561
217 Ga0207679_10000308 3300025945 Bacteria 36802
218 Ga0207679_10664305 3300025945 Bacteria 943
219 Ga0207679_11094703 3300025945 Bacteria 731
220 Ga0207651_10276839 3300025960 Bacteria 1385
221 Ga0207651_10643695 3300025960 Bacteria 930
222 Ga0207712_10481801 3300025961 Bacteria 1058
223 Ga0207712_10888121 3300025961 Bacteria 787
224 Ga0207668_10098667 3300025972 Unclassified 2165
225 Ga0207668_11761534 3300025972 Unclassified 559
226 Ga0207668_12063648 3300025972 Bacteria 513
227 Ga0207668_12132652 3300025972 Unclassified 504
228 Ga0207640_10108737 3300025981 Bacteria 1960
229 Ga0207640_10507093 3300025981 Bacteria 1006
230 Ga0207658_10833171 3300025986 Bacteria 838
231 Ga0207658_11955521 3300025986 Unclassified 534
232 Ga0207677_10022408 3300026023 Bacteria 3881
233 Ga0207677_10618720 3300026023 Unclassified 952
234 Ga0207639_10007804 3300026041 Bacteria 7307
235 Ga0207678_10387459 3300026067 Unclassified 1209
236 Ga0207708_10222291 3300026075 Bacteria 1513
237 Ga0207702_10000314 3300026078 Bacteria 55437
238 Ga0207641_10159056 3300026088 Bacteria 2052
239 Ga0207641_10615078 3300026088 Bacteria 1065
240 Ga0207648_10004124 3300026089 Bacteria 15029
241 Ga0207648_10054515 3300026089 Bacteria 3492
242 Ga0207648_11000197 3300026089 Bacteria 783
243 Ga0207676_10212215 3300026095 Bacteria 1718
244 Ga0207674_10015913 3300026116 Bacteria 8243
245 Ga0207674_10104064 3300026116 Bacteria 2818
246 Ga0207674_10109524 3300026116 Bacteria 2738
247 Ga0207674_10563968 3300026116 Bacteria 1100
248 Ga0207675_100032573 3300026118 Bacteria 4855
249 Ga0207675_100064296 3300026118 Bacteria 3429
250 Ga0207675_100387475 3300026118 Bacteria 1375
251 Ga0207675_101449951 3300026118 Bacteria 707
252 Ga0207683_10006970 3300026121 Bacteria 9686
253 Ga0207698_10799704 3300026142 Bacteria 945
254 Ga0207698_11935775 3300026142 Bacteria 604
255 Ga0207428_10210277 3300027907 Bacteria 1462
256 Ga0207428_10228596 3300027907 Bacteria 1393
257 Ga0268266_10027235 3300028379 Bacteria 4862
258 Ga0268265_10640161 3300028380 Bacteria 1021
259 Ga0268265_10936499 3300028380 Bacteria 852
260 Ga0268264_10036308 3300028381 Bacteria 4059
261 Ga0268264_10083081 3300028381 Bacteria 2743
262 Ga0307517_10000963 3300028786 Bacteria 48832
263 Ga0307515_10000300 3300028794 Bacteria 122040
264 Ga0316177_1062757 3300030731 Bacteria 5195
265 Ga0316176_1023444 3300030732 Bacteria 24481
266 Ga0307414_10349735 3300032004 Bacteria 1268
267 Ga0373936_0157224 3300035113 Bacteria 988
268 Ga0451797_0099218 3300041453 Bacteria 664
269 Ga0451833_0132330 3300041491 Bacteria 894
270 Ga0450894_026660 3300042131 Unclassified 794
271 Ga0450898_009047 3300042134 Bacteria 1585
272 Ga0450899_011687 3300042135 Bacteria 981
273 Ga0439434_0009934 3300042435 Bacteria 2802
274 Ga0466972_0000002 3300044658 Bacteria 408005
275 Ga0466968_0140098 3300044735 Bacteria 1106
276 Ga0466970_0008857 3300044765 Bacteria 5072
277 Ga0466959_0168409 3300045049 Bacteria 1537
278 Ga0495625_0169415 3300046660 Bacteria 1459
279 Ga0495600_0287880 3300046809 Bacteria 1039
280 Ga0495674_0133545 3300047319 Bacteria 2090
281 Ga0495684_0351766 3300047471 Bacteria 1046
282 Ga0501295_142578 3300049518 Bacteria 588
283 Ga0501043_0292631 3300049579 Bacteria 1246
