F395087

General Info

Members Datasets Scaffolds Average Seq Length
299 170 289 349

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_000293|Ga0500572_000293_12628_13845
Length 385
Sequence MNDLMHRPGAAGKRGNLMLGSSVAVSDSDRSPLIEHPADFRLLDAEGGLKAELTGDWTSRTMGGAADRLRSELANRHAKIVDMTQMGRCDTSGAYAIVRAAENAGAADAQIKARPETQRLIDLVSRVKEDEVAPPPQPSLWNRFLVRLGRGITNLGVEGYETLAFNGRILAAMGRLIANPKKFRWAPFVALAERAGLDALPIVSVTSFFIGAVVGLLGAHMLSQFGAQVFAVEGRSASSFAAEIGSMKMNQEIDAMRVMGVDPFEALVLPRFMALLFTIPLLTFVAALAGLLGGMCVTWAVLGISPDFFMARVVDQVGVSHFWVGLSKAPVMAIVIAGIGCRQGMEVGGDVESLGRRVTAAVVHAIFSIIMIDAVFALVYMEANL

Samples

Sample ID Description Type Environment
1 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221640 Caulobacter sp. Root342 Isolate Unclassified
5 2643221642 Caulobacter sp. Root343 Isolate Unclassified
6 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
7 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
8 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
9 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
10 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
150 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
151 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
152 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
167 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
168 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
169 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
170 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 0
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.4
Nodule 0
Rhizoplane 2.68
Rhizosphere 69.23
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10022632 3300003215 Bacteria 2310
2 Ga0055536_1000595 3300003781 Bacteria 24647
3 Ga0055536_1000604 3300003781 Bacteria 24459
4 Ga0055530_10000188 3300003791 Bacteria 55307
5 Ga0055530_10000899 3300003791 Bacteria 24455
6 Ga0055530_10002781 3300003791 Bacteria 10795
7 Ga0055540_1022513 3300003792 Bacteria 1610
8 Ga0055531_10000847 3300003794 Bacteria 25245
9 Ga0055531_10008205 3300003794 Bacteria 5558
10 Ga0065165_1000029 3300005262 Bacteria 220342
11 Ga0070658_10036302 3300005327 Bacteria 3973
12 Ga0070658_10065613 3300005327 Bacteria 2963
13 Ga0070670_100000050 3300005331 Bacteria 132470
14 Ga0070670_100007260 3300005331 Bacteria 9393
15 Ga0070670_100022919 3300005331 Bacteria 5372
16 Ga0070670_100036704 3300005331 Bacteria 4217
17 Ga0068869_100300359 3300005334 Bacteria 1296
18 Ga0070666_10020342 3300005335 Bacteria 4290
19 Ga0070666_10097222 3300005335 Bacteria 2027
20 Ga0070666_10158598 3300005335 Bacteria 1581
21 Ga0070680_100005561 3300005336 Bacteria 9539
22 Ga0070660_100059437 3300005339 Bacteria 2964
23 Ga0070691_10004623 3300005341 Bacteria 6257
24 Ga0070668_100001877 3300005347 Bacteria 15355
25 Ga0070668_100001998 3300005347 Bacteria 14909
26 Ga0070668_100002030 3300005347 Bacteria 14799
27 Ga0070668_100004043 3300005347 Bacteria 10854
28 Ga0070668_100016378 3300005347 Bacteria 5543
29 Ga0070671_100000153 3300005355 Bacteria 45037
30 Ga0070659_100000040 3300005366 Bacteria 104145
31 Ga0070659_100008635 3300005366 Bacteria 7451
32 Ga0070667_100000299 3300005367 Bacteria 55531
33 Ga0070667_100015159 3300005367 Bacteria 6367
34 Ga0070678_100134493 3300005456 Bacteria 1970
35 Ga0070662_100204643 3300005457 Bacteria 1568
36 Ga0070681_10015006 3300005458 Bacteria 7704
37 Ga0070681_10030623 3300005458 Bacteria 5400
38 Ga0070681_10097961 3300005458 Bacteria 2879
39 Ga0070679_100162908 3300005530 Bacteria 2204
40 Ga0070679_100245500 3300005530 Bacteria 1747
41 Ga0068853_100066223 3300005539 Bacteria 3137
42 Ga0070665_100000248 3300005548 Bacteria 89239
43 Ga0070665_100000867 3300005548 Bacteria 39214
44 Ga0070665_100001434 3300005548 Bacteria 27937
45 Ga0070665_100012517 3300005548 Bacteria 8547
46 Ga0070665_100020273 3300005548 Bacteria 6676
47 Ga0070665_100132084 3300005548 Bacteria 2499
