F395087
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 170 | 289 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300053111|Ga0500572_000293|Ga0500572_000293_12628_13845 |
| Length | 385 |
| Sequence | MNDLMHRPGAAGKRGNLMLGSSVAVSDSDRSPLIEHPADFRLLDAEGGLKAELTGDWTSRTMGGAADRLRSELANRHAKIVDMTQMGRCDTSGAYAIVRAAENAGAADAQIKARPETQRLIDLVSRVKEDEVAPPPQPSLWNRFLVRLGRGITNLGVEGYETLAFNGRILAAMGRLIANPKKFRWAPFVALAERAGLDALPIVSVTSFFIGAVVGLLGAHMLSQFGAQVFAVEGRSASSFAAEIGSMKMNQEIDAMRVMGVDPFEALVLPRFMALLFTIPLLTFVAALAGLLGGMCVTWAVLGISPDFFMARVVDQVGVSHFWVGLSKAPVMAIVIAGIGCRQGMEVGGDVESLGRRVTAAVVHAIFSIIMIDAVFALVYMEANL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 2 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 3 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 4 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 5 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 6 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 7 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 8 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 9 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 10 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 61 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 102 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 106 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 134 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 135 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 136 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 137 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 138 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 139 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 143 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 146 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 147 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 148 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 149 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 150 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 151 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 152 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 153 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 154 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 155 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 156 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 157 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 158 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 159 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 160 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 161 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 162 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 163 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 164 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 165 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 166 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 167 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 168 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 169 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 170 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.66 |
| Metatranscriptomes | 0 |
| Isolates | 3.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.4 |
| Nodule | 0 |
| Rhizoplane | 2.68 |
| Rhizosphere | 69.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10022632 | 3300003215 | Bacteria | 2310 |
| 2 | Ga0055536_1000595 | 3300003781 | Bacteria | 24647 |
| 3 | Ga0055536_1000604 | 3300003781 | Bacteria | 24459 |
| 4 | Ga0055530_10000188 | 3300003791 | Bacteria | 55307 |
| 5 | Ga0055530_10000899 | 3300003791 | Bacteria | 24455 |
| 6 | Ga0055530_10002781 | 3300003791 | Bacteria | 10795 |
| 7 | Ga0055540_1022513 | 3300003792 | Bacteria | 1610 |
| 8 | Ga0055531_10000847 | 3300003794 | Bacteria | 25245 |
| 9 | Ga0055531_10008205 | 3300003794 | Bacteria | 5558 |
| 10 | Ga0065165_1000029 | 3300005262 | Bacteria | 220342 |
| 11 | Ga0070658_10036302 | 3300005327 | Bacteria | 3973 |
| 12 | Ga0070658_10065613 | 3300005327 | Bacteria | 2963 |
| 13 | Ga0070670_100000050 | 3300005331 | Bacteria | 132470 |
| 14 | Ga0070670_100007260 | 3300005331 | Bacteria | 9393 |
| 15 | Ga0070670_100022919 | 3300005331 | Bacteria | 5372 |
| 16 | Ga0070670_100036704 | 3300005331 | Bacteria | 4217 |
| 17 | Ga0068869_100300359 | 3300005334 | Bacteria | 1296 |
| 18 | Ga0070666_10020342 | 3300005335 | Bacteria | 4290 |
| 19 | Ga0070666_10097222 | 3300005335 | Bacteria | 2027 |
| 20 | Ga0070666_10158598 | 3300005335 | Bacteria | 1581 |
| 21 | Ga0070680_100005561 | 3300005336 | Bacteria | 9539 |
| 22 | Ga0070660_100059437 | 3300005339 | Bacteria | 2964 |
| 23 | Ga0070691_10004623 | 3300005341 | Bacteria | 6257 |
| 24 | Ga0070668_100001877 | 3300005347 | Bacteria | 15355 |
| 25 | Ga0070668_100001998 | 3300005347 | Bacteria | 14909 |
| 26 | Ga0070668_100002030 | 3300005347 | Bacteria | 14799 |
| 27 | Ga0070668_100004043 | 3300005347 | Bacteria | 10854 |
| 28 | Ga0070668_100016378 | 3300005347 | Bacteria | 5543 |
| 29 | Ga0070671_100000153 | 3300005355 | Bacteria | 45037 |
| 30 | Ga0070659_100000040 | 3300005366 | Bacteria | 104145 |
| 31 | Ga0070659_100008635 | 3300005366 | Bacteria | 7451 |
| 32 | Ga0070667_100000299 | 3300005367 | Bacteria | 55531 |
| 33 | Ga0070667_100015159 | 3300005367 | Bacteria | 6367 |
| 34 | Ga0070678_100134493 | 3300005456 | Bacteria | 1970 |
| 35 | Ga0070662_100204643 | 3300005457 | Bacteria | 1568 |