284 Ga0501223_001920 3300049663 Bacteria 4674
285 Ga0501269_002001 3300049766 Bacteria 2572
286 nmdc:mga0k408_916836_c1 3300050493 Bacteria 508
287 nmdc:mga09592_1469866_c1 3300050508 Bacteria 555
288 nmdc:mga08y16_1239689_c1 3300050511 Bacteria 715
289 nmdc:mga08y16_44643_c1 3300050511 Bacteria 4644
290 Ga0500646_0031849 3300053090 Bacteria 1453
291 Ga0500588_0003194 3300053146 Bacteria 3428
292 Ga0500616_0001825 3300053153 Bacteria 19303
293 Ga0500616_0054824 3300053153 Unclassified 2086
294 Ga0466962_0715948 3300061719 Unclassified 514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738541279 2738736683 126
2 iso_pu_bacteria 2738541285 2738769139 126
3 iso_pu_bacteria 2738543007 2739218265 126
4 iso_pu_bacteria 2818991444 2819587580 126
5 iso_pu_bacteria 2842903701 2842904664 126
6 iso_pu_bacteria 2852627209 2852629221 126
7 3300003322 rootL2_10047213 rootL2_100472135 127
8 3300005328 Ga0070676_10336053 Ga0070676_103360532 127
9 3300005331 Ga0070670_100244778 Ga0070670_1002447783 127
10 3300005334 Ga0068869_100582526 Ga0068869_1005825261 127
11 3300005335 Ga0070666_10044141 Ga0070666_100441413 127
12 3300005335 Ga0070666_11460637 Ga0070666_114606371 127
13 3300005338 Ga0068868_100289878 Ga0068868_1002898782 127
14 3300005344 Ga0070661_100616069 Ga0070661_1006160691 127
15 3300005353 Ga0070669_100195482 Ga0070669_1001954823 127
16 3300005354 Ga0070675_100024443 Ga0070675_1000244434 127
17 3300005355 Ga0070671_100087442 Ga0070671_1000874422 127
18 3300005356 Ga0070674_100074664 Ga0070674_1000746643 127
19 3300005364 Ga0070673_100085469 Ga0070673_1000854693 127
20 3300005367 Ga0070667_100430981 Ga0070667_1004309813 127
21 3300005457 Ga0070662_100285932 Ga0070662_1002859321 127
22 3300005459 Ga0068867_100658622 Ga0068867_1006586221 127
23 3300005543 Ga0070672_100487051 Ga0070672_1004870512 127
24 3300005547 Ga0070693_100639352 Ga0070693_1006393521 127
25 3300005548 Ga0070665_100005261 Ga0070665_1000052619 127
26 3300005577 Ga0068857_100323381 Ga0068857_1003233812 127
27 3300005614 Ga0068856_100000023 Ga0068856_10000002399 127
28 3300005614 Ga0068856_100184432 Ga0068856_1001844321 127
29 3300005617 Ga0068859_100017290 Ga0068859_1000172902 127
30 3300005618 Ga0068864_100305962 Ga0068864_1003059621 127
31 3300005718 Ga0068866_10390712 Ga0068866_103907122 127
32 3300005719 Ga0068861_100224699 Ga0068861_1002246992 127
33 3300005841 Ga0068863_101366665 Ga0068863_1013666652 127
34 3300005843 Ga0068860_100049635 Ga0068860_1000496356 127
35 3300006195 Ga0075366_10461643 Ga0075366_104616432 127
36 3300006237 Ga0097621_100672460 Ga0097621_1006724602 127
37 3300006881 Ga0068865_100541410 Ga0068865_1005414102 127
38 3300006931 Ga0097620_100017290 Ga0097620_1000172902 127
39 3300009093 Ga0105240_10002159 Ga0105240_1000215926 127
40 3300009093 Ga0105240_10125253 Ga0105240_101252536 127
41 3300009174 Ga0105241_10178760 Ga0105241_101787602 127
42 3300009545 Ga0105237_10000171 Ga0105237_1000017163 127
43 3300009545 Ga0105237_10069948 Ga0105237_100699486 127
44 3300009545 Ga0105237_11743234 Ga0105237_117432342 127
45 3300009553 Ga0105249_12384662 Ga0105249_123846621 127
46 3300010375 Ga0105239_10004967 Ga0105239_1000496710 127
47 3300010375 Ga0105239_10020635 Ga0105239_100206359 127