48 Ga0068855_100011064 3300005563 Bacteria 10886
49 Ga0068855_100035175 3300005563 Bacteria 5967
50 Ga0068855_100053362 3300005563 Bacteria 4756
51 Ga0068856_100135583 3300005614 Bacteria 2467
52 Ga0068852_100013708 3300005616 Bacteria 6211
53 Ga0068859_100001402 3300005617 Bacteria 24458
54 Ga0068859_100010234 3300005617 Bacteria 9439
55 Ga0068864_100000238 3300005618 Bacteria 49284
56 Ga0068864_100001967 3300005618 Bacteria 16895
57 Ga0068864_100002426 3300005618 Bacteria 15410
58 Ga0068864_100084238 3300005618 Bacteria 2793
59 Ga0068864_100330465 3300005618 Bacteria 1434
60 Ga0068863_100000167 3300005841 Bacteria 70943
61 Ga0068863_100000531 3300005841 Bacteria 38939
62 Ga0068863_100007829 3300005841 Bacteria 10447
63 Ga0068863_100171898 3300005841 Bacteria 2079
64 Ga0068858_100001538 3300005842 Bacteria 23685
65 Ga0068858_100007719 3300005842 Bacteria 10385
66 Ga0068858_100007943 3300005842 Bacteria 10225
67 Ga0068858_100067705 3300005842 Bacteria 3308
68 Ga0068860_100000517 3300005843 Bacteria 47364
69 Ga0068860_100000676 3300005843 Bacteria 39429
70 Ga0068860_100001527 3300005843 Bacteria 24942
71 Ga0068862_100000786 3300005844 Bacteria 31460
72 Ga0068862_100147302 3300005844 Bacteria 2093
73 Ga0068865_100002003 3300006881 Bacteria 12025
74 Ga0097620_100001402 3300006931 Bacteria 24458
75 Ga0097620_100010235 3300006931 Bacteria 9439
76 Ga0105250_10026932 3300009092 Bacteria 2317
77 Ga0105240_10000522 3300009093 Bacteria 70833
78 Ga0105240_10022832 3300009093 Bacteria 8289
79 Ga0105240_10056518 3300009093 Bacteria 4910
80 Ga0105240_10073487 3300009093 Bacteria 4222
81 Ga0105242_10203616 3300009176 Bacteria 1759
82 Ga0105248_10002192 3300009177 Bacteria 21611
83 Ga0105248_10002620 3300009177 Bacteria 20006
84 Ga0105248_10002783 3300009177 Bacteria 19441
85 Ga0105248_10030043 3300009177 Bacteria 6064
86 Ga0105237_10187201 3300009545 Bacteria 2070
87 Ga0105238_10016707 3300009551 Bacteria 7436
88 Ga0105238_10051376 3300009551 Bacteria 4147
89 Ga0105249_10000356 3300009553 Bacteria 45856
90 Ga0105239_10028133 3300010375 Bacteria 6186
91 Ga0105239_10151828 3300010375 Bacteria 2585
92 Ga0157369_10184694 3300013105 Bacteria 2193
93 Ga0157374_10114856 3300013296 Bacteria 2593
94 Ga0163162_10008333 3300013306 Bacteria 10112
95 Ga0163162_10141996 3300013306 Bacteria 2515
96 Ga0157375_10053522 3300013308 Bacteria 3972
97 Ga0163163_10001756 3300014325 Bacteria 18264
98 Ga0157379_10001501 3300014968 Bacteria 19208
99 Ga0157379_10001581 3300014968 Bacteria 18756
100 Ga0157379_10077416 3300014968 Bacteria 2978
101 Ga0163161_10201238 3300017792 Bacteria 1535
102 Ga0213872_10019359 3300021361 Bacteria 3136
103 Ga0209455_1015955 3300025272 Bacteria 1630
104 Ga0209676_1000243 3300025292 Bacteria 117113
105 Ga0209676_1000311 3300025292 Bacteria 95478
106 Ga0209758_1004222 3300025297 Bacteria 12164
107 Ga0209050_1000031 3300025298 Bacteria 458181
108 Ga0209050_1000244 3300025298 Bacteria 117105
109 Ga0209050_1000375 3300025298 Bacteria 84503
110 Ga0209051_1003593 3300025303 Bacteria 10081
111 Ga0209257_1000073 3300025304 Bacteria 325833
112 Ga0209257_1000140 3300025304 Bacteria 201515
113 Ga0209257_1004459 3300025304 Bacteria 10837
114 Ga0207705_10002329 3300025909 Bacteria 14696
115 Ga0207705_10066327 3300025909 Bacteria 2610
116 Ga0207707_10017930 3300025912 Bacteria 6173
117 Ga0207695_10000987 3300025913 Bacteria 50463
118 Ga0207695_10001134 3300025913 Bacteria 46205
119 Ga0207695_10010039 3300025913 Bacteria 11627
120 Ga0207695_10028456 3300025913 Bacteria 6197
121 Ga0207695_10256773 3300025913 Bacteria 1646
122 Ga0207660_10003341 3300025917 Bacteria 10470
123 Ga0207660_10137835 3300025917 Bacteria 1863
124 Ga0207657_10007945 3300025919 Bacteria 10817
125 Ga0207657_10063693 3300025919 Bacteria 3151
126 Ga0207652_10024525 3300025921 Bacteria 5005
127 Ga0207652_10052009 3300025921 Bacteria 3514