| 36 | Ga0070681_10015006 | 3300005458 | Bacteria | 7704 |
| 37 | Ga0070681_10030623 | 3300005458 | Bacteria | 5400 |
| 38 | Ga0070681_10097961 | 3300005458 | Bacteria | 2879 |
| 39 | Ga0070679_100162908 | 3300005530 | Bacteria | 2204 |
| 40 | Ga0070679_100245500 | 3300005530 | Bacteria | 1747 |
| 41 | Ga0068853_100066223 | 3300005539 | Bacteria | 3137 |
| 42 | Ga0070665_100000248 | 3300005548 | Bacteria | 89239 |
| 43 | Ga0070665_100000867 | 3300005548 | Bacteria | 39214 |
| 44 | Ga0070665_100001434 | 3300005548 | Bacteria | 27937 |
| 45 | Ga0070665_100012517 | 3300005548 | Bacteria | 8547 |
| 46 | Ga0070665_100020273 | 3300005548 | Bacteria | 6676 |
| 47 | Ga0070665_100132084 | 3300005548 | Bacteria | 2499 |
| 48 | Ga0068855_100011064 | 3300005563 | Bacteria | 10886 |
| 49 | Ga0068855_100035175 | 3300005563 | Bacteria | 5967 |
| 50 | Ga0068855_100053362 | 3300005563 | Bacteria | 4756 |
| 51 | Ga0068856_100135583 | 3300005614 | Bacteria | 2467 |
| 52 | Ga0068852_100013708 | 3300005616 | Bacteria | 6211 |
| 53 | Ga0068859_100001402 | 3300005617 | Bacteria | 24458 |
| 54 | Ga0068859_100010234 | 3300005617 | Bacteria | 9439 |
| 55 | Ga0068864_100000238 | 3300005618 | Bacteria | 49284 |
| 56 | Ga0068864_100001967 | 3300005618 | Bacteria | 16895 |
| 57 | Ga0068864_100002426 | 3300005618 | Bacteria | 15410 |
| 58 | Ga0068864_100084238 | 3300005618 | Bacteria | 2793 |
| 59 | Ga0068864_100330465 | 3300005618 | Bacteria | 1434 |
| 60 | Ga0068863_100000167 | 3300005841 | Bacteria | 70943 |
| 61 | Ga0068863_100000531 | 3300005841 | Bacteria | 38939 |
| 62 | Ga0068863_100007829 | 3300005841 | Bacteria | 10447 |
| 63 | Ga0068863_100171898 | 3300005841 | Bacteria | 2079 |
| 64 | Ga0068858_100001538 | 3300005842 | Bacteria | 23685 |
| 65 | Ga0068858_100007719 | 3300005842 | Bacteria | 10385 |
| 66 | Ga0068858_100007943 | 3300005842 | Bacteria | 10225 |
| 67 | Ga0068858_100067705 | 3300005842 | Bacteria | 3308 |
| 68 | Ga0068860_100000517 | 3300005843 | Bacteria | 47364 |
| 69 | Ga0068860_100000676 | 3300005843 | Bacteria | 39429 |
| 70 | Ga0068860_100001527 | 3300005843 | Bacteria | 24942 |
| 71 | Ga0068862_100000786 | 3300005844 | Bacteria | 31460 |
| 72 | Ga0068862_100147302 | 3300005844 | Bacteria | 2093 |
| 73 | Ga0068865_100002003 | 3300006881 | Bacteria | 12025 |
| 74 | Ga0097620_100001402 | 3300006931 | Bacteria | 24458 |
| 75 | Ga0097620_100010235 | 3300006931 | Bacteria | 9439 |
| 76 | Ga0105250_10026932 | 3300009092 | Bacteria | 2317 |
| 77 | Ga0105240_10000522 | 3300009093 | Bacteria | 70833 |
| 78 | Ga0105240_10022832 | 3300009093 | Bacteria | 8289 |
| 79 | Ga0105240_10056518 | 3300009093 | Bacteria | 4910 |
| 80 | Ga0105240_10073487 | 3300009093 | Bacteria | 4222 |
| 81 | Ga0105242_10203616 | 3300009176 | Bacteria | 1759 |
| 82 | Ga0105248_10002192 | 3300009177 | Bacteria | 21611 |
| 83 | Ga0105248_10002620 | 3300009177 | Bacteria | 20006 |
| 84 | Ga0105248_10002783 | 3300009177 | Bacteria | 19441 |
| 85 | Ga0105248_10030043 | 3300009177 | Bacteria | 6064 |
| 86 | Ga0105237_10187201 | 3300009545 | Bacteria | 2070 |
| 87 | Ga0105238_10016707 | 3300009551 | Bacteria | 7436 |
| 88 | Ga0105238_10051376 | 3300009551 | Bacteria | 4147 |
| 89 | Ga0105249_10000356 | 3300009553 | Bacteria | 45856 |
| 90 | Ga0105239_10028133 | 3300010375 | Bacteria | 6186 |
| 91 | Ga0105239_10151828 | 3300010375 | Bacteria | 2585 |
| 92 | Ga0157369_10184694 | 3300013105 | Bacteria | 2193 |
| 93 | Ga0157374_10114856 | 3300013296 | Bacteria | 2593 |
| 94 | Ga0163162_10008333 | 3300013306 | Bacteria | 10112 |
| 95 | Ga0163162_10141996 | 3300013306 | Bacteria | 2515 |
| 96 | Ga0157375_10053522 | 3300013308 | Bacteria | 3972 |
| 97 | Ga0163163_10001756 | 3300014325 | Bacteria | 18264 |
| 98 | Ga0157379_10001501 | 3300014968 | Bacteria | 19208 |
| 99 | Ga0157379_10001581 | 3300014968 | Bacteria | 18756 |
| 100 | Ga0157379_10077416 | 3300014968 | Bacteria | 2978 |
| 101 | Ga0163161_10201238 | 3300017792 | Bacteria | 1535 |
| 102 | Ga0213872_10019359 | 3300021361 | Bacteria | 3136 |
| 103 | Ga0209455_1015955 | 3300025272 | Bacteria | 1630 |
| 104 | Ga0209676_1000243 | 3300025292 | Bacteria | 117113 |
| 105 | Ga0209676_1000311 | 3300025292 | Bacteria | 95478 |
| 106 | Ga0209758_1004222 | 3300025297 | Bacteria | 12164 |
| 107 | Ga0209050_1000031 | 3300025298 | Bacteria | 458181 |
| 108 | Ga0209050_1000244 | 3300025298 | Bacteria | 117105 |
| 109 | Ga0209050_1000375 | 3300025298 | Bacteria | 84503 |
| 110 | Ga0209051_1003593 | 3300025303 | Bacteria | 10081 |
| 111 | Ga0209257_1000073 | 3300025304 | Bacteria | 325833 |
| 112 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 113 | Ga0209257_1004459 | 3300025304 | Bacteria | 10837 |
| 114 | Ga0207705_10002329 | 3300025909 | Bacteria | 14696 |
| 115 | Ga0207705_10066327 | 3300025909 | Bacteria | 2610 |
| 116 | Ga0207707_10017930 | 3300025912 | Bacteria | 6173 |
| 117 | Ga0207695_10000987 | 3300025913 | Bacteria | 50463 |
| 118 | Ga0207695_10001134 | 3300025913 | Bacteria | 46205 |
| 119 | Ga0207695_10010039 | 3300025913 | Bacteria | 11627 |
| 120 | Ga0207695_10028456 | 3300025913 | Bacteria | 6197 |
| 121 | Ga0207695_10256773 | 3300025913 | Bacteria | 1646 |
| 122 | Ga0207660_10003341 | 3300025917 | Bacteria | 10470 |
| 123 | Ga0207660_10137835 | 3300025917 | Bacteria | 1863 |
| 124 | Ga0207657_10007945 | 3300025919 | Bacteria | 10817 |
| 125 | Ga0207657_10063693 | 3300025919 | Bacteria | 3151 |
| 126 | Ga0207652_10024525 | 3300025921 | Bacteria | 5005 |