48 3300010375 Ga0105239_11162072 Ga0105239_111620722 127
49 3300011119 Ga0105246_10017566 Ga0105246_100175662 127
50 3300013296 Ga0157374_10008783 Ga0157374_100087836 127
51 3300013297 Ga0157378_10100214 Ga0157378_101002143 127
52 3300013297 Ga0157378_10234094 Ga0157378_102340943 127
53 3300013306 Ga0163162_10600982 Ga0163162_106009822 127
54 3300013307 Ga0157372_10066017 Ga0157372_100660176 127
55 3300013308 Ga0157375_10389148 Ga0157375_103891483 127
56 3300014745 Ga0157377_10264025 Ga0157377_102640252 127
57 3300014968 Ga0157379_11052858 Ga0157379_110528582 127
58 3300025901 Ga0207688_10061501 Ga0207688_100615012 127
59 3300025903 Ga0207680_10253089 Ga0207680_102530891 127
60 3300025903 Ga0207680_11130243 Ga0207680_111302431 127
61 3300025904 Ga0207647_10038266 Ga0207647_100382661 127
62 3300025904 Ga0207647_10154777 Ga0207647_101547772 127
63 3300025908 Ga0207643_10090240 Ga0207643_100902403 127
64 3300025911 Ga0207654_10337734 Ga0207654_103377342 127
65 3300025913 Ga0207695_10101654 Ga0207695_101016543 127
66 3300025914 Ga0207671_10008202 Ga0207671_100082026 127
67 3300025920 Ga0207649_10541651 Ga0207649_105416512 127
68 3300025923 Ga0207681_10055347 Ga0207681_100553473 127
69 3300025925 Ga0207650_11636281 Ga0207650_116362812 127
70 3300025926 Ga0207659_10121335 Ga0207659_101213353 127
71 3300025931 Ga0207644_10328599 Ga0207644_103285992 127
72 3300025933 Ga0207706_10157618 Ga0207706_101576183 127
73 3300025940 Ga0207691_10230806 Ga0207691_102308063 127
74 3300025942 Ga0207689_10005081 Ga0207689_100050819 127
75 3300025942 Ga0207689_10740621 Ga0207689_107406212 127
76 3300025945 Ga0207679_10664305 Ga0207679_106643051 127
77 3300025960 Ga0207651_10643695 Ga0207651_106436952 127
78 3300025972 Ga0207668_12132652 Ga0207668_121326521 127
79 3300026023 Ga0207677_10022408 Ga0207677_100224082 127
80 3300026078 Ga0207702_10000314 Ga0207702_1000031434 127
81 3300026089 Ga0207648_10004124 Ga0207648_100041243 127
82 3300026095 Ga0207676_10212215 Ga0207676_102122151 127
83 3300026116 Ga0207674_10104064 Ga0207674_101040643 127
84 3300026118 Ga0207675_100032573 Ga0207675_1000325733 127
85 3300026121 Ga0207683_10006970 Ga0207683_100069706 127
86 3300028379 Ga0268266_10027235 Ga0268266_100272355 127
87 3300028381 Ga0268264_10036308 Ga0268264_100363082 127
88 3300028381 Ga0268264_10083081 Ga0268264_100830813 127
89 3300028786 Ga0307517_10000963 Ga0307517_100009638 127
90 3300035113 Ga0373936_0157224 Ga0373936_0157224_293_676 127
91 3300046660 Ga0495625_0169415 Ga0495625_0169415_293_676 127
92 3300050493 nmdc:mga0k408_916836_c1 nmdc:mga0k408_916836_c1_79_462 127
93 3300053146 Ga0500588_0003194 Ga0500588_0003194_2883_3266 127
94 3300005262 Ga0065165_1003325 Ga0065165_10033259 128
95 3300005329 Ga0070683_100007262 Ga0070683_1000072623 128
96 3300005335 Ga0070666_10132642 Ga0070666_101326421 128
97 3300005339 Ga0070660_100521823 Ga0070660_1005218231 128
98 3300005339 Ga0070660_101770606 Ga0070660_1017706061 128
99 3300005344 Ga0070661_100002162 Ga0070661_1000021627 128
100 3300005366 Ga0070659_100068413 Ga0070659_1000684132 128
101 3300005535 Ga0070684_100007172 Ga0070684_1000071725 128
102 3300005539 Ga0068853_100036950 Ga0068853_1000369503 128
103 3300005539 Ga0068853_100280325 Ga0068853_1002803253 128