128 Ga0207694_10058049 3300025924 Bacteria 3010
129 Ga0207650_10000133 3300025925 Bacteria 90953
130 Ga0207650_10007542 3300025925 Bacteria 7417
131 Ga0207650_10031237 3300025925 Bacteria 3844
132 Ga0207650_10090000 3300025925 Bacteria 2343
133 Ga0207644_10001604 3300025931 Bacteria 14601
134 Ga0207644_10212549 3300025931 Bacteria 1530
135 Ga0207690_10000134 3300025932 Bacteria 60374
136 Ga0207690_10019025 3300025932 Bacteria 4218
137 Ga0207706_10238239 3300025933 Bacteria 1591
138 Ga0207704_10007013 3300025938 Bacteria 5293
139 Ga0207711_10002205 3300025941 Bacteria 17482
140 Ga0207711_10005329 3300025941 Bacteria 10907
141 Ga0207711_10005736 3300025941 Bacteria 10478
142 Ga0207711_10107588 3300025941 Bacteria 2476
143 Ga0207667_10016558 3300025949 Bacteria 8326
144 Ga0207667_10033643 3300025949 Bacteria 5510
145 Ga0207651_10183487 3300025960 Bacteria 1662
146 Ga0207712_10000790 3300025961 Bacteria 23489
147 Ga0207668_10000016 3300025972 Bacteria 159703
148 Ga0207668_10000718 3300025972 Bacteria 20265
149 Ga0207668_10001104 3300025972 Bacteria 16060
150 Ga0207668_10001138 3300025972 Bacteria 15811
151 Ga0207668_10026609 3300025972 Bacteria 3757
152 Ga0207658_10010762 3300025986 Bacteria 6222
153 Ga0207658_10139608 3300025986 Bacteria 1959
154 Ga0207703_10000189 3300026035 Bacteria 72189
155 Ga0207703_10002235 3300026035 Bacteria 16933
156 Ga0207703_10003556 3300026035 Bacteria 13024
157 Ga0207639_10123624 3300026041 Bacteria 2130
158 Ga0207702_10099548 3300026078 Bacteria 2563
159 Ga0207641_10000120 3300026088 Bacteria 116070
160 Ga0207641_10001611 3300026088 Bacteria 22031
161 Ga0207641_10064462 3300026088 Bacteria 3132
162 Ga0207641_10068726 3300026088 Bacteria 3038
163 Ga0207676_10000109 3300026095 Bacteria 74080
164 Ga0207676_10000424 3300026095 Bacteria 35638
165 Ga0207676_10001962 3300026095 Bacteria 14986
166 Ga0207675_100253915 3300026118 Bacteria 1702
167 Ga0207683_10023287 3300026121 Bacteria 5326
168 Ga0268266_10000005 3300028379 Bacteria 1448194
169 Ga0268266_10002063 3300028379 Bacteria 22264
170 Ga0268266_10008489 3300028379 Bacteria 9130
171 Ga0268265_10004078 3300028380 Bacteria 10263
172 Ga0268265_10012834 3300028380 Bacteria 5689
173 Ga0268265_10020628 3300028380 Bacteria 4602
174 Ga0268264_10000364 3300028381 Bacteria 67218
175 Ga0268264_10000416 3300028381 Bacteria 60203
176 Ga0268264_10015244 3300028381 Bacteria 6305
177 Ga0268264_10168789 3300028381 Bacteria 1977
178 Ga0265319_1043278 3300028563 Bacteria 1513
179 Ga0307517_10003720 3300028786 Bacteria 23706
180 Ga0307517_10106485 3300028786 Bacteria 2168
181 Ga0265338_10011798 3300028800 Bacteria 10044
182 Ga0265338_10206428 3300028800 Bacteria 1478
183 Ga0265324_10023464 3300029957 Bacteria 2198
184 Ga0307511_10007943 3300030521 Bacteria 10645
185 Ga0265327_10000933 3300031251 Bacteria 42834
186 Ga0307513_10004304 3300031456 Bacteria 19024
187 Ga0307513_10018679 3300031456 Bacteria 8279
188 Ga0307513_10021039 3300031456 Bacteria 7710
189 Ga0307513_10053499 3300031456 Bacteria 4338
190 Ga0265314_10007232 3300031711 Bacteria 9651
191 Ga0307516_10000004 3300031730 Bacteria 367451
192 Ga0307411_10028831 3300032005 Bacteria 3381
193 Ga0307510_10025344 3300033180 Bacteria 6840
194 Ga0307510_10116755 3300033180 Bacteria 2389
195 Ga0373936_0026641 3300035113 Bacteria 2264
196 Ga0373936_0052265 3300035113 Bacteria 1655
197 Ga0395899_0016645 3300037312 Bacteria 5607
198 Ga0395900_0000010 3300037418 Bacteria 461364
199 Ga0395900_0011862 3300037418 Bacteria 8913
200 Ga0395900_0110483 3300037418 Bacteria 2824
201 Ga0395898_0034425 3300037466 Bacteria 5048
202 Ga0395898_0104266 3300037466 Bacteria 2720
203 Ga0395898_0123153 3300037466 Bacteria 2484
204 Ga0395905_0001301 3300037471 Bacteria 30685
205 Ga0395905_0011759 3300037471 Bacteria 8449
206 Ga0395905_0032087 3300037471 Bacteria 4941
207 Ga0395905_0038566 3300037471 Bacteria 4484