| 127 | Ga0207652_10052009 | 3300025921 | Bacteria | 3514 |
| 128 | Ga0207694_10058049 | 3300025924 | Bacteria | 3010 |
| 129 | Ga0207650_10000133 | 3300025925 | Bacteria | 90953 |
| 130 | Ga0207650_10007542 | 3300025925 | Bacteria | 7417 |
| 131 | Ga0207650_10031237 | 3300025925 | Bacteria | 3844 |
| 132 | Ga0207650_10090000 | 3300025925 | Bacteria | 2343 |
| 133 | Ga0207644_10001604 | 3300025931 | Bacteria | 14601 |
| 134 | Ga0207644_10212549 | 3300025931 | Bacteria | 1530 |
| 135 | Ga0207690_10000134 | 3300025932 | Bacteria | 60374 |
| 136 | Ga0207690_10019025 | 3300025932 | Bacteria | 4218 |
| 137 | Ga0207706_10238239 | 3300025933 | Bacteria | 1591 |
| 138 | Ga0207704_10007013 | 3300025938 | Bacteria | 5293 |
| 139 | Ga0207711_10002205 | 3300025941 | Bacteria | 17482 |
| 140 | Ga0207711_10005329 | 3300025941 | Bacteria | 10907 |
| 141 | Ga0207711_10005736 | 3300025941 | Bacteria | 10478 |
| 142 | Ga0207711_10107588 | 3300025941 | Bacteria | 2476 |
| 143 | Ga0207667_10016558 | 3300025949 | Bacteria | 8326 |
| 144 | Ga0207667_10033643 | 3300025949 | Bacteria | 5510 |
| 145 | Ga0207651_10183487 | 3300025960 | Bacteria | 1662 |
| 146 | Ga0207712_10000790 | 3300025961 | Bacteria | 23489 |
| 147 | Ga0207668_10000016 | 3300025972 | Bacteria | 159703 |
| 148 | Ga0207668_10000718 | 3300025972 | Bacteria | 20265 |
| 149 | Ga0207668_10001104 | 3300025972 | Bacteria | 16060 |
| 150 | Ga0207668_10001138 | 3300025972 | Bacteria | 15811 |
| 151 | Ga0207668_10026609 | 3300025972 | Bacteria | 3757 |
| 152 | Ga0207658_10010762 | 3300025986 | Bacteria | 6222 |
| 153 | Ga0207658_10139608 | 3300025986 | Bacteria | 1959 |
| 154 | Ga0207703_10000189 | 3300026035 | Bacteria | 72189 |
| 155 | Ga0207703_10002235 | 3300026035 | Bacteria | 16933 |
| 156 | Ga0207703_10003556 | 3300026035 | Bacteria | 13024 |
| 157 | Ga0207639_10123624 | 3300026041 | Bacteria | 2130 |
| 158 | Ga0207702_10099548 | 3300026078 | Bacteria | 2563 |
| 159 | Ga0207641_10000120 | 3300026088 | Bacteria | 116070 |
| 160 | Ga0207641_10001611 | 3300026088 | Bacteria | 22031 |
| 161 | Ga0207641_10064462 | 3300026088 | Bacteria | 3132 |
| 162 | Ga0207641_10068726 | 3300026088 | Bacteria | 3038 |
| 163 | Ga0207676_10000109 | 3300026095 | Bacteria | 74080 |
| 164 | Ga0207676_10000424 | 3300026095 | Bacteria | 35638 |
| 165 | Ga0207676_10001962 | 3300026095 | Bacteria | 14986 |
| 166 | Ga0207675_100253915 | 3300026118 | Bacteria | 1702 |
| 167 | Ga0207683_10023287 | 3300026121 | Bacteria | 5326 |
| 168 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 169 | Ga0268266_10002063 | 3300028379 | Bacteria | 22264 |
| 170 | Ga0268266_10008489 | 3300028379 | Bacteria | 9130 |
| 171 | Ga0268265_10004078 | 3300028380 | Bacteria | 10263 |
| 172 | Ga0268265_10012834 | 3300028380 | Bacteria | 5689 |
| 173 | Ga0268265_10020628 | 3300028380 | Bacteria | 4602 |
| 174 | Ga0268264_10000364 | 3300028381 | Bacteria | 67218 |
| 175 | Ga0268264_10000416 | 3300028381 | Bacteria | 60203 |
| 176 | Ga0268264_10015244 | 3300028381 | Bacteria | 6305 |
| 177 | Ga0268264_10168789 | 3300028381 | Bacteria | 1977 |
| 178 | Ga0265319_1043278 | 3300028563 | Bacteria | 1513 |
| 179 | Ga0307517_10003720 | 3300028786 | Bacteria | 23706 |
| 180 | Ga0307517_10106485 | 3300028786 | Bacteria | 2168 |
| 181 | Ga0265338_10011798 | 3300028800 | Bacteria | 10044 |
| 182 | Ga0265338_10206428 | 3300028800 | Bacteria | 1478 |
| 183 | Ga0265324_10023464 | 3300029957 | Bacteria | 2198 |
| 184 | Ga0307511_10007943 | 3300030521 | Bacteria | 10645 |
| 185 | Ga0265327_10000933 | 3300031251 | Bacteria | 42834 |
| 186 | Ga0307513_10004304 | 3300031456 | Bacteria | 19024 |
| 187 | Ga0307513_10018679 | 3300031456 | Bacteria | 8279 |
| 188 | Ga0307513_10021039 | 3300031456 | Bacteria | 7710 |
| 189 | Ga0307513_10053499 | 3300031456 | Bacteria | 4338 |
| 190 | Ga0265314_10007232 | 3300031711 | Bacteria | 9651 |
| 191 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 192 | Ga0307411_10028831 | 3300032005 | Bacteria | 3381 |
| 193 | Ga0307510_10025344 | 3300033180 | Bacteria | 6840 |
| 194 | Ga0307510_10116755 | 3300033180 | Bacteria | 2389 |
| 195 | Ga0373936_0026641 | 3300035113 | Bacteria | 2264 |
| 196 | Ga0373936_0052265 | 3300035113 | Bacteria | 1655 |
| 197 | Ga0395899_0016645 | 3300037312 | Bacteria | 5607 |
| 198 | Ga0395900_0000010 | 3300037418 | Bacteria | 461364 |
| 199 | Ga0395900_0011862 | 3300037418 | Bacteria | 8913 |
| 200 | Ga0395900_0110483 | 3300037418 | Bacteria | 2824 |
| 201 | Ga0395898_0034425 | 3300037466 | Bacteria | 5048 |
| 202 | Ga0395898_0104266 | 3300037466 | Bacteria | 2720 |
| 203 | Ga0395898_0123153 | 3300037466 | Bacteria | 2484 |
| 204 | Ga0395905_0001301 | 3300037471 | Bacteria | 30685 |
| 205 | Ga0395905_0011759 | 3300037471 | Bacteria | 8449 |
| 206 | Ga0395905_0032087 | 3300037471 | Bacteria | 4941 |
| 207 | Ga0395905_0038566 | 3300037471 | Bacteria | 4484 |
| 208 | Ga0395905_0090266 | 3300037471 | Bacteria | 2872 |
| 209 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 210 | Ga0436361_0129444 | 3300039447 | Bacteria | 9167 |
| 211 | Ga0436362_1202214 | 3300039453 | Bacteria | 1172 |
| 212 | Ga0466965_0051740 | 3300044683 | Bacteria | 2038 |
| 213 | Ga0495629_0024130 | 3300046459 | Bacteria | 4331 |
| 214 | Ga0495583_0040372 | 3300046506 | Bacteria | 2193 |
| 215 | Ga0495620_0012492 | 3300046515 | Bacteria | 4382 |
| 216 | Ga0495628_0183283 | 3300046516 | Bacteria | 1583 |
| 217 | Ga0495597_0013917 | 3300046542 | Bacteria | 3845 |