104 3300005564 Ga0070664_100027779 Ga0070664_1000277794 128
105 3300005577 Ga0068857_100016956 Ga0068857_1000169562 128
106 3300005616 Ga0068852_100192977 Ga0068852_1001929773 128
107 3300005718 Ga0068866_10203789 Ga0068866_102037891 128
108 3300005983 Ga0081540_1019719 Ga0081540_10197193 128
109 3300009176 Ga0105242_10267701 Ga0105242_102677013 128
110 3300009545 Ga0105237_12233467 Ga0105237_122334671 128
111 3300013100 Ga0157373_10274308 Ga0157373_102743082 128
112 3300013104 Ga0157370_10345350 Ga0157370_103453502 128
113 3300013297 Ga0157378_10835556 Ga0157378_108355561 128
114 3300025903 Ga0207680_10066074 Ga0207680_100660743 128
115 3300025909 Ga0207705_10445137 Ga0207705_104451372 128
116 3300025912 Ga0207707_10582202 Ga0207707_105822022 128
117 3300025917 Ga0207660_10354148 Ga0207660_103541482 128
118 3300025919 Ga0207657_10484590 Ga0207657_104845902 128
119 3300025919 Ga0207657_10639021 Ga0207657_106390211 128
120 3300025919 Ga0207657_11177667 Ga0207657_111776671 128
121 3300025920 Ga0207649_10001633 Ga0207649_100016337 128
122 3300025921 Ga0207652_10127094 Ga0207652_101270943 128
123 3300025932 Ga0207690_10055021 Ga0207690_100550213 128
124 3300025933 Ga0207706_11116034 Ga0207706_111160342 128
125 3300025934 Ga0207686_10468959 Ga0207686_104689592 128
126 3300025944 Ga0207661_10000183 Ga0207661_1000018332 128
127 3300025945 Ga0207679_10000308 Ga0207679_100003085 128
128 3300025945 Ga0207679_11094703 Ga0207679_110947032 128
129 3300025981 Ga0207640_10108737 Ga0207640_101087373 128
130 3300026041 Ga0207639_10007804 Ga0207639_100078045 128
131 3300026116 Ga0207674_10015913 Ga0207674_100159132 128
132 3300026142 Ga0207698_11935775 Ga0207698_119357751 128
133 3300045049 Ga0466959_0168409 Ga0466959_0168409_886_1272 128
134 3300049579 Ga0501043_0292631 Ga0501043_0292631_672_1058 128
135 3300053153 Ga0500616_0054824 Ga0500616_0054824_1025_1411 128
136 3300061719 Ga0466962_0715948 Ga0466962_0715948_92_478 128
137 3300003320 rootH2_10249136 rootH2_102491363 130
138 3300003322 rootL2_10231404 rootL2_102314044 130
139 3300003323 rootH1_10101256 rootH1_101012568 130
140 3300005289 Ga0065704_10320525 Ga0065704_103205251 130
141 3300005290 Ga0065712_10163086 Ga0065712_101630861 130
142 3300005290 Ga0065712_10255182 Ga0065712_102551823 130
143 3300005293 Ga0065715_10246349 Ga0065715_102463491 130
144 3300005293 Ga0065715_10575188 Ga0065715_105751882 130
145 3300005295 Ga0065707_10303266 Ga0065707_103032661 130
146 3300005328 Ga0070676_10295048 Ga0070676_102950481 130
147 3300005328 Ga0070676_10430192 Ga0070676_104301922 130
148 3300005328 Ga0070676_10506563 Ga0070676_105065632 130
149 3300005331 Ga0070670_101215590 Ga0070670_1012155901 130
150 3300005334 Ga0068869_100146582 Ga0068869_1001465822 130
151 3300005340 Ga0070689_102151294 Ga0070689_1021512941 130
152 3300005347 Ga0070668_100246435 Ga0070668_1002464351 130
153 3300005347 Ga0070668_100680369 Ga0070668_1006803691 130
154 3300005353 Ga0070669_100094023 Ga0070669_1000940232 130
155 3300005354 Ga0070675_100021380 Ga0070675_1000213806 130
156 3300005354 Ga0070675_100232703 Ga0070675_1002327033 130
157 3300005356 Ga0070674_100411680 Ga0070674_1004116801 130
158 3300005356 Ga0070674_100472243 Ga0070674_1004722432 130