208 Ga0395905_0090266 3300037471 Bacteria 2872
209 Ga0395901_0000007 3300038443 Bacteria 497408
210 Ga0436361_0129444 3300039447 Bacteria 9167
211 Ga0436362_1202214 3300039453 Bacteria 1172
212 Ga0466965_0051740 3300044683 Bacteria 2038
213 Ga0495629_0024130 3300046459 Bacteria 4331
214 Ga0495583_0040372 3300046506 Bacteria 2193
215 Ga0495620_0012492 3300046515 Bacteria 4382
216 Ga0495628_0183283 3300046516 Bacteria 1583
217 Ga0495597_0013917 3300046542 Bacteria 3845
218 Ga0495622_0003148 3300046557 Bacteria 7810
219 Ga0495668_0000456 3300046616 Bacteria 52300
220 Ga0495668_0036016 3300046616 Bacteria 2774
221 Ga0495611_0027813 3300046648 Bacteria 2475
222 Ga0495669_0000001 3300046684 Bacteria 291866
223 Ga0495669_0000172 3300046684 Bacteria 40888
224 Ga0495613_0000830 3300046689 Bacteria 23881
225 Ga0495672_0053772 3300047320 Bacteria 2357
226 Ga0495687_056070 3300047443 Bacteria 1645
227 Ga0495686_0034167 3300047472 Bacteria 3277
228 Ga0496101_0197360 3300048904 Bacteria 1555
229 Ga0496102_0020954 3300048905 Bacteria 5781
230 Ga0496108_0053086 3300048911 Bacteria 3398
231 Ga0496112_0054241 3300048915 Bacteria 3938
232 Ga0496112_0453417 3300048915 Bacteria 1220
233 Ga0496115_0001599 3300048918 Bacteria 16277
234 Ga0496115_0072475 3300048918 Bacteria 2795
235 Ga0496115_0100160 3300048918 Bacteria 2375
236 Ga0496117_0023789 3300048920 Bacteria 4867
237 Ga0496118_0009194 3300048921 Bacteria 10034
238 Ga0496119_0011383 3300048922 Bacteria 7375
239 Ga0496121_0001187 3300048924 Bacteria 45612
240 Ga0496125_0025772 3300048928 Bacteria 5377
241 Ga0496126_0018224 3300048929 Bacteria 6967
242 Ga0501033_0005132 3300049570 Bacteria 10415
243 Ga0501033_0006219 3300049570 Bacteria 9359
244 Ga0501034_0024267 3300049571 Bacteria 6167
245 Ga0501047_0018544 3300049581 Bacteria 6674
246 Ga0501257_001923 3300049686 Bacteria 4325
247 Ga0501035_0024753 3300049822 Bacteria 5503
248 Ga0501044_0004038 3300049823 Bacteria 16462
249 Ga0501044_0006448 3300049823 Bacteria 12959
250 nmdc:mga07m45_2532_c1 3300050496 Bacteria 8580
251 nmdc:mga0sz30_27055_c1 3300050516 Bacteria 2354
252 Ga0500635_0000082 3300053080 Bacteria 62117
253 Ga0500643_000236 3300053087 Bacteria 51341
254 Ga0500643_011155 3300053087 Bacteria 3296
255 Ga0500643_016575 3300053087 Bacteria 2492
256 Ga0500647_0040389 3300053091 Bacteria 2238
257 Ga0500651_0092340 3300053093 Bacteria 1862
258 Ga0500641_0007930 3300053096 Bacteria 3786
259 Ga0500641_0036302 3300053096 Bacteria 1971
260 Ga0500650_0096900 3300053098 Bacteria 1381
261 Ga0500556_0001246 3300053104 Bacteria 11763
262 Ga0500562_000623 3300053108 Bacteria 8548
263 Ga0500562_001952 3300053108 Bacteria 5170
264 Ga0500562_007712 3300053108 Bacteria 2714
265 Ga0500569_001997 3300053109 Bacteria 3957
266 Ga0500572_000293 3300053111 Bacteria 17881
267 Ga0500594_0030130 3300053118 Bacteria 1423
268 Ga0500595_007326 3300053119 Bacteria 4580
269 Ga0500608_000207 3300053122 Bacteria 23415
270 Ga0500608_008295 3300053122 Bacteria 4358
271 Ga0500614_003945 3300053123 Bacteria 3167
272 Ga0500652_052442 3300053131 Bacteria 1668
273 Ga0500559_0000002 3300053136 Bacteria 262002
274 Ga0500559_0003257 3300053136 Bacteria 8060
275 Ga0500559_0052684 3300053136 Bacteria 1799
276 Ga0500616_0006850 3300053153 Bacteria 7365
277 Ga0500616_0022720 3300053153 Bacteria 3499
278 Ga0500616_0061669 3300053153 Bacteria 1940
279 Ga0500620_020946 3300053155 Bacteria 1947
280 Ga0500622_0014917 3300053156 Bacteria 4165
281 Ga0500622_0014955 3300053156 Bacteria 4160
282 Ga0500622_0040386 3300053156 Bacteria 2430
283 Ga0500636_0009256 3300053177 Bacteria 5725
284 Ga0500636_0024604 3300053177 Bacteria 3561
285 Ga0500637_0041569 3300053178 Bacteria 2598
286 Ga0500625_028541 3300053729 Bacteria 2648
287 Ga0500645_000790 3300053730 Bacteria 19008
288 Ga0500645_001349 3300053730 Bacteria 12693
289 Ga0500596_000259 3300053735 Bacteria 9297