| 218 | Ga0495622_0003148 | 3300046557 | Bacteria | 7810 |
| 219 | Ga0495668_0000456 | 3300046616 | Bacteria | 52300 |
| 220 | Ga0495668_0036016 | 3300046616 | Bacteria | 2774 |
| 221 | Ga0495611_0027813 | 3300046648 | Bacteria | 2475 |
| 222 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 223 | Ga0495669_0000172 | 3300046684 | Bacteria | 40888 |
| 224 | Ga0495613_0000830 | 3300046689 | Bacteria | 23881 |
| 225 | Ga0495672_0053772 | 3300047320 | Bacteria | 2357 |
| 226 | Ga0495687_056070 | 3300047443 | Bacteria | 1645 |
| 227 | Ga0495686_0034167 | 3300047472 | Bacteria | 3277 |
| 228 | Ga0496101_0197360 | 3300048904 | Bacteria | 1555 |
| 229 | Ga0496102_0020954 | 3300048905 | Bacteria | 5781 |
| 230 | Ga0496108_0053086 | 3300048911 | Bacteria | 3398 |
| 231 | Ga0496112_0054241 | 3300048915 | Bacteria | 3938 |
| 232 | Ga0496112_0453417 | 3300048915 | Bacteria | 1220 |
| 233 | Ga0496115_0001599 | 3300048918 | Bacteria | 16277 |
| 234 | Ga0496115_0072475 | 3300048918 | Bacteria | 2795 |
| 235 | Ga0496115_0100160 | 3300048918 | Bacteria | 2375 |
| 236 | Ga0496117_0023789 | 3300048920 | Bacteria | 4867 |
| 237 | Ga0496118_0009194 | 3300048921 | Bacteria | 10034 |
| 238 | Ga0496119_0011383 | 3300048922 | Bacteria | 7375 |
| 239 | Ga0496121_0001187 | 3300048924 | Bacteria | 45612 |
| 240 | Ga0496125_0025772 | 3300048928 | Bacteria | 5377 |
| 241 | Ga0496126_0018224 | 3300048929 | Bacteria | 6967 |
| 242 | Ga0501033_0005132 | 3300049570 | Bacteria | 10415 |
| 243 | Ga0501033_0006219 | 3300049570 | Bacteria | 9359 |
| 244 | Ga0501034_0024267 | 3300049571 | Bacteria | 6167 |
| 245 | Ga0501047_0018544 | 3300049581 | Bacteria | 6674 |
| 246 | Ga0501257_001923 | 3300049686 | Bacteria | 4325 |
| 247 | Ga0501035_0024753 | 3300049822 | Bacteria | 5503 |
| 248 | Ga0501044_0004038 | 3300049823 | Bacteria | 16462 |
| 249 | Ga0501044_0006448 | 3300049823 | Bacteria | 12959 |
| 250 | nmdc:mga07m45_2532_c1 | 3300050496 | Bacteria | 8580 |
| 251 | nmdc:mga0sz30_27055_c1 | 3300050516 | Bacteria | 2354 |
| 252 | Ga0500635_0000082 | 3300053080 | Bacteria | 62117 |
| 253 | Ga0500643_000236 | 3300053087 | Bacteria | 51341 |
| 254 | Ga0500643_011155 | 3300053087 | Bacteria | 3296 |
| 255 | Ga0500643_016575 | 3300053087 | Bacteria | 2492 |
| 256 | Ga0500647_0040389 | 3300053091 | Bacteria | 2238 |
| 257 | Ga0500651_0092340 | 3300053093 | Bacteria | 1862 |
| 258 | Ga0500641_0007930 | 3300053096 | Bacteria | 3786 |
| 259 | Ga0500641_0036302 | 3300053096 | Bacteria | 1971 |
| 260 | Ga0500650_0096900 | 3300053098 | Bacteria | 1381 |
| 261 | Ga0500556_0001246 | 3300053104 | Bacteria | 11763 |
| 262 | Ga0500562_000623 | 3300053108 | Bacteria | 8548 |
| 263 | Ga0500562_001952 | 3300053108 | Bacteria | 5170 |
| 264 | Ga0500562_007712 | 3300053108 | Bacteria | 2714 |
| 265 | Ga0500569_001997 | 3300053109 | Bacteria | 3957 |
| 266 | Ga0500572_000293 | 3300053111 | Bacteria | 17881 |
| 267 | Ga0500594_0030130 | 3300053118 | Bacteria | 1423 |
| 268 | Ga0500595_007326 | 3300053119 | Bacteria | 4580 |
| 269 | Ga0500608_000207 | 3300053122 | Bacteria | 23415 |
| 270 | Ga0500608_008295 | 3300053122 | Bacteria | 4358 |
| 271 | Ga0500614_003945 | 3300053123 | Bacteria | 3167 |
| 272 | Ga0500652_052442 | 3300053131 | Bacteria | 1668 |
| 273 | Ga0500559_0000002 | 3300053136 | Bacteria | 262002 |
| 274 | Ga0500559_0003257 | 3300053136 | Bacteria | 8060 |
| 275 | Ga0500559_0052684 | 3300053136 | Bacteria | 1799 |
| 276 | Ga0500616_0006850 | 3300053153 | Bacteria | 7365 |
| 277 | Ga0500616_0022720 | 3300053153 | Bacteria | 3499 |
| 278 | Ga0500616_0061669 | 3300053153 | Bacteria | 1940 |
| 279 | Ga0500620_020946 | 3300053155 | Bacteria | 1947 |
| 280 | Ga0500622_0014917 | 3300053156 | Bacteria | 4165 |
| 281 | Ga0500622_0014955 | 3300053156 | Bacteria | 4160 |
| 282 | Ga0500622_0040386 | 3300053156 | Bacteria | 2430 |
| 283 | Ga0500636_0009256 | 3300053177 | Bacteria | 5725 |
| 284 | Ga0500636_0024604 | 3300053177 | Bacteria | 3561 |
| 285 | Ga0500637_0041569 | 3300053178 | Bacteria | 2598 |
| 286 | Ga0500625_028541 | 3300053729 | Bacteria | 2648 |
| 287 | Ga0500645_000790 | 3300053730 | Bacteria | 19008 |
| 288 | Ga0500645_001349 | 3300053730 | Bacteria | 12693 |
| 289 | Ga0500596_000259 | 3300053735 | Bacteria | 9297 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100002030 | Ga0070668_10000203011 | 296 |
| 2 | 3300005355 | Ga0070671_100000153 | Ga0070671_10000015327 | 296 |
| 3 | 3300005617 | Ga0068859_100001402 | Ga0068859_10000140223 | 296 |
| 4 | 3300005842 | Ga0068858_100001538 | Ga0068858_10000153818 | 296 |
| 5 | 3300006931 | Ga0097620_100001402 | Ga0097620_1000014022 | 296 |
| 6 | 3300025925 | Ga0207650_10007542 | Ga0207650_100075424 | 296 |
| 7 | 3300025941 | Ga0207711_10005736 | Ga0207711_1000573611 | 296 |
| 8 | 3300025972 | Ga0207668_10001138 | Ga0207668_1000113813 | 296 |
| 9 | 3300026035 | Ga0207703_10003556 | Ga0207703_1000355615 | 296 |
| 10 | 3300046542 | Ga0495597_0013917 | Ga0495597_0013917_273_1310 | 317 |
| 11 | 3300047443 | Ga0495687_056070 | Ga0495687_056070_443_1480 | 317 |
| 12 | 3300053123 | Ga0500614_003945 | Ga0500614_003945_631_1668 | 317 |
| 13 | 3300053735 | Ga0500596_000259 | Ga0500596_000259_5108_6145 | 317 |
| 14 | 3300050496 | nmdc:mga07m45_2532_c1 | nmdc:mga07m45_2532_c1_6182_7303 | 324 |
| 15 | 3300047320 | Ga0495672_0053772 | Ga0495672_0053772_16_1095 | 328 |
| 16 | 3300053177 | Ga0500636_0024604 | Ga0500636_0024604_1726_2844 | 329 |