159 3300005364 Ga0070673_100105836 Ga0070673_1001058362 130
160 3300005365 Ga0070688_100256617 Ga0070688_1002566172 130
161 3300005366 Ga0070659_100334636 Ga0070659_1003346363 130
162 3300005367 Ga0070667_101802411 Ga0070667_1018024111 130
163 3300005438 Ga0070701_10542239 Ga0070701_105422392 130
164 3300005440 Ga0070705_100748959 Ga0070705_1007489591 130
165 3300005441 Ga0070700_100286713 Ga0070700_1002867132 130
166 3300005441 Ga0070700_101559288 Ga0070700_1015592881 130
167 3300005457 Ga0070662_100346107 Ga0070662_1003461071 130
168 3300005459 Ga0068867_100094823 Ga0068867_1000948233 130
169 3300005459 Ga0068867_101225989 Ga0068867_1012259891 130
170 3300005543 Ga0070672_100865995 Ga0070672_1008659952 130
171 3300005547 Ga0070693_100649908 Ga0070693_1006499082 130
172 3300005577 Ga0068857_100069481 Ga0068857_1000694813 130
173 3300005577 Ga0068857_101391008 Ga0068857_1013910082 130
174 3300005578 Ga0068854_100797556 Ga0068854_1007975561 130
175 3300005616 Ga0068852_100801707 Ga0068852_1008017071 130
176 3300005617 Ga0068859_100086583 Ga0068859_1000865832 130
177 3300005618 Ga0068864_100266411 Ga0068864_1002664113 130
178 3300005618 Ga0068864_100469509 Ga0068864_1004695092 130
179 3300005719 Ga0068861_100358616 Ga0068861_1003586162 130
180 3300005719 Ga0068861_100501836 Ga0068861_1005018362 130
181 3300005719 Ga0068861_100610250 Ga0068861_1006102502 130
182 3300005719 Ga0068861_101041382 Ga0068861_1010413822 130
183 3300005719 Ga0068861_101309342 Ga0068861_1013093421 130
184 3300005840 Ga0068870_10060137 Ga0068870_100601372 130
185 3300005841 Ga0068863_100270954 Ga0068863_1002709542 130
186 3300005843 Ga0068860_100646953 Ga0068860_1006469532 130
187 3300005844 Ga0068862_102504941 Ga0068862_1025049412 130
188 3300006237 Ga0097621_100616356 Ga0097621_1006163562 130
189 3300006358 Ga0068871_100482861 Ga0068871_1004828612 130
190 3300006880 Ga0075429_100945933 Ga0075429_1009459332 130
191 3300006881 Ga0068865_100213905 Ga0068865_1002139051 130
192 3300006881 Ga0068865_101656316 Ga0068865_1016563161 130
193 3300006931 Ga0097620_100086588 Ga0097620_1000865882 130
194 3300009036 Ga0105244_10000292 Ga0105244_1000029213 130
195 3300009093 Ga0105240_11192680 Ga0105240_111926801 130
196 3300009094 Ga0111539_10086667 Ga0111539_100866675 130
197 3300009094 Ga0111539_10180611 Ga0111539_101806112 130
198 3300009094 Ga0111539_11076668 Ga0111539_110766681 130
199 3300009176 Ga0105242_10173700 Ga0105242_101737002 130
200 3300009553 Ga0105249_10100728 Ga0105249_101007283 130
201 3300009553 Ga0105249_11680904 Ga0105249_116809042 130
202 3300009553 Ga0105249_12590493 Ga0105249_125904931 130
203 3300011119 Ga0105246_10914837 Ga0105246_109148372 130
204 3300013102 Ga0157371_10127134 Ga0157371_101271344 130
205 3300013104 Ga0157370_10796898 Ga0157370_107968982 130
206 3300013104 Ga0157370_11027552 Ga0157370_110275522 130
207 3300013296 Ga0157374_10153473 Ga0157374_101534733 130
208 3300013296 Ga0157374_12299273 Ga0157374_122992731 130
209 3300013297 Ga0157378_10298958 Ga0157378_102989582 130
210 3300013297 Ga0157378_11827047 Ga0157378_118270471 130
211 3300013306 Ga0163162_10025268 Ga0163162_100252685 130
212 3300013306 Ga0163162_10410084 Ga0163162_104100841 130