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100002030 Ga0070668_10000203011 296
2 3300005355 Ga0070671_100000153 Ga0070671_10000015327 296
3 3300005617 Ga0068859_100001402 Ga0068859_10000140223 296
4 3300005842 Ga0068858_100001538 Ga0068858_10000153818 296
5 3300006931 Ga0097620_100001402 Ga0097620_1000014022 296
6 3300025925 Ga0207650_10007542 Ga0207650_100075424 296
7 3300025941 Ga0207711_10005736 Ga0207711_1000573611 296
8 3300025972 Ga0207668_10001138 Ga0207668_1000113813 296
9 3300026035 Ga0207703_10003556 Ga0207703_1000355615 296
10 3300046542 Ga0495597_0013917 Ga0495597_0013917_273_1310 317
11 3300047443 Ga0495687_056070 Ga0495687_056070_443_1480 317
12 3300053123 Ga0500614_003945 Ga0500614_003945_631_1668 317
13 3300053735 Ga0500596_000259 Ga0500596_000259_5108_6145 317
14 3300050496 nmdc:mga07m45_2532_c1 nmdc:mga07m45_2532_c1_6182_7303 324
15 3300047320 Ga0495672_0053772 Ga0495672_0053772_16_1095 328
16 3300053177 Ga0500636_0024604 Ga0500636_0024604_1726_2844 329
17 3300005347 Ga0070668_100016378 Ga0070668_1000163785 331
18 3300028800 Ga0265338_10206428 Ga0265338_102064281 331
19 3300029957 Ga0265324_10023464 Ga0265324_100234642 331
20 3300031711 Ga0265314_10007232 Ga0265314_100072326 331
21 3300005331 Ga0070670_100036704 Ga0070670_1000367045 332
22 3300005347 Ga0070668_100001998 Ga0070668_1000019984 332
23 3300005548 Ga0070665_100132084 Ga0070665_1001320842 332
24 3300005617 Ga0068859_100010234 Ga0068859_1000102344 332
25 3300005618 Ga0068864_100330465 Ga0068864_1003304652 332
26 3300005843 Ga0068860_100000517 Ga0068860_10000051741 332
27 3300005843 Ga0068860_100001527 Ga0068860_10000152720 332
28 3300005844 Ga0068862_100147302 Ga0068862_1001473022 332
29 3300006931 Ga0097620_100010235 Ga0097620_1000102354 332
30 3300025925 Ga0207650_10090000 Ga0207650_100900002 332
31 3300025972 Ga0207668_10001104 Ga0207668_1000110411 332
32 3300025972 Ga0207668_10026609 Ga0207668_100266095 332
33 3300025986 Ga0207658_10139608 Ga0207658_101396081 332
34 3300028380 Ga0268265_10004078 Ga0268265_100040782 332
35 3300028380 Ga0268265_10020628 Ga0268265_100206285 332
36 3300028381 Ga0268264_10000416 Ga0268264_1000041629 332
37 3300028381 Ga0268264_10015244 Ga0268264_100152447 332
38 3300037466 Ga0395898_0123153 Ga0395898_0123153_23_1099 332
39 3300049686 Ga0501257_001923 Ga0501257_001923_1310_2425 332
40 3300031456 Ga0307513_10021039 Ga0307513_100210398 333
41 3300046689 Ga0495613_0000830 Ga0495613_0000830_11879_12988 334
42 3300053108 Ga0500562_007712 Ga0500562_007712_816_1925 334
43 3300048928 Ga0496125_0025772 Ga0496125_0025772_1768_2871 336
44 3300005334 Ga0068869_100300359 Ga0068869_1003003592 337
45 3300037418 Ga0395900_0110483 Ga0395900_0110483_252_1361 337
46 3300037466 Ga0395898_0104266 Ga0395898_0104266_1207_2316 337
47 3300037471 Ga0395905_0038566 Ga0395905_0038566_2123_3232 337
48 3300003781 Ga0055536_1000604 Ga0055536_100060419 338
49 3300003791 Ga0055530_10000899 Ga0055530_1000089919 338
50 3300003792 Ga0055540_1022513 Ga0055540_10225132 338
51 3300025292 Ga0209676_1000311 Ga0209676_100031119 338
52 3300025298 Ga0209050_1000375 Ga0209050_100037519 338
53 3300025303 Ga0209051_1003593 Ga0209051_10035933 338
54 3300025304 Ga0209257_1004459 Ga0209257_10044599 338
55 3300046616 Ga0495668_0036016 Ga0495668_0036016_413_1540 339
56 3300046684 Ga0495669_0000001 Ga0495669_0000001_47244_48356 339
57 3300003781 Ga0055536_1000595 Ga0055536_100059520 340
58 3300003791 Ga0055530_10002781 Ga0055530_1000278110 340
59 3300003794 Ga0055531_10000847 Ga0055531_1000084720 340
60 3300025292 Ga0209676_1000243 Ga0209676_100024368 340
61 3300025298 Ga0209050_1000244 Ga0209050_100024468 340
62 3300025304 Ga0209257_1000140 Ga0209257_100014056 340
63 3300053156 Ga0500622_0014955 Ga0500622_0014955_2139_3299 340
64 3300005456 Ga0070678_100134493 Ga0070678_1001344932 341
65 3300005457 Ga0070662_100204643 Ga0070662_1002046431 341
66 3300005618 Ga0068864_100001967 Ga0068864_1000019679 341
67 3300005841 Ga0068863_100007829 Ga0068863_10000782910 341
68 3300005842 Ga0068858_100067705 Ga0068858_1000677054 341
69 3300025933 Ga0207706_10238239 Ga0207706_102382391 341
70 3300025941 Ga0207711_10107588 Ga0207711_101075882 341
71 3300025960 Ga0207651_10183487 Ga0207651_101834872 341
72 3300026088 Ga0207641_10068726 Ga0207641_100687262 341
73 3300026095 Ga0207676_10001962 Ga0207676_1000196218 341
74 3300026121 Ga0207683_10023287 Ga0207683_100232876 341
75 3300028786 Ga0307517_10106485 Ga0307517_101064852 341
76 3300048905 Ga0496102_0020954 Ga0496102_0020954_3575_4678 341
77 3300048911 Ga0496108_0053086 Ga0496108_0053086_2139_3242 341
78 3300048915 Ga0496112_0453417 Ga0496112_0453417_98_1201 341
79 iso_pu_bacteria 2585428106 2587918024 341
80 iso_pu_bacteria 2643221598 2644002238 341
81 iso_pu_bacteria 2643221614 2644085599 341
82 iso_pu_bacteria 2643221640 2644224558 341