| 17 | 3300005347 | Ga0070668_100016378 | Ga0070668_1000163785 | 331 |
| 18 | 3300028800 | Ga0265338_10206428 | Ga0265338_102064281 | 331 |
| 19 | 3300029957 | Ga0265324_10023464 | Ga0265324_100234642 | 331 |
| 20 | 3300031711 | Ga0265314_10007232 | Ga0265314_100072326 | 331 |
| 21 | 3300005331 | Ga0070670_100036704 | Ga0070670_1000367045 | 332 |
| 22 | 3300005347 | Ga0070668_100001998 | Ga0070668_1000019984 | 332 |
| 23 | 3300005548 | Ga0070665_100132084 | Ga0070665_1001320842 | 332 |
| 24 | 3300005617 | Ga0068859_100010234 | Ga0068859_1000102344 | 332 |
| 25 | 3300005618 | Ga0068864_100330465 | Ga0068864_1003304652 | 332 |
| 26 | 3300005843 | Ga0068860_100000517 | Ga0068860_10000051741 | 332 |
| 27 | 3300005843 | Ga0068860_100001527 | Ga0068860_10000152720 | 332 |
| 28 | 3300005844 | Ga0068862_100147302 | Ga0068862_1001473022 | 332 |
| 29 | 3300006931 | Ga0097620_100010235 | Ga0097620_1000102354 | 332 |
| 30 | 3300025925 | Ga0207650_10090000 | Ga0207650_100900002 | 332 |
| 31 | 3300025972 | Ga0207668_10001104 | Ga0207668_1000110411 | 332 |
| 32 | 3300025972 | Ga0207668_10026609 | Ga0207668_100266095 | 332 |
| 33 | 3300025986 | Ga0207658_10139608 | Ga0207658_101396081 | 332 |
| 34 | 3300028380 | Ga0268265_10004078 | Ga0268265_100040782 | 332 |
| 35 | 3300028380 | Ga0268265_10020628 | Ga0268265_100206285 | 332 |
| 36 | 3300028381 | Ga0268264_10000416 | Ga0268264_1000041629 | 332 |
| 37 | 3300028381 | Ga0268264_10015244 | Ga0268264_100152447 | 332 |
| 38 | 3300037466 | Ga0395898_0123153 | Ga0395898_0123153_23_1099 | 332 |
| 39 | 3300049686 | Ga0501257_001923 | Ga0501257_001923_1310_2425 | 332 |
| 40 | 3300031456 | Ga0307513_10021039 | Ga0307513_100210398 | 333 |
| 41 | 3300046689 | Ga0495613_0000830 | Ga0495613_0000830_11879_12988 | 334 |
| 42 | 3300053108 | Ga0500562_007712 | Ga0500562_007712_816_1925 | 334 |
| 43 | 3300048928 | Ga0496125_0025772 | Ga0496125_0025772_1768_2871 | 336 |
| 44 | 3300005334 | Ga0068869_100300359 | Ga0068869_1003003592 | 337 |
| 45 | 3300037418 | Ga0395900_0110483 | Ga0395900_0110483_252_1361 | 337 |
| 46 | 3300037466 | Ga0395898_0104266 | Ga0395898_0104266_1207_2316 | 337 |
| 47 | 3300037471 | Ga0395905_0038566 | Ga0395905_0038566_2123_3232 | 337 |
| 48 | 3300003781 | Ga0055536_1000604 | Ga0055536_100060419 | 338 |
| 49 | 3300003791 | Ga0055530_10000899 | Ga0055530_1000089919 | 338 |
| 50 | 3300003792 | Ga0055540_1022513 | Ga0055540_10225132 | 338 |
| 51 | 3300025292 | Ga0209676_1000311 | Ga0209676_100031119 | 338 |
| 52 | 3300025298 | Ga0209050_1000375 | Ga0209050_100037519 | 338 |
| 53 | 3300025303 | Ga0209051_1003593 | Ga0209051_10035933 | 338 |
| 54 | 3300025304 | Ga0209257_1004459 | Ga0209257_10044599 | 338 |
| 55 | 3300046616 | Ga0495668_0036016 | Ga0495668_0036016_413_1540 | 339 |
| 56 | 3300046684 | Ga0495669_0000001 | Ga0495669_0000001_47244_48356 | 339 |
| 57 | 3300003781 | Ga0055536_1000595 | Ga0055536_100059520 | 340 |
| 58 | 3300003791 | Ga0055530_10002781 | Ga0055530_1000278110 | 340 |
| 59 | 3300003794 | Ga0055531_10000847 | Ga0055531_1000084720 | 340 |
| 60 | 3300025292 | Ga0209676_1000243 | Ga0209676_100024368 | 340 |
| 61 | 3300025298 | Ga0209050_1000244 | Ga0209050_100024468 | 340 |
| 62 | 3300025304 | Ga0209257_1000140 | Ga0209257_100014056 | 340 |
| 63 | 3300053156 | Ga0500622_0014955 | Ga0500622_0014955_2139_3299 | 340 |
| 64 | 3300005456 | Ga0070678_100134493 | Ga0070678_1001344932 | 341 |
| 65 | 3300005457 | Ga0070662_100204643 | Ga0070662_1002046431 | 341 |
| 66 | 3300005618 | Ga0068864_100001967 | Ga0068864_1000019679 | 341 |
| 67 | 3300005841 | Ga0068863_100007829 | Ga0068863_10000782910 | 341 |
| 68 | 3300005842 | Ga0068858_100067705 | Ga0068858_1000677054 | 341 |
| 69 | 3300025933 | Ga0207706_10238239 | Ga0207706_102382391 | 341 |
| 70 | 3300025941 | Ga0207711_10107588 | Ga0207711_101075882 | 341 |
| 71 | 3300025960 | Ga0207651_10183487 | Ga0207651_101834872 | 341 |
| 72 | 3300026088 | Ga0207641_10068726 | Ga0207641_100687262 | 341 |
| 73 | 3300026095 | Ga0207676_10001962 | Ga0207676_1000196218 | 341 |
| 74 | 3300026121 | Ga0207683_10023287 | Ga0207683_100232876 | 341 |
| 75 | 3300028786 | Ga0307517_10106485 | Ga0307517_101064852 | 341 |
| 76 | 3300048905 | Ga0496102_0020954 | Ga0496102_0020954_3575_4678 | 341 |
| 77 | 3300048911 | Ga0496108_0053086 | Ga0496108_0053086_2139_3242 | 341 |
| 78 | 3300048915 | Ga0496112_0453417 | Ga0496112_0453417_98_1201 | 341 |
| 79 | iso_pu_bacteria | 2585428106 | 2587918024 | 341 |
| 80 | iso_pu_bacteria | 2643221598 | 2644002238 | 341 |
| 81 | iso_pu_bacteria | 2643221614 | 2644085599 | 341 |
| 82 | iso_pu_bacteria | 2643221640 | 2644224558 | 341 |
| 83 | iso_pu_bacteria | 2643221642 | 2644234507 | 341 |
| 84 | iso_pu_bacteria | 2643221661 | 2644343150 | 341 |
| 85 | iso_pu_bacteria | 2643221666 | 2644366450 | 341 |
| 86 | iso_pu_bacteria | 2857504554 | 2857504818 | 341 |
| 87 | iso_pu_bacteria | 2884960567 | 2884965365 | 341 |
| 88 | iso_pu_bacteria | 2928531327 | 2928532865 | 341 |
| 89 | 3300005347 | Ga0070668_100004043 | Ga0070668_1000040433 | 343 |
| 90 | 3300005367 | Ga0070667_100015159 | Ga0070667_1000151596 | 343 |
| 91 | 3300005548 | Ga0070665_100000867 | Ga0070665_10000086728 | 343 |
| 92 | 3300025972 | Ga0207668_10000016 | Ga0207668_10000016153 | 343 |
| 93 | 3300028379 | Ga0268266_10008489 | Ga0268266_100084896 | 343 |
| 94 | 3300049570 | Ga0501033_0006219 | Ga0501033_0006219_583_1692 | 343 |
| 95 | 3300049823 | Ga0501044_0006448 | Ga0501044_0006448_4207_5316 | 343 |