213 3300013306 Ga0163162_11406302 Ga0163162_114063021 130
214 3300013307 Ga0157372_10517650 Ga0157372_105176502 130
215 3300013308 Ga0157375_10101801 Ga0157375_101018014 130
216 3300013308 Ga0157375_10671572 Ga0157375_106715721 130
217 3300014325 Ga0163163_10436958 Ga0163163_104369582 130
218 3300014325 Ga0163163_10647773 Ga0163163_106477732 130
219 3300014326 Ga0157380_10028930 Ga0157380_100289301 130
220 3300014326 Ga0157380_10065800 Ga0157380_100658002 130
221 3300014326 Ga0157380_10128548 Ga0157380_101285482 130
222 3300014326 Ga0157380_10366439 Ga0157380_103664392 130
223 3300014326 Ga0157380_10376793 Ga0157380_103767931 130
224 3300014326 Ga0157380_11158261 Ga0157380_111582612 130
225 3300014745 Ga0157377_10064430 Ga0157377_100644301 130
226 3300014745 Ga0157377_10255404 Ga0157377_102554042 130
227 3300014968 Ga0157379_12090791 Ga0157379_120907911 130
228 3300014969 Ga0157376_10393567 Ga0157376_103935672 130
229 3300017792 Ga0163161_10000061 Ga0163161_1000006114 130
230 3300025271 Ga0207666_1046653 Ga0207666_10466532 130
231 3300025315 Ga0207697_10113820 Ga0207697_101138201 130
232 3300025728 Ga0207655_1000012 Ga0207655_100001213 130
233 3300025904 Ga0207647_10529788 Ga0207647_105297881 130
234 3300025907 Ga0207645_10229331 Ga0207645_102293311 130
235 3300025907 Ga0207645_10481576 Ga0207645_104815762 130
236 3300025907 Ga0207645_11145653 Ga0207645_111456531 130
237 3300025908 Ga0207643_10096363 Ga0207643_100963632 130
238 3300025911 Ga0207654_11209666 Ga0207654_112096661 130
239 3300025917 Ga0207660_10787624 Ga0207660_107876242 130
240 3300025923 Ga0207681_10085092 Ga0207681_100850923 130
241 3300025925 Ga0207650_10600210 Ga0207650_106002102 130
242 3300025926 Ga0207659_10161677 Ga0207659_101616772 130
243 3300025933 Ga0207706_10364362 Ga0207706_103643621 130
244 3300025937 Ga0207669_10355069 Ga0207669_103550692 130
245 3300025937 Ga0207669_10428171 Ga0207669_104281711 130
246 3300025938 Ga0207704_10128358 Ga0207704_101283582 130
247 3300025938 Ga0207704_10664284 Ga0207704_106642841 130
248 3300025940 Ga0207691_10267724 Ga0207691_102677243 130
249 3300025942 Ga0207689_10118865 Ga0207689_101188653 130
250 3300025942 Ga0207689_10515139 Ga0207689_105151392 130
251 3300025960 Ga0207651_10276839 Ga0207651_102768392 130
252 3300025961 Ga0207712_10481801 Ga0207712_104818012 130
253 3300025961 Ga0207712_10888121 Ga0207712_108881212 130
254 3300025972 Ga0207668_10098667 Ga0207668_100986673 130
255 3300025972 Ga0207668_11761534 Ga0207668_117615341 130
256 3300025972 Ga0207668_12063648 Ga0207668_120636481 130
257 3300025981 Ga0207640_10507093 Ga0207640_105070932 130
258 3300025986 Ga0207658_10833171 Ga0207658_108331711 130
259 3300025986 Ga0207658_11955521 Ga0207658_119555211 130
260 3300026023 Ga0207677_10618720 Ga0207677_106187202 130
261 3300026067 Ga0207678_10387459 Ga0207678_103874592 130
262 3300026075 Ga0207708_10222291 Ga0207708_102222911 130
263 3300026088 Ga0207641_10159056 Ga0207641_101590564 130
264 3300026088 Ga0207641_10615078 Ga0207641_106150782 130
265 3300026089 Ga0207648_10054515 Ga0207648_100545155 130
266 3300026089 Ga0207648_11000197 Ga0207648_110001972 130
267 3300026116 Ga0207674_10109524 Ga0207674_101095244 130
268 3300026116 Ga0207674_10563968 Ga0207674_105639681 130