83 iso_pu_bacteria 2643221642 2644234507 341
84 iso_pu_bacteria 2643221661 2644343150 341
85 iso_pu_bacteria 2643221666 2644366450 341
86 iso_pu_bacteria 2857504554 2857504818 341
87 iso_pu_bacteria 2884960567 2884965365 341
88 iso_pu_bacteria 2928531327 2928532865 341
89 3300005347 Ga0070668_100004043 Ga0070668_1000040433 343
90 3300005367 Ga0070667_100015159 Ga0070667_1000151596 343
91 3300005548 Ga0070665_100000867 Ga0070665_10000086728 343
92 3300025972 Ga0207668_10000016 Ga0207668_10000016153 343
93 3300028379 Ga0268266_10008489 Ga0268266_100084896 343
94 3300049570 Ga0501033_0006219 Ga0501033_0006219_583_1692 343
95 3300049823 Ga0501044_0006448 Ga0501044_0006448_4207_5316 343
96 3300053087 Ga0500643_016575 Ga0500643_016575_443_1555 343
97 3300053131 Ga0500652_052442 Ga0500652_052442_17_1225 343
98 3300046684 Ga0495669_0000172 Ga0495669_0000172_9435_10547 344
99 3300053153 Ga0500616_0061669 Ga0500616_0061669_377_1489 344
100 3300005331 Ga0070670_100000050 Ga0070670_100000050109 345
101 3300005331 Ga0070670_100007260 Ga0070670_1000072604 345
102 3300005331 Ga0070670_100022919 Ga0070670_1000229195 345
103 3300005335 Ga0070666_10020342 Ga0070666_100203424 345
104 3300005335 Ga0070666_10158598 Ga0070666_101585982 345
105 3300005347 Ga0070668_100001877 Ga0070668_10000187712 345
106 3300005367 Ga0070667_100000299 Ga0070667_10000029932 345
107 3300005548 Ga0070665_100001434 Ga0070665_10000143418 345
108 3300005548 Ga0070665_100012517 Ga0070665_1000125179 345
109 3300005618 Ga0068864_100000238 Ga0068864_10000023826 345
110 3300005618 Ga0068864_100002426 Ga0068864_10000242618 345
111 3300005618 Ga0068864_100084238 Ga0068864_1000842384 345
112 3300005841 Ga0068863_100000167 Ga0068863_10000016711 345
113 3300005841 Ga0068863_100000531 Ga0068863_1000005315 345
114 3300005841 Ga0068863_100171898 Ga0068863_1001718982 345
115 3300005842 Ga0068858_100007719 Ga0068858_1000077192 345
116 3300005842 Ga0068858_100007943 Ga0068858_1000079433 345
117 3300005843 Ga0068860_100000676 Ga0068860_10000067632 345
118 3300005844 Ga0068862_100000786 Ga0068862_1000007869 345
119 3300009092 Ga0105250_10026932 Ga0105250_100269323 345
120 3300009177 Ga0105248_10002620 Ga0105248_1000262020 345
121 3300009177 Ga0105248_10002783 Ga0105248_1000278321 345
122 3300009177 Ga0105248_10030043 Ga0105248_100300432 345
123 3300009553 Ga0105249_10000356 Ga0105249_1000035622 345
124 3300010375 Ga0105239_10028133 Ga0105239_100281333 345
125 3300013306 Ga0163162_10008333 Ga0163162_1000833310 345
126 3300014325 Ga0163163_10001756 Ga0163163_1000175621 345
127 3300014968 Ga0157379_10001501 Ga0157379_1000150113 345
128 3300014968 Ga0157379_10001581 Ga0157379_1000158121 345
129 3300014968 Ga0157379_10077416 Ga0157379_100774161 345
130 3300017792 Ga0163161_10201238 Ga0163161_102012381 345
131 3300021361 Ga0213872_10019359 Ga0213872_100193593 345
132 3300025925 Ga0207650_10000133 Ga0207650_1000013366 345
133 3300025925 Ga0207650_10031237 Ga0207650_100312373 345
134 3300025931 Ga0207644_10001604 Ga0207644_100016046 345
135 3300025941 Ga0207711_10002205 Ga0207711_100022052 345
136 3300025961 Ga0207712_10000790 Ga0207712_100007904 345
137 3300025972 Ga0207668_10000718 Ga0207668_100007185 345
138 3300025986 Ga0207658_10010762 Ga0207658_100107625 345
139 3300026035 Ga0207703_10000189 Ga0207703_100001898 345
140 3300026035 Ga0207703_10002235 Ga0207703_100022353 345
141 3300026088 Ga0207641_10000120 Ga0207641_1000012094 345
142 3300026088 Ga0207641_10001611 Ga0207641_100016111 345
143 3300026088 Ga0207641_10064462 Ga0207641_100644623 345
144 3300026095 Ga0207676_10000109 Ga0207676_1000010926 345
145 3300026095 Ga0207676_10000424 Ga0207676_100004248 345
146 3300026118 Ga0207675_100253915 Ga0207675_1002539151 345
147 3300028379 Ga0268266_10002063 Ga0268266_1000206316 345
148 3300028380 Ga0268265_10012834 Ga0268265_100128347 345
149 3300028381 Ga0268264_10000364 Ga0268264_1000036427 345
150 3300028381 Ga0268264_10168789 Ga0268264_101687893 345
151 3300028563 Ga0265319_1043278 Ga0265319_10432782 345
152 3300028786 Ga0307517_10003720 Ga0307517_1000372017 345
153 3300028800 Ga0265338_10011798 Ga0265338_100117984 345
154 3300031251 Ga0265327_10000933 Ga0265327_1000093324 345
155 3300031456 Ga0307513_10004304 Ga0307513_100043046 345
156 3300031456 Ga0307513_10053499 Ga0307513_100534994 345
157 3300031730 Ga0307516_10000004 Ga0307516_10000004146 345
158 3300032005 Ga0307411_10028831 Ga0307411_100288315 345
159 3300033180 Ga0307510_10025344 Ga0307510_100253448 345
160 3300033180 Ga0307510_10116755 Ga0307510_101167552 345
161 3300039447 Ga0436361_0129444 Ga0436361_0129444_2719_3834 345
162 3300039453 Ga0436362_1202214 Ga0436362_1202214_46_1161 345
163 3300044683 Ga0466965_0051740 Ga0466965_0051740_351_1466 345
164 3300046459 Ga0495629_0024130 Ga0495629_0024130_1514_2635 345
165 3300046515 Ga0495620_0012492 Ga0495620_0012492_1663_2784 345