| 96 | 3300053087 | Ga0500643_016575 | Ga0500643_016575_443_1555 | 343 |
| 97 | 3300053131 | Ga0500652_052442 | Ga0500652_052442_17_1225 | 343 |
| 98 | 3300046684 | Ga0495669_0000172 | Ga0495669_0000172_9435_10547 | 344 |
| 99 | 3300053153 | Ga0500616_0061669 | Ga0500616_0061669_377_1489 | 344 |
| 100 | 3300005331 | Ga0070670_100000050 | Ga0070670_100000050109 | 345 |
| 101 | 3300005331 | Ga0070670_100007260 | Ga0070670_1000072604 | 345 |
| 102 | 3300005331 | Ga0070670_100022919 | Ga0070670_1000229195 | 345 |
| 103 | 3300005335 | Ga0070666_10020342 | Ga0070666_100203424 | 345 |
| 104 | 3300005335 | Ga0070666_10158598 | Ga0070666_101585982 | 345 |
| 105 | 3300005347 | Ga0070668_100001877 | Ga0070668_10000187712 | 345 |
| 106 | 3300005367 | Ga0070667_100000299 | Ga0070667_10000029932 | 345 |
| 107 | 3300005548 | Ga0070665_100001434 | Ga0070665_10000143418 | 345 |
| 108 | 3300005548 | Ga0070665_100012517 | Ga0070665_1000125179 | 345 |
| 109 | 3300005618 | Ga0068864_100000238 | Ga0068864_10000023826 | 345 |
| 110 | 3300005618 | Ga0068864_100002426 | Ga0068864_10000242618 | 345 |
| 111 | 3300005618 | Ga0068864_100084238 | Ga0068864_1000842384 | 345 |
| 112 | 3300005841 | Ga0068863_100000167 | Ga0068863_10000016711 | 345 |
| 113 | 3300005841 | Ga0068863_100000531 | Ga0068863_1000005315 | 345 |
| 114 | 3300005841 | Ga0068863_100171898 | Ga0068863_1001718982 | 345 |
| 115 | 3300005842 | Ga0068858_100007719 | Ga0068858_1000077192 | 345 |
| 116 | 3300005842 | Ga0068858_100007943 | Ga0068858_1000079433 | 345 |
| 117 | 3300005843 | Ga0068860_100000676 | Ga0068860_10000067632 | 345 |
| 118 | 3300005844 | Ga0068862_100000786 | Ga0068862_1000007869 | 345 |
| 119 | 3300009092 | Ga0105250_10026932 | Ga0105250_100269323 | 345 |
| 120 | 3300009177 | Ga0105248_10002620 | Ga0105248_1000262020 | 345 |
| 121 | 3300009177 | Ga0105248_10002783 | Ga0105248_1000278321 | 345 |
| 122 | 3300009177 | Ga0105248_10030043 | Ga0105248_100300432 | 345 |
| 123 | 3300009553 | Ga0105249_10000356 | Ga0105249_1000035622 | 345 |
| 124 | 3300010375 | Ga0105239_10028133 | Ga0105239_100281333 | 345 |
| 125 | 3300013306 | Ga0163162_10008333 | Ga0163162_1000833310 | 345 |
| 126 | 3300014325 | Ga0163163_10001756 | Ga0163163_1000175621 | 345 |
| 127 | 3300014968 | Ga0157379_10001501 | Ga0157379_1000150113 | 345 |
| 128 | 3300014968 | Ga0157379_10001581 | Ga0157379_1000158121 | 345 |
| 129 | 3300014968 | Ga0157379_10077416 | Ga0157379_100774161 | 345 |
| 130 | 3300017792 | Ga0163161_10201238 | Ga0163161_102012381 | 345 |
| 131 | 3300021361 | Ga0213872_10019359 | Ga0213872_100193593 | 345 |
| 132 | 3300025925 | Ga0207650_10000133 | Ga0207650_1000013366 | 345 |
| 133 | 3300025925 | Ga0207650_10031237 | Ga0207650_100312373 | 345 |
| 134 | 3300025931 | Ga0207644_10001604 | Ga0207644_100016046 | 345 |
| 135 | 3300025941 | Ga0207711_10002205 | Ga0207711_100022052 | 345 |
| 136 | 3300025961 | Ga0207712_10000790 | Ga0207712_100007904 | 345 |
| 137 | 3300025972 | Ga0207668_10000718 | Ga0207668_100007185 | 345 |
| 138 | 3300025986 | Ga0207658_10010762 | Ga0207658_100107625 | 345 |
| 139 | 3300026035 | Ga0207703_10000189 | Ga0207703_100001898 | 345 |
| 140 | 3300026035 | Ga0207703_10002235 | Ga0207703_100022353 | 345 |
| 141 | 3300026088 | Ga0207641_10000120 | Ga0207641_1000012094 | 345 |
| 142 | 3300026088 | Ga0207641_10001611 | Ga0207641_100016111 | 345 |
| 143 | 3300026088 | Ga0207641_10064462 | Ga0207641_100644623 | 345 |
| 144 | 3300026095 | Ga0207676_10000109 | Ga0207676_1000010926 | 345 |
| 145 | 3300026095 | Ga0207676_10000424 | Ga0207676_100004248 | 345 |
| 146 | 3300026118 | Ga0207675_100253915 | Ga0207675_1002539151 | 345 |
| 147 | 3300028379 | Ga0268266_10002063 | Ga0268266_1000206316 | 345 |
| 148 | 3300028380 | Ga0268265_10012834 | Ga0268265_100128347 | 345 |
| 149 | 3300028381 | Ga0268264_10000364 | Ga0268264_1000036427 | 345 |
| 150 | 3300028381 | Ga0268264_10168789 | Ga0268264_101687893 | 345 |
| 151 | 3300028563 | Ga0265319_1043278 | Ga0265319_10432782 | 345 |
| 152 | 3300028786 | Ga0307517_10003720 | Ga0307517_1000372017 | 345 |
| 153 | 3300028800 | Ga0265338_10011798 | Ga0265338_100117984 | 345 |
| 154 | 3300031251 | Ga0265327_10000933 | Ga0265327_1000093324 | 345 |
| 155 | 3300031456 | Ga0307513_10004304 | Ga0307513_100043046 | 345 |
| 156 | 3300031456 | Ga0307513_10053499 | Ga0307513_100534994 | 345 |
| 157 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004146 | 345 |
| 158 | 3300032005 | Ga0307411_10028831 | Ga0307411_100288315 | 345 |
| 159 | 3300033180 | Ga0307510_10025344 | Ga0307510_100253448 | 345 |
| 160 | 3300033180 | Ga0307510_10116755 | Ga0307510_101167552 | 345 |
| 161 | 3300039447 | Ga0436361_0129444 | Ga0436361_0129444_2719_3834 | 345 |
| 162 | 3300039453 | Ga0436362_1202214 | Ga0436362_1202214_46_1161 | 345 |
| 163 | 3300044683 | Ga0466965_0051740 | Ga0466965_0051740_351_1466 | 345 |
| 164 | 3300046459 | Ga0495629_0024130 | Ga0495629_0024130_1514_2635 | 345 |
| 165 | 3300046515 | Ga0495620_0012492 | Ga0495620_0012492_1663_2784 | 345 |
| 166 | 3300046557 | Ga0495622_0003148 | Ga0495622_0003148_1500_2621 | 345 |
| 167 | 3300046616 | Ga0495668_0000456 | Ga0495668_0000456_28505_29620 | 345 |
| 168 | 3300047472 | Ga0495686_0034167 | Ga0495686_0034167_1620_2735 | 345 |
| 169 | 3300048904 | Ga0496101_0197360 | Ga0496101_0197360_337_1455 | 345 |
| 170 | 3300048918 | Ga0496115_0100160 | Ga0496115_0100160_1049_2164 | 345 |
| 171 | 3300048920 | Ga0496117_0023789 | Ga0496117_0023789_2784_3905 | 345 |