269 3300026118 Ga0207675_100064296 Ga0207675_1000642965 130
270 3300026118 Ga0207675_100387475 Ga0207675_1003874752 130
271 3300026118 Ga0207675_101449951 Ga0207675_1014499511 130
272 3300026142 Ga0207698_10799704 Ga0207698_107997042 130
273 3300027907 Ga0207428_10210277 Ga0207428_102102772 130
274 3300027907 Ga0207428_10228596 Ga0207428_102285961 130
275 3300028380 Ga0268265_10640161 Ga0268265_106401612 130
276 3300028380 Ga0268265_10936499 Ga0268265_109364991 130
277 3300028794 Ga0307515_10000300 Ga0307515_1000030044 130
278 3300030731 Ga0316177_1062757 Ga0316177_10627572 130
279 3300030732 Ga0316176_1023444 Ga0316176_10234447 130
280 3300032004 Ga0307414_10349735 Ga0307414_103497352 130
281 3300041453 Ga0451797_0099218 Ga0451797_0099218_125_520 130
282 3300041491 Ga0451833_0132330 Ga0451833_0132330_448_843 130
283 3300042131 Ga0450894_026660 Ga0450894_026660_228_620 130
284 3300042134 Ga0450898_009047 Ga0450898_009047_247_639 130
285 3300042135 Ga0450899_011687 Ga0450899_011687_346_738 130
286 3300042435 Ga0439434_0009934 Ga0439434_0009934_1589_1987 130
287 3300044658 Ga0466972_0000002 Ga0466972_0000002_253012_253404 130
288 3300044735 Ga0466968_0140098 Ga0466968_0140098_388_780 130
289 3300044765 Ga0466970_0008857 Ga0466970_0008857_3712_4104 130
290 3300046809 Ga0495600_0287880 Ga0495600_0287880_125_520 130
291 3300047319 Ga0495674_0133545 Ga0495674_0133545_705_1100 130
292 3300047471 Ga0495684_0351766 Ga0495684_0351766_281_676 130
293 3300049518 Ga0501295_142578 Ga0501295_142578_163_555 130
294 3300049663 Ga0501223_001920 Ga0501223_001920_350_745 130
295 3300049766 Ga0501269_002001 Ga0501269_002001_1325_1717 130
296 3300050508 nmdc:mga09592_1469866_c1 nmdc:mga09592_1469866_c1_65_460 130
297 3300050511 nmdc:mga08y16_1239689_c1 nmdc:mga08y16_1239689_c1_30_422 130
298 3300050511 nmdc:mga08y16_44643_c1 nmdc:mga08y16_44643_c1_3188_3583 130
299 3300053090 Ga0500646_0031849 Ga0500646_0031849_660_1055 130
300 3300053153 Ga0500616_0001825 Ga0500616_0001825_15515_15907 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

152

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9794 1 129
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9571 1 129
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8535 1 130
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8479 1 130
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8348 1 128
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9827 2 126 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9445 2 126 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9339 81 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9113 80 130 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8688 77 128 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A561IXF5-F1-model_v4 deleted 0.9954 1 130
AF-A0A4R3KLI4-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9952 1 130 GO:0016829
GO:0051213
AF-A0A1H4CK38-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9908 76 130 GO:0051213
AF-A0A7T5M393-F1-model_v4 deleted 0.9899 1 128
AF-B8CR13-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9898 1 130

Feature Viewer

pLDDT pTM Quality
96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map