166 3300046557 Ga0495622_0003148 Ga0495622_0003148_1500_2621 345
167 3300046616 Ga0495668_0000456 Ga0495668_0000456_28505_29620 345
168 3300047472 Ga0495686_0034167 Ga0495686_0034167_1620_2735 345
169 3300048904 Ga0496101_0197360 Ga0496101_0197360_337_1455 345
170 3300048918 Ga0496115_0100160 Ga0496115_0100160_1049_2164 345
171 3300048920 Ga0496117_0023789 Ga0496117_0023789_2784_3905 345
172 3300048921 Ga0496118_0009194 Ga0496118_0009194_1527_2648 345
173 3300048922 Ga0496119_0011383 Ga0496119_0011383_747_1868 345
174 3300048924 Ga0496121_0001187 Ga0496121_0001187_4547_5668 345
175 3300048929 Ga0496126_0018224 Ga0496126_0018224_1908_3023 345
176 3300049570 Ga0501033_0005132 Ga0501033_0005132_6219_7334 345
177 3300049581 Ga0501047_0018544 Ga0501047_0018544_5421_6536 345
178 3300049822 Ga0501035_0024753 Ga0501035_0024753_1990_3105 345
179 3300049823 Ga0501044_0004038 Ga0501044_0004038_13215_14330 345
180 3300050516 nmdc:mga0sz30_27055_c1 nmdc:mga0sz30_27055_c1_1204_2319 345
181 3300053080 Ga0500635_0000082 Ga0500635_0000082_5968_7089 345
182 3300053087 Ga0500643_000236 Ga0500643_000236_30237_31352 345
183 3300053087 Ga0500643_011155 Ga0500643_011155_829_1944 345
184 3300053091 Ga0500647_0040389 Ga0500647_0040389_794_1915 345
185 3300053093 Ga0500651_0092340 Ga0500651_0092340_346_1467 345
186 3300053096 Ga0500641_0007930 Ga0500641_0007930_2379_3494 345
187 3300053098 Ga0500650_0096900 Ga0500650_0096900_211_1326 345
188 3300053104 Ga0500556_0001246 Ga0500556_0001246_1687_2802 345
189 3300053108 Ga0500562_001952 Ga0500562_001952_1691_2806 345
190 3300053109 Ga0500569_001997 Ga0500569_001997_2403_3524 345
191 3300053111 Ga0500572_000293 Ga0500572_000293_12628_13845 345
192 3300053119 Ga0500595_007326 Ga0500595_007326_3140_4261 345
193 3300053122 Ga0500608_000207 Ga0500608_000207_12868_13983 345
194 3300053122 Ga0500608_008295 Ga0500608_008295_565_1686 345
195 3300053136 Ga0500559_0000002 Ga0500559_0000002_211943_213061 345
196 3300053136 Ga0500559_0003257 Ga0500559_0003257_1955_3070 345
197 3300053136 Ga0500559_0052684 Ga0500559_0052684_393_1514 345
198 3300053153 Ga0500616_0006850 Ga0500616_0006850_2442_3557 345
199 3300053153 Ga0500616_0022720 Ga0500616_0022720_1394_2509 345
200 3300053155 Ga0500620_020946 Ga0500620_020946_316_1437 345
201 3300053156 Ga0500622_0014917 Ga0500622_0014917_665_1780 345
202 3300053156 Ga0500622_0040386 Ga0500622_0040386_779_1894 345
203 3300053177 Ga0500636_0009256 Ga0500636_0009256_2108_3229 345
204 3300053178 Ga0500637_0041569 Ga0500637_0041569_874_1995 345
205 3300053729 Ga0500625_028541 Ga0500625_028541_1040_2161 345
206 3300053730 Ga0500645_000790 Ga0500645_000790_13100_14215 345
207 3300053730 Ga0500645_001349 Ga0500645_001349_2284_3399 345
208 3300009545 Ga0105237_10187201 Ga0105237_101872012 347
209 3300009551 Ga0105238_10016707 Ga0105238_100167074 347
210 3300049571 Ga0501034_0024267 Ga0501034_0024267_2174_3340 347
211 3300005335 Ga0070666_10097222 Ga0070666_100972222 348
212 3300003215 JGI25153J46596_10022632 JGI25153J46596_100226322 349
213 3300003791 Ga0055530_10000188 Ga0055530_1000018825 349
214 3300003794 Ga0055531_10008205 Ga0055531_100082053 349
215 3300005262 Ga0065165_1000029 Ga0065165_1000029118 349
216 3300005327 Ga0070658_10036302 Ga0070658_100363024 349
217 3300005327 Ga0070658_10065613 Ga0070658_100656134 349
218 3300005336 Ga0070680_100005561 Ga0070680_1000055613 349
219 3300005339 Ga0070660_100059437 Ga0070660_1000594374 349
220 3300005341 Ga0070691_10004623 Ga0070691_100046233 349
221 3300005366 Ga0070659_100000040 Ga0070659_10000004089 349
222 3300005366 Ga0070659_100008635 Ga0070659_1000086355 349
223 3300005458 Ga0070681_10015006 Ga0070681_100150068 349
224 3300005458 Ga0070681_10030623 Ga0070681_100306234 349
225 3300005458 Ga0070681_10097961 Ga0070681_100979613 349
226 3300005530 Ga0070679_100162908 Ga0070679_1001629082 349
227 3300005530 Ga0070679_100245500 Ga0070679_1002455002 349
228 3300005539 Ga0068853_100066223 Ga0068853_1000662231 349
229 3300005548 Ga0070665_100000248 Ga0070665_10000024867 349
230 3300005548 Ga0070665_100020273 Ga0070665_1000202735 349
231 3300005563 Ga0068855_100011064 Ga0068855_1000110647 349
232 3300005563 Ga0068855_100035175 Ga0068855_1000351753 349
233 3300005563 Ga0068855_100053362 Ga0068855_1000533623 349
234 3300005614 Ga0068856_100135583 Ga0068856_1001355833 349
235 3300005616 Ga0068852_100013708 Ga0068852_1000137085 349
236 3300006881 Ga0068865_100002003 Ga0068865_1000020036 349
237 3300009093 Ga0105240_10000522 Ga0105240_1000052214 349
238 3300009093 Ga0105240_10022832 Ga0105240_100228326 349
239 3300009093 Ga0105240_10056518 Ga0105240_100565184 349
240 3300009093 Ga0105240_10073487 Ga0105240_100734873 349
241 3300009176 Ga0105242_10203616 Ga0105242_102036161 349
242 3300009177 Ga0105248_10002192 Ga0105248_1000219211 349