| 172 | 3300048921 | Ga0496118_0009194 | Ga0496118_0009194_1527_2648 | 345 |
| 173 | 3300048922 | Ga0496119_0011383 | Ga0496119_0011383_747_1868 | 345 |
| 174 | 3300048924 | Ga0496121_0001187 | Ga0496121_0001187_4547_5668 | 345 |
| 175 | 3300048929 | Ga0496126_0018224 | Ga0496126_0018224_1908_3023 | 345 |
| 176 | 3300049570 | Ga0501033_0005132 | Ga0501033_0005132_6219_7334 | 345 |
| 177 | 3300049581 | Ga0501047_0018544 | Ga0501047_0018544_5421_6536 | 345 |
| 178 | 3300049822 | Ga0501035_0024753 | Ga0501035_0024753_1990_3105 | 345 |
| 179 | 3300049823 | Ga0501044_0004038 | Ga0501044_0004038_13215_14330 | 345 |
| 180 | 3300050516 | nmdc:mga0sz30_27055_c1 | nmdc:mga0sz30_27055_c1_1204_2319 | 345 |
| 181 | 3300053080 | Ga0500635_0000082 | Ga0500635_0000082_5968_7089 | 345 |
| 182 | 3300053087 | Ga0500643_000236 | Ga0500643_000236_30237_31352 | 345 |
| 183 | 3300053087 | Ga0500643_011155 | Ga0500643_011155_829_1944 | 345 |
| 184 | 3300053091 | Ga0500647_0040389 | Ga0500647_0040389_794_1915 | 345 |
| 185 | 3300053093 | Ga0500651_0092340 | Ga0500651_0092340_346_1467 | 345 |
| 186 | 3300053096 | Ga0500641_0007930 | Ga0500641_0007930_2379_3494 | 345 |
| 187 | 3300053098 | Ga0500650_0096900 | Ga0500650_0096900_211_1326 | 345 |
| 188 | 3300053104 | Ga0500556_0001246 | Ga0500556_0001246_1687_2802 | 345 |
| 189 | 3300053108 | Ga0500562_001952 | Ga0500562_001952_1691_2806 | 345 |
| 190 | 3300053109 | Ga0500569_001997 | Ga0500569_001997_2403_3524 | 345 |
| 191 | 3300053111 | Ga0500572_000293 | Ga0500572_000293_12628_13845 | 345 |
| 192 | 3300053119 | Ga0500595_007326 | Ga0500595_007326_3140_4261 | 345 |
| 193 | 3300053122 | Ga0500608_000207 | Ga0500608_000207_12868_13983 | 345 |
| 194 | 3300053122 | Ga0500608_008295 | Ga0500608_008295_565_1686 | 345 |
| 195 | 3300053136 | Ga0500559_0000002 | Ga0500559_0000002_211943_213061 | 345 |
| 196 | 3300053136 | Ga0500559_0003257 | Ga0500559_0003257_1955_3070 | 345 |
| 197 | 3300053136 | Ga0500559_0052684 | Ga0500559_0052684_393_1514 | 345 |
| 198 | 3300053153 | Ga0500616_0006850 | Ga0500616_0006850_2442_3557 | 345 |
| 199 | 3300053153 | Ga0500616_0022720 | Ga0500616_0022720_1394_2509 | 345 |
| 200 | 3300053155 | Ga0500620_020946 | Ga0500620_020946_316_1437 | 345 |
| 201 | 3300053156 | Ga0500622_0014917 | Ga0500622_0014917_665_1780 | 345 |
| 202 | 3300053156 | Ga0500622_0040386 | Ga0500622_0040386_779_1894 | 345 |
| 203 | 3300053177 | Ga0500636_0009256 | Ga0500636_0009256_2108_3229 | 345 |
| 204 | 3300053178 | Ga0500637_0041569 | Ga0500637_0041569_874_1995 | 345 |
| 205 | 3300053729 | Ga0500625_028541 | Ga0500625_028541_1040_2161 | 345 |
| 206 | 3300053730 | Ga0500645_000790 | Ga0500645_000790_13100_14215 | 345 |
| 207 | 3300053730 | Ga0500645_001349 | Ga0500645_001349_2284_3399 | 345 |
| 208 | 3300009545 | Ga0105237_10187201 | Ga0105237_101872012 | 347 |
| 209 | 3300009551 | Ga0105238_10016707 | Ga0105238_100167074 | 347 |
| 210 | 3300049571 | Ga0501034_0024267 | Ga0501034_0024267_2174_3340 | 347 |
| 211 | 3300005335 | Ga0070666_10097222 | Ga0070666_100972222 | 348 |
| 212 | 3300003215 | JGI25153J46596_10022632 | JGI25153J46596_100226322 | 349 |
| 213 | 3300003791 | Ga0055530_10000188 | Ga0055530_1000018825 | 349 |
| 214 | 3300003794 | Ga0055531_10008205 | Ga0055531_100082053 | 349 |
| 215 | 3300005262 | Ga0065165_1000029 | Ga0065165_1000029118 | 349 |
| 216 | 3300005327 | Ga0070658_10036302 | Ga0070658_100363024 | 349 |
| 217 | 3300005327 | Ga0070658_10065613 | Ga0070658_100656134 | 349 |
| 218 | 3300005336 | Ga0070680_100005561 | Ga0070680_1000055613 | 349 |
| 219 | 3300005339 | Ga0070660_100059437 | Ga0070660_1000594374 | 349 |
| 220 | 3300005341 | Ga0070691_10004623 | Ga0070691_100046233 | 349 |
| 221 | 3300005366 | Ga0070659_100000040 | Ga0070659_10000004089 | 349 |
| 222 | 3300005366 | Ga0070659_100008635 | Ga0070659_1000086355 | 349 |
| 223 | 3300005458 | Ga0070681_10015006 | Ga0070681_100150068 | 349 |
| 224 | 3300005458 | Ga0070681_10030623 | Ga0070681_100306234 | 349 |
| 225 | 3300005458 | Ga0070681_10097961 | Ga0070681_100979613 | 349 |
| 226 | 3300005530 | Ga0070679_100162908 | Ga0070679_1001629082 | 349 |
| 227 | 3300005530 | Ga0070679_100245500 | Ga0070679_1002455002 | 349 |
| 228 | 3300005539 | Ga0068853_100066223 | Ga0068853_1000662231 | 349 |
| 229 | 3300005548 | Ga0070665_100000248 | Ga0070665_10000024867 | 349 |
| 230 | 3300005548 | Ga0070665_100020273 | Ga0070665_1000202735 | 349 |
| 231 | 3300005563 | Ga0068855_100011064 | Ga0068855_1000110647 | 349 |
| 232 | 3300005563 | Ga0068855_100035175 | Ga0068855_1000351753 | 349 |
| 233 | 3300005563 | Ga0068855_100053362 | Ga0068855_1000533623 | 349 |
| 234 | 3300005614 | Ga0068856_100135583 | Ga0068856_1001355833 | 349 |
| 235 | 3300005616 | Ga0068852_100013708 | Ga0068852_1000137085 | 349 |
| 236 | 3300006881 | Ga0068865_100002003 | Ga0068865_1000020036 | 349 |
| 237 | 3300009093 | Ga0105240_10000522 | Ga0105240_1000052214 | 349 |
| 238 | 3300009093 | Ga0105240_10022832 | Ga0105240_100228326 | 349 |
| 239 | 3300009093 | Ga0105240_10056518 | Ga0105240_100565184 | 349 |
| 240 | 3300009093 | Ga0105240_10073487 | Ga0105240_100734873 | 349 |
| 241 | 3300009176 | Ga0105242_10203616 | Ga0105242_102036161 | 349 |
| 242 | 3300009177 | Ga0105248_10002192 | Ga0105248_1000219211 | 349 |
| 243 | 3300009551 | Ga0105238_10051376 | Ga0105238_100513763 | 349 |
| 244 | 3300010375 | Ga0105239_10151828 | Ga0105239_101518282 | 349 |
| 245 | 3300013105 | Ga0157369_10184694 | Ga0157369_101846942 | 349 |