243 3300009551 Ga0105238_10051376 Ga0105238_100513763 349
244 3300010375 Ga0105239_10151828 Ga0105239_101518282 349
245 3300013105 Ga0157369_10184694 Ga0157369_101846942 349
246 3300013296 Ga0157374_10114856 Ga0157374_101148562 349
247 3300013306 Ga0163162_10141996 Ga0163162_101419963 349
248 3300013308 Ga0157375_10053522 Ga0157375_100535223 349
249 3300025272 Ga0209455_1015955 Ga0209455_10159551 349
250 3300025297 Ga0209758_1004222 Ga0209758_100422212 349
251 3300025298 Ga0209050_1000031 Ga0209050_1000031281 349
252 3300025304 Ga0209257_1000073 Ga0209257_100007399 349
253 3300025909 Ga0207705_10002329 Ga0207705_100023299 349
254 3300025909 Ga0207705_10066327 Ga0207705_100663273 349
255 3300025912 Ga0207707_10017930 Ga0207707_100179302 349
256 3300025913 Ga0207695_10000987 Ga0207695_100009874 349
257 3300025913 Ga0207695_10001134 Ga0207695_1000113414 349
258 3300025913 Ga0207695_10010039 Ga0207695_100100395 349
259 3300025913 Ga0207695_10028456 Ga0207695_100284563 349
260 3300025913 Ga0207695_10256773 Ga0207695_102567731 349
261 3300025917 Ga0207660_10003341 Ga0207660_100033413 349
262 3300025917 Ga0207660_10137835 Ga0207660_101378352 349
263 3300025919 Ga0207657_10007945 Ga0207657_100079457 349
264 3300025919 Ga0207657_10063693 Ga0207657_100636934 349
265 3300025921 Ga0207652_10024525 Ga0207652_100245255 349
266 3300025921 Ga0207652_10052009 Ga0207652_100520094 349
267 3300025924 Ga0207694_10058049 Ga0207694_100580493 349
268 3300025931 Ga0207644_10212549 Ga0207644_102125492 349
269 3300025932 Ga0207690_10000134 Ga0207690_1000013414 349
270 3300025932 Ga0207690_10019025 Ga0207690_100190253 349
271 3300025938 Ga0207704_10007013 Ga0207704_100070132 349
272 3300025941 Ga0207711_10005329 Ga0207711_1000532912 349
273 3300025949 Ga0207667_10016558 Ga0207667_100165587 349
274 3300025949 Ga0207667_10033643 Ga0207667_100336433 349
275 3300026041 Ga0207639_10123624 Ga0207639_101236242 349
276 3300026078 Ga0207702_10099548 Ga0207702_100995483 349
277 3300028379 Ga0268266_10000005 Ga0268266_100000051139 349
278 3300030521 Ga0307511_10007943 Ga0307511_100079434 349
279 3300031456 Ga0307513_10018679 Ga0307513_100186799 349
280 3300035113 Ga0373936_0026641 Ga0373936_0026641_386_1513 349
281 3300035113 Ga0373936_0052265 Ga0373936_0052265_61_1188 349
282 3300037312 Ga0395899_0016645 Ga0395899_0016645_4207_5334 349
283 3300037418 Ga0395900_0000010 Ga0395900_0000010_356232_357359 349
284 3300037418 Ga0395900_0011862 Ga0395900_0011862_6935_8065 349
285 3300037466 Ga0395898_0034425 Ga0395898_0034425_3648_4775 349
286 3300037471 Ga0395905_0001301 Ga0395905_0001301_28961_30088 349
287 3300037471 Ga0395905_0011759 Ga0395905_0011759_4643_5770 349
288 3300037471 Ga0395905_0032087 Ga0395905_0032087_3464_4591 349
289 3300037471 Ga0395905_0090266 Ga0395905_0090266_224_1354 349
290 3300038443 Ga0395901_0000007 Ga0395901_0000007_440596_441723 349
291 3300046506 Ga0495583_0040372 Ga0495583_0040372_860_1987 349
292 3300046516 Ga0495628_0183283 Ga0495628_0183283_96_1223 349
293 3300046648 Ga0495611_0027813 Ga0495611_0027813_164_1291 349
294 3300048915 Ga0496112_0054241 Ga0496112_0054241_1844_2977 349
295 3300048918 Ga0496115_0001599 Ga0496115_0001599_2497_3624 349
296 3300048918 Ga0496115_0072475 Ga0496115_0072475_101_1228 349
297 3300053096 Ga0500641_0036302 Ga0500641_0036302_294_1424 349
298 3300053108 Ga0500562_000623 Ga0500562_000623_1209_2339 349
299 3300053118 Ga0500594_0030130 Ga0500594_0030130_64_1236 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

229

379

0.98

PF02405

MlaE

Permease MlaE

188

233

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.773 125 342
7ch8-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd with adp-v 0.7662 111 343
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.7504 109 343
7ch9-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd 0.7375 111 343
7d0a-assembly1.cif.gz_D acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation 0.728 109 343
ID Description Score Start End Superfamily
1t6rA00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7137 5 94 3.30.750.24
af_P71568_9_126_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.6869 3 94 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.6801 3 91 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.6731 5 88 3.30.750.24
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.672 8 80 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2N1WY46-F1-model_v4 deleted 0.8275 209 349
AF-A0A2N1WY46-F1-model_v4 deleted 0.8173 209 349
AF-A0A0R2X768-F1-model_v4 ABC transporter permease 0.8126 132 346 GO:0005548
GO:0043190
AF-A0A2V6A8Q9-F1-model_v4 ABC transporter permease 0.8114 126 340 GO:0005548
GO:0043190
AF-A0A3M2F3X5-F1-model_v4 ABC transporter permease 0.8032 112 347 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
76.16 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map