| 246 | 3300013296 | Ga0157374_10114856 | Ga0157374_101148562 | 349 |
| 247 | 3300013306 | Ga0163162_10141996 | Ga0163162_101419963 | 349 |
| 248 | 3300013308 | Ga0157375_10053522 | Ga0157375_100535223 | 349 |
| 249 | 3300025272 | Ga0209455_1015955 | Ga0209455_10159551 | 349 |
| 250 | 3300025297 | Ga0209758_1004222 | Ga0209758_100422212 | 349 |
| 251 | 3300025298 | Ga0209050_1000031 | Ga0209050_1000031281 | 349 |
| 252 | 3300025304 | Ga0209257_1000073 | Ga0209257_100007399 | 349 |
| 253 | 3300025909 | Ga0207705_10002329 | Ga0207705_100023299 | 349 |
| 254 | 3300025909 | Ga0207705_10066327 | Ga0207705_100663273 | 349 |
| 255 | 3300025912 | Ga0207707_10017930 | Ga0207707_100179302 | 349 |
| 256 | 3300025913 | Ga0207695_10000987 | Ga0207695_100009874 | 349 |
| 257 | 3300025913 | Ga0207695_10001134 | Ga0207695_1000113414 | 349 |
| 258 | 3300025913 | Ga0207695_10010039 | Ga0207695_100100395 | 349 |
| 259 | 3300025913 | Ga0207695_10028456 | Ga0207695_100284563 | 349 |
| 260 | 3300025913 | Ga0207695_10256773 | Ga0207695_102567731 | 349 |
| 261 | 3300025917 | Ga0207660_10003341 | Ga0207660_100033413 | 349 |
| 262 | 3300025917 | Ga0207660_10137835 | Ga0207660_101378352 | 349 |
| 263 | 3300025919 | Ga0207657_10007945 | Ga0207657_100079457 | 349 |
| 264 | 3300025919 | Ga0207657_10063693 | Ga0207657_100636934 | 349 |
| 265 | 3300025921 | Ga0207652_10024525 | Ga0207652_100245255 | 349 |
| 266 | 3300025921 | Ga0207652_10052009 | Ga0207652_100520094 | 349 |
| 267 | 3300025924 | Ga0207694_10058049 | Ga0207694_100580493 | 349 |
| 268 | 3300025931 | Ga0207644_10212549 | Ga0207644_102125492 | 349 |
| 269 | 3300025932 | Ga0207690_10000134 | Ga0207690_1000013414 | 349 |
| 270 | 3300025932 | Ga0207690_10019025 | Ga0207690_100190253 | 349 |
| 271 | 3300025938 | Ga0207704_10007013 | Ga0207704_100070132 | 349 |
| 272 | 3300025941 | Ga0207711_10005329 | Ga0207711_1000532912 | 349 |
| 273 | 3300025949 | Ga0207667_10016558 | Ga0207667_100165587 | 349 |
| 274 | 3300025949 | Ga0207667_10033643 | Ga0207667_100336433 | 349 |
| 275 | 3300026041 | Ga0207639_10123624 | Ga0207639_101236242 | 349 |
| 276 | 3300026078 | Ga0207702_10099548 | Ga0207702_100995483 | 349 |
| 277 | 3300028379 | Ga0268266_10000005 | Ga0268266_100000051139 | 349 |
| 278 | 3300030521 | Ga0307511_10007943 | Ga0307511_100079434 | 349 |
| 279 | 3300031456 | Ga0307513_10018679 | Ga0307513_100186799 | 349 |
| 280 | 3300035113 | Ga0373936_0026641 | Ga0373936_0026641_386_1513 | 349 |
| 281 | 3300035113 | Ga0373936_0052265 | Ga0373936_0052265_61_1188 | 349 |
| 282 | 3300037312 | Ga0395899_0016645 | Ga0395899_0016645_4207_5334 | 349 |
| 283 | 3300037418 | Ga0395900_0000010 | Ga0395900_0000010_356232_357359 | 349 |
| 284 | 3300037418 | Ga0395900_0011862 | Ga0395900_0011862_6935_8065 | 349 |
| 285 | 3300037466 | Ga0395898_0034425 | Ga0395898_0034425_3648_4775 | 349 |
| 286 | 3300037471 | Ga0395905_0001301 | Ga0395905_0001301_28961_30088 | 349 |
| 287 | 3300037471 | Ga0395905_0011759 | Ga0395905_0011759_4643_5770 | 349 |
| 288 | 3300037471 | Ga0395905_0032087 | Ga0395905_0032087_3464_4591 | 349 |
| 289 | 3300037471 | Ga0395905_0090266 | Ga0395905_0090266_224_1354 | 349 |
| 290 | 3300038443 | Ga0395901_0000007 | Ga0395901_0000007_440596_441723 | 349 |
| 291 | 3300046506 | Ga0495583_0040372 | Ga0495583_0040372_860_1987 | 349 |
| 292 | 3300046516 | Ga0495628_0183283 | Ga0495628_0183283_96_1223 | 349 |
| 293 | 3300046648 | Ga0495611_0027813 | Ga0495611_0027813_164_1291 | 349 |
| 294 | 3300048915 | Ga0496112_0054241 | Ga0496112_0054241_1844_2977 | 349 |
| 295 | 3300048918 | Ga0496115_0001599 | Ga0496115_0001599_2497_3624 | 349 |
| 296 | 3300048918 | Ga0496115_0072475 | Ga0496115_0072475_101_1228 | 349 |
| 297 | 3300053096 | Ga0500641_0036302 | Ga0500641_0036302_294_1424 | 349 |
| 298 | 3300053108 | Ga0500562_000623 | Ga0500562_000623_1209_2339 | 349 |
| 299 | 3300053118 | Ga0500594_0030130 | Ga0500594_0030130_64_1236 | 349 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fef-assembly1.cif.gz_J | structure of mce1 transporter from mycobacterium smegmatis (map0) | 0.773 | 125 | 342 |
| 7ch8-assembly1.cif.gz_H | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.7662 | 111 | 343 |
| 7d06-assembly1.cif.gz_D | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.7504 | 109 | 343 |
| 7ch9-assembly1.cif.gz_H | cryo-em structure of p.aeruginosa mlafebd | 0.7375 | 111 | 343 |
| 7d0a-assembly1.cif.gz_D | acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation | 0.728 | 109 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t6rA00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7137 | 5 | 94 | 3.30.750.24 |
| af_P71568_9_126_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.6869 | 3 | 94 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.6801 | 3 | 91 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.6731 | 5 | 88 | 3.30.750.24 |
| 3if5A02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.672 | 8 | 80 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1WY46-F1-model_v4 | deleted | 0.8275 | 209 | 349 |
|
| AF-A0A2N1WY46-F1-model_v4 | deleted | 0.8173 | 209 | 349 |
|
| AF-A0A0R2X768-F1-model_v4 | ABC transporter permease | 0.8126 | 132 | 346 |
GO:0005548
GO:0043190 |
| AF-A0A2V6A8Q9-F1-model_v4 | ABC transporter permease | 0.8114 | 126 | 340 |
GO:0005548
GO:0043190 |
| AF-A0A3M2F3X5-F1-model_v4 | ABC transporter permease | 0.8032 | 112 | 347 |
GO:0005548
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar