F394907

General Info

Members Datasets Scaffolds Average Seq Length
299 211 598 131

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10183508|Ga0307412_101835082
Length 143
Sequence MALKRDEKRTTGVITDPIGDFLTRIRNGLGARHGEVRIPHSRLKVRLAEILIKEGFLEDVDVIPDPIQSQIVVKLKYTPGREPVIKGLKRVSKPGLRVYSGRGDLPRVQGGLGVAIVSTSKGVMTDKEARRHKVGGEVLCEVW

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
164 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
165 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.28
Metatranscriptomes 15.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.02
Rhizosphere 90.97
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10183508 3300031911 Bacteria 1576
2 JGI24740J21852_10032375 3300001979 Bacteria 1672
3 rootH1_10176846 3300003316 Bacteria 1040
4 rootH1_10151301 3300003323 Bacteria 2094
5 Ga0058858_1422295 3300004785 Bacteria 861
6 Ga0058859_10010917 3300004798 Bacteria 704
7 Ga0058859_10020347 3300004798 Bacteria 1042
8 Ga0058863_10947996 3300004799 Bacteria 619
9 Ga0058863_11678218 3300004799 Bacteria 2053
10 Ga0058861_10081153 3300004800 Bacteria 10561
11 Ga0058860_10027907 3300004801 Bacteria 2027
12 Ga0058862_10176130 3300004803 Bacteria 9071
13 Ga0058862_12388517 3300004803 Bacteria 927
14 Ga0058862_12698388 3300004803 Bacteria 1963
15 Ga0058862_12774201 3300004803 Bacteria 4362
16 Ga0070676_10680250 3300005328 Bacteria 750
17 Ga0070690_100388481 3300005330 Bacteria 1022
18 Ga0070670_100824185 3300005331 Bacteria 839
19 Ga0068869_100468837 3300005334 Bacteria 1047
20 Ga0070680_100005522 3300005336 Bacteria 9570
21 Ga0070680_100361940 3300005336 Bacteria 1234
22 Ga0070680_101349951 3300005336 Bacteria 617
23 Ga0070682_100258478 3300005337 Bacteria 1259
24 Ga0070682_100918478 3300005337 Bacteria 721
25 Ga0068868_100235512 3300005338 Bacteria 1537
26 Ga0070660_100467062 3300005339 Bacteria 1048
27 Ga0070689_100350777 3300005340 Bacteria 1238
28 Ga0070689_100729373 3300005340 Unclassified 867
29 Ga0070689_100820467 3300005340 Unclassified 819
30 Ga0070691_10204783 3300005341 Bacteria 1038
31 Ga0070691_10744236 3300005341 Bacteria 592
32 Ga0070687_100664419 3300005343 Bacteria 724
33 Ga0070668_100192907 3300005347 Bacteria 1669
34 Ga0070675_100347097 3300005354 Bacteria 1315
35 Ga0070671_100785405 3300005355 Bacteria 829
36 Ga0070659_100378547 3300005366 Bacteria 1192
37 Ga0070667_100546180 3300005367 Bacteria 1065
38 Ga0070713_101345420 3300005436 Bacteria 692
39 Ga0070701_10199932 3300005438 Bacteria 1181
40 Ga0070711_100046997 3300005439 Bacteria 2944
41 Ga0070700_100079746 3300005441 Bacteria 2111
42 Ga0070708_100435463 3300005445 Bacteria 1237
43 Ga0070663_101263777 3300005455 Bacteria 650
44 Ga0070678_101398537 3300005456 Bacteria 653
45 Ga0070678_101709728 3300005456 Bacteria 592
46 Ga0070662_100246778 3300005457 Bacteria 1434
47 Ga0070681_10005386 3300005458 Bacteria 12351
48 Ga0070681_10568999 3300005458 Bacteria 1047
49 Ga0068867_100471153 3300005459 Bacteria 1074
50 Ga0070706_100046673 3300005467 Bacteria 3999
51 Ga0070706_100290494 3300005467 Bacteria 1526
52 Ga0070707_100235630 3300005468 Bacteria 1781
53 Ga0070707_100730083 3300005468 Bacteria 954
54 Ga0070707_102351236 3300005468 Bacteria 500
55 Ga0070698_100172142 3300005471 Bacteria 2106
56 Ga0070679_100009896 3300005530 Bacteria 9022
57 Ga0070679_100814340 3300005530 Bacteria 877
58 Ga0070684_100056547 3300005535 Bacteria 3424
59 Ga0068853_101457908 3300005539 Bacteria 662
60 Ga0070686_100029546 3300005544 Bacteria 3335
61 Ga0070695_100020558 3300005545 Bacteria 4031
62 Ga0070696_101389736 3300005546 Bacteria 598
63 Ga0070704_100860856 3300005549 Archaea 813
64 Ga0068855_100001385 3300005563 Bacteria 30013
65 Ga0070664_100597984 3300005564 Bacteria 1023
66 Ga0068854_100000039 3300005578 Bacteria 94407
67 Ga0068856_100002334 3300005614 Bacteria 19517
68 Ga0070702_100618055 3300005615 Bacteria 815
69 Ga0068852_101873216 3300005616 Bacteria 622
70 Ga0068861_100542247 3300005719 Bacteria 1058
71 Ga0068858_100179469 3300005842 Bacteria 1999
72 Ga0068860_100348374 3300005843 Bacteria 1457
73 Ga0068862_101321539 3300005844 Bacteria 723
74 Ga0081539_10182903 3300005985 Bacteria 982
75 Ga0070716_101542284 3300006173 Bacteria 544
76 Ga0068871_100414550 3300006358 Bacteria 1202
77 Ga0075428_100981574 3300006844 Bacteria 894
78 Ga0075430_100001741 3300006846 Bacteria 17785
79 Ga0075431_100029533 3300006847 Bacteria 5645
80 Ga0075431_101314091 3300006847 Bacteria 684
81 Ga0075433_10038728 3300006852 Bacteria 4119
82 Ga0075433_10958099 3300006852 Unclassified 746
83 Ga0075433_11146575 3300006852 Bacteria 675
84 Ga0075434_101258802 3300006871 Bacteria 751
85 Ga0075429_100009674 3300006880 Bacteria 8360
86 Ga0075429_101032093 3300006880 Bacteria 719
87 Ga0068865_100299314 3300006881 Bacteria 1287
88 Ga0097620_101742160 3300006931 Bacteria 688
89 Ga0105251_10293359 3300009011 Bacteria 736
90 Ga0105250_10315272 3300009092 Bacteria 679
91 Ga0105240_10944173 3300009093 Bacteria 925
92 Ga0111539_10543125 3300009094 Bacteria 1354
93 Ga0105245_10892950 3300009098 Bacteria 930
94 Ga0105247_10522159 3300009101 Bacteria 869
95 Ga0114129_10003653 3300009147 Bacteria 21641
96 Ga0114129_10474694 3300009147 Bacteria 1637
97 Ga0114129_10971377 3300009147 Bacteria 1072
98 Ga0114129_11048834 3300009147 Bacteria 1024
99 Ga0105243_10858060 3300009148 Bacteria 900
100 Ga0105243_11826581 3300009148 Bacteria 639
101 Ga0105242_10528940 3300009176 Bacteria 1126
102 Ga0105248_10742006 3300009177 Bacteria 1108
103 Ga0105248_11040148 3300009177 Bacteria 925
104 Ga0105249_10102572 3300009553 Bacteria 2693
105 Ga0105239_10407598 3300010375 Bacteria 1539
106 Ga0105246_10320866 3300011119 Bacteria 1259
107 Ga0157345_1018324 3300012498 Bacteria 690
108 Ga0157371_10556742 3300013102 Bacteria 850
109 Ga0157369_11264837 3300013105 Bacteria 752
110 Ga0157378_10037124 3300013297 Bacteria 4314
111 Ga0157378_10166155 3300013297 Bacteria 2067
112 Ga0163162_10097255 3300013306 Bacteria 3032
113 Ga0157372_10612544 3300013307 Bacteria 1269
114 Ga0157375_10150736 3300013308 Bacteria 2460
115 Ga0163163_10944002 3300014325 Bacteria 926
116 Ga0157380_11199404 3300014326 Bacteria 802
117 Ga0157377_10031186 3300014745 Bacteria 2895
118 Ga0157379_10891620 3300014968 Bacteria 843
119 Ga0163161_10358043 3300017792 Bacteria 1161
120 Ga0197907_10773738 3300020069 Bacteria 1462
121 Ga0197907_10800216 3300020069 Bacteria 4495
122 Ga0197907_11365827 3300020069 Bacteria 3388
123 Ga0206356_11287527 3300020070 Bacteria 12032
124 Ga0206356_11375738 3300020070 Bacteria 907
125 Ga0206356_11574971 3300020070 Bacteria 10382
126 Ga0206349_1119855 3300020075 Bacteria 8453
127 Ga0206355_1680354 3300020076 Bacteria 4028
128 Ga0206351_10175414 3300020077 Bacteria 7296
129 Ga0206352_11139540 3300020078 Bacteria 4491
130 Ga0206350_10587188 3300020080 Bacteria 9712
131 Ga0206354_10706702 3300020081 Bacteria 530
132 Ga0206354_11636011 3300020081 Bacteria 3050
133 Ga0206353_10434407 3300020082 Bacteria 2683
134 Ga0154015_1602284 3300020610 Bacteria 3657
135 Ga0213873_10000595 3300021358 Bacteria 5889
136 Ga0213872_10004954 3300021361 Bacteria 6924
137 Ga0224712_10000619 3300022467 Bacteria 7246
138 Ga0224712_10067876 3300022467 Bacteria 1440
139 Ga0224712_10081256 3300022467 Bacteria 1338
140 Ga0224712_10170471 3300022467 Bacteria 976
141 Ga0224712_10295151 3300022467 Bacteria 757
142 Ga0207642_10503545 3300025899 Bacteria 742
143 Ga0207688_10443969 3300025901 Bacteria 808
144 Ga0207684_10259688 3300025910 Bacteria 1499
145 Ga0207684_10361190 3300025910 Bacteria 1250
146 Ga0207684_10486316 3300025910 Bacteria 1058
147 Ga0207707_10024016 3300025912 Bacteria 5331
148 Ga0207671_10253580 3300025914 Bacteria 1383
149 Ga0207660_10016445 3300025917 Bacteria 4897
150 Ga0207660_10423809 3300025917 Bacteria 1074
151 Ga0207657_10569201 3300025919 Bacteria 885
152 Ga0207649_10754204 3300025920 Bacteria 757
153 Ga0207652_10061003 3300025921 Bacteria 3255
154 Ga0207652_10661243 3300025921 Bacteria 934
155 Ga0207646_11498821 3300025922 Bacteria 584
156 Ga0207694_11431896 3300025924 Bacteria 584
157 Ga0207650_11085956 3300025925 Bacteria 681
158 Ga0207644_10481949 3300025931 Bacteria 1022
159 Ga0207690_10602538 3300025932 Bacteria 897
160 Ga0207690_10709495 3300025932 Bacteria 827
161 Ga0207706_10100663 3300025933 Bacteria 2542
162 Ga0207709_10933422 3300025935 Bacteria 707
163 Ga0207709_11525450 3300025935 Bacteria 554
164 Ga0207670_10232859 3300025936 Bacteria 1415
165 Ga0207691_10473496 3300025940 Bacteria 1065
166 Ga0207711_11273367 3300025941 Bacteria 677
167 Ga0207689_10220414 3300025942 Bacteria 1567
168 Ga0207661_10393939 3300025944 Bacteria 1255
169 Ga0207661_10583216 3300025944 Bacteria 1026
170 Ga0207679_10158818 3300025945 Bacteria 1849
171 Ga0207667_10002682 3300025949 Bacteria 22012
172 Ga0207712_10717555 3300025961 Bacteria 874
173 Ga0207668_10058291 3300025972 Bacteria 2699
174 Ga0207668_10181397 3300025972 Bacteria 1661
175 Ga0207640_10000024 3300025981 Bacteria 154876
176 Ga0207658_10227130 3300025986 Bacteria 1574
177 Ga0207703_10351944 3300026035 Bacteria 1356
178 Ga0207678_10212259 3300026067 Bacteria 1656
179 Ga0207678_11028662 3300026067 Bacteria 729
180 Ga0207708_10116208 3300026075 Bacteria 2081
181 Ga0207648_10390449 3300026089 Bacteria 1260
182 Ga0207674_11925902 3300026116 Bacteria 557
183 Ga0207675_100068381 3300026118 Bacteria 3320
184 Ga0207683_11278863 3300026121 Bacteria 679
185 Ga0268266_11551472 3300028379 Bacteria 638
186 Ga0268264_10453067 3300028381 Bacteria 1243
187 Ga0268264_11915188 3300028381 Bacteria 602
188 Ga0265336_10036840 3300028666 Bacteria 1505
189 Ga0316579_10121734 3300031691 Unclassified 1254
190 Ga0316577_10075640 3300031733 Bacteria 1880
191 Ga0307413_11179048 3300031824 Bacteria 665
192 Ga0307407_10309927 3300031903 Bacteria 1104
193 Ga0307407_10661219 3300031903 Bacteria 784
194 Ga0307416_100035072 3300032002 Bacteria 3826
195 Ga0307416_100074155 3300032002 Unclassified 2841
196 Ga0307416_102432455 3300032002 Bacteria 623
197 Ga0307416_102495647 3300032002 Bacteria 616
198 Ga0307416_103313955 3300032002 Bacteria 539
199 Ga0307414_11323810 3300032004 Bacteria 669
200 Ga0307415_100149481 3300032126 Bacteria 1796
201 Ga0307415_101821195 3300032126 Unclassified 589
202 Ga0316588_1000021 3300033528 Bacteria 11292
203 Ga0373949_0180082 3300035090 Bacteria 626
204 Ga0373939_0105508 3300035114 Bacteria 974
205 Ga0373960_0180239 3300035121 Bacteria 737
206 Ga0373962_0228559 3300035242 Bacteria 639
207 Ga0373927_0323471 3300035695 Bacteria 1016
208 Ga0400483_168849 3300039062 Bacteria 24271
209 Ga0436363_0875424 3300039450 Bacteria 1816
210 Ga0436363_0876648 3300039450 Bacteria 4097
211 Ga0436362_0014478 3300039453 Bacteria 835
212 Ga0436362_1025650 3300039453 Bacteria 650
213 Ga0439465_0302359 3300041413 Bacteria 599
214 Ga0451797_0262521 3300041453 Bacteria 1066
215 Ga0451795_0005139 3300041456 Bacteria 624
216 Ga0451795_1034946 3300041456 Bacteria 1011
217 Ga0451795_1546141 3300041456 Bacteria 732
218 Ga0451807_0424907 3300041486 Bacteria 1014
219 Ga0451837_0118706 3300041494 Bacteria 3427
220 Ga0451837_0951068 3300041494 Bacteria 768
221 Ga0451855_0750244 3300041511 Bacteria 549
222 Ga0450902_079529 3300042137 Bacteria 575
223 Ga0466972_0002629 3300044658 Bacteria 8898
224 Ga0466965_0004970 3300044683 Bacteria 5954
225 Ga0466968_0002163 3300044735 Bacteria 7173
226 Ga0466960_0002207 3300044901 Bacteria 7269
227 Ga0466959_0424068 3300045049 Bacteria 903
228 Ga0466959_0448133 3300045049 Bacteria 875
229 Ga0466959_0636206 3300045049 Unclassified 717
230 Ga0466958_0202859 3300045836 Bacteria 1262
231 Ga0466958_0421520 3300045836 Bacteria 863
232 Ga0496102_0067414 3300048905 Bacteria 3283
233 Ga0496102_0669662 3300048905 Bacteria 961
234 Ga0496106_0112458 3300048909 Bacteria 2122
235 Ga0496108_0000307 3300048911 Bacteria 42018
236 Ga0496109_0441795 3300048912 Bacteria 1229
237 Ga0496109_0683750 3300048912 Bacteria 963
238 Ga0496110_0040963 3300048913 Bacteria 4039
239 Ga0496110_0105501 3300048913 Bacteria 2528
240 Ga0496110_0775426 3300048913 Bacteria 863
241 Ga0496114_0453689 3300048917 Bacteria 1135
242 Ga0501311_004409 3300049527 Bacteria 1496
243 Ga0501317_003817 3300049533 Bacteria 1530
244 Ga0501317_096106 3300049533 Bacteria 529
245 Ga0501318_010563 3300049534 Bacteria 1027
246 Ga0501318_015067 3300049534 Bacteria 919
247 Ga0501318_042371 3300049534 Bacteria 655
248 Ga0501320_023279 3300049536 Bacteria 731
249 Ga0501321_019472 3300049537 Bacteria 832
250 Ga0501323_039934 3300049539 Bacteria 685
251 Ga0501034_0049192 3300049571 Bacteria 4254
252 Ga0501034_0169228 3300049571 Bacteria 2153
253 Ga0501034_0494747 3300049571 Bacteria 1137
254 Ga0501034_0859883 3300049571 Unclassified 797
255 Ga0501034_1331401 3300049571 Bacteria 594
256 Ga0501040_1164745 3300049576 Bacteria 559
257 Ga0501042_0491552 3300049578 Bacteria 891
258 Ga0501047_0389273 3300049581 Bacteria 1228
259 Ga0501047_0587257 3300049581 Bacteria 936
260 Ga0501047_1092712 3300049581 Unclassified 611
261 Ga0501048_0848910 3300049582 Bacteria 656
262 Ga0501048_1039159 3300049582 Unclassified 589
263 Ga0501068_0583187 3300049584 Bacteria 728
264 Ga0501073_0228306 3300049589 Bacteria 1286
265 Ga0501073_0614950 3300049589 Bacteria 750
266 Ga0501074_0255707 3300049590 Bacteria 1246
267 Ga0501076_0408276 3300049592 Bacteria 1117
268 Ga0501076_1678216 3300049592 Bacteria 521
269 Ga0501202_198067 3300049652 Bacteria 548
270 Ga0501249_149267 3300049679 Unclassified 587
271 Ga0501225_0250371 3300049705 Bacteria 582
272 Ga0501080_0082414 3300049742 Bacteria 2988
273 Ga0501080_0370213 3300049742 Bacteria 1292
274 Ga0501081_1074410 3300049743 Unclassified 609
275 nmdc:mga05p37_1516812_c1 3300050507 Bacteria 666
276 nmdc:mga05p37_50510_c1 3300050507 Bacteria 5115
277 nmdc:mga05p37_635023_c1 3300050507 Bacteria 1199
278 nmdc:mga05p37_790718_c1 3300050507 Bacteria 1039
279 nmdc:mga09592_302628_c1 3300050508 Bacteria 1386
280 nmdc:mga09592_3850_c1 3300050508 Bacteria 12083
281 nmdc:mga0qj67_38452_c1 3300050509 Bacteria 3754
282 nmdc:mga0qj67_5215_c1 3300050509 Bacteria 9486
283 nmdc:mga06r32_1281255_c1 3300050510 Unclassified 677
284 nmdc:mga06r32_1321_c1 3300050510 Bacteria 22359
285 nmdc:mga06r32_960748_c1 3300050510 Bacteria 808
286 nmdc:mga08x19_1174236_c1 3300050514 Unclassified 544
287 nmdc:mga0a205_9011_c1 3300050515 Bacteria 9093
288 Ga0501084_0109312 3300054114 Bacteria 2323
289 Ga0501084_0730327 3300054114 Unclassified 835
290 Ga0587073_0083153 3300059492 Bacteria 799
291 Ga0587082_045726 3300059504 Bacteria 819
292 Ga0587085_000796 3300059506 Bacteria 2596
293 Ga0587085_043525 3300059506 Bacteria 792
294 Ga0587062_000749 3300059639 Bacteria 2480
295 Ga0587068_101028 3300059641 Bacteria 606
296 Ga0501082_1427184 3300060353 Bacteria 604
297 Ga0530510_0005256 3300061734 Bacteria 8939
298 Ga0530510_0381917 3300061734 Bacteria 1060
299 Ga0530510_0998527 3300061734 Bacteria 640
300 Ga0307412_10183508
301 JGI24740J21852_10032375
302 rootH1_10176846
303 rootH1_10151301
304 Ga0058858_1422295
305 Ga0058859_10010917
306 Ga0058859_10020347
307 Ga0058863_10947996
308 Ga0058863_11678218
309 Ga0058861_10081153
310 Ga0058860_10027907
311 Ga0058862_10176130
312 Ga0058862_12388517
313 Ga0058862_12698388
314 Ga0058862_12774201
315 Ga0070676_10680250
316 Ga0070690_100388481
317 Ga0070670_100824185
318 Ga0068869_100468837
319 Ga0070680_100005522
320 Ga0070680_100361940
321 Ga0070680_101349951
322 Ga0070682_100258478
323 Ga0070682_100918478
324 Ga0068868_100235512
325 Ga0070660_100467062
326 Ga0070689_100350777
327 Ga0070689_100729373
328 Ga0070689_100820467
329 Ga0070691_10204783
330 Ga0070691_10744236
331 Ga0070687_100664419
332 Ga0070668_100192907
333 Ga0070675_100347097
334 Ga0070671_100785405
335 Ga0070659_100378547
336 Ga0070667_100546180
337 Ga0070713_101345420
338 Ga0070701_10199932
339 Ga0070711_100046997
340 Ga0070700_100079746
341 Ga0070708_100435463
342 Ga0070663_101263777
343 Ga0070678_101398537
344 Ga0070678_101709728
345 Ga0070662_100246778
346 Ga0070681_10005386
347 Ga0070681_10568999
348 Ga0068867_100471153
349 Ga0070706_100046673
350 Ga0070706_100290494
351 Ga0070707_100235630
352 Ga0070707_100730083
353 Ga0070707_102351236
354 Ga0070698_100172142
355 Ga0070679_100009896
356 Ga0070679_100814340
357 Ga0070684_100056547
358 Ga0068853_101457908
359 Ga0070686_100029546
360 Ga0070695_100020558
361 Ga0070696_101389736
362 Ga0070704_100860856
363 Ga0068855_100001385
364 Ga0070664_100597984
365 Ga0068854_100000039
366 Ga0068856_100002334
367 Ga0070702_100618055
368 Ga0068852_101873216
369 Ga0068861_100542247
370 Ga0068858_100179469
371 Ga0068860_100348374
372 Ga0068862_101321539
373 Ga0081539_10182903
374 Ga0070716_101542284
375 Ga0068871_100414550
376 Ga0075428_100981574
377 Ga0075430_100001741
378 Ga0075431_100029533
379 Ga0075431_101314091
380 Ga0075433_10038728
381 Ga0075433_10958099
382 Ga0075433_11146575
383 Ga0075434_101258802
384 Ga0075429_100009674
385 Ga0075429_101032093
386 Ga0068865_100299314
387 Ga0097620_101742160
388 Ga0105251_10293359
389 Ga0105250_10315272
390 Ga0105240_10944173
391 Ga0111539_10543125
392 Ga0105245_10892950
393 Ga0105247_10522159
394 Ga0114129_10003653
395 Ga0114129_10474694
396 Ga0114129_10971377
397 Ga0114129_11048834
398 Ga0105243_10858060
399 Ga0105243_11826581
400 Ga0105242_10528940
401 Ga0105248_10742006
402 Ga0105248_11040148
403 Ga0105249_10102572
404 Ga0105239_10407598
405 Ga0105246_10320866
406 Ga0157345_1018324
407 Ga0157371_10556742
408 Ga0157369_11264837
409 Ga0157378_10037124
410 Ga0157378_10166155
411 Ga0163162_10097255
412 Ga0157372_10612544
413 Ga0157375_10150736
414 Ga0163163_10944002
415 Ga0157380_11199404
416 Ga0157377_10031186
417 Ga0157379_10891620
418 Ga0163161_10358043
419 Ga0197907_10773738
420 Ga0197907_10800216
421 Ga0197907_11365827
422 Ga0206356_11287527
423 Ga0206356_11375738
424 Ga0206356_11574971
425 Ga0206349_1119855
426 Ga0206355_1680354
427 Ga0206351_10175414
428 Ga0206352_11139540
429 Ga0206350_10587188
430 Ga0206354_10706702
431 Ga0206354_11636011
432 Ga0206353_10434407
433 Ga0154015_1602284
434 Ga0213873_10000595
435 Ga0213872_10004954
436 Ga0224712_10000619
437 Ga0224712_10067876
438 Ga0224712_10081256
439 Ga0224712_10170471
440 Ga0224712_10295151
441 Ga0207642_10503545
442 Ga0207688_10443969
443 Ga0207684_10259688
444 Ga0207684_10361190
445 Ga0207684_10486316
446 Ga0207707_10024016
447 Ga0207671_10253580
448 Ga0207660_10016445
449 Ga0207660_10423809
450 Ga0207657_10569201
451 Ga0207649_10754204
452 Ga0207652_10061003
453 Ga0207652_10661243
454 Ga0207646_11498821
455 Ga0207694_11431896
456 Ga0207650_11085956
457 Ga0207644_10481949
458 Ga0207690_10602538
459 Ga0207690_10709495
460 Ga0207706_10100663
461 Ga0207709_10933422
462 Ga0207709_11525450
463 Ga0207670_10232859
464 Ga0207691_10473496
465 Ga0207711_11273367
466 Ga0207689_10220414
467 Ga0207661_10393939
468 Ga0207661_10583216
469 Ga0207679_10158818
470 Ga0207667_10002682
471 Ga0207712_10717555
472 Ga0207668_10058291
473 Ga0207668_10181397
474 Ga0207640_10000024
475 Ga0207658_10227130
476 Ga0207703_10351944
477 Ga0207678_10212259
478 Ga0207678_11028662
479 Ga0207708_10116208
480 Ga0207648_10390449
481 Ga0207674_11925902
482 Ga0207675_100068381
483 Ga0207683_11278863
484 Ga0268266_11551472
485 Ga0268264_10453067
486 Ga0268264_11915188
487 Ga0265336_10036840
488 Ga0316579_10121734
489 Ga0316577_10075640
490 Ga0307413_11179048
491 Ga0307407_10309927
492 Ga0307407_10661219
493 Ga0307416_100035072
494 Ga0307416_100074155
495 Ga0307416_102432455
496 Ga0307416_102495647
497 Ga0307416_103313955
498 Ga0307414_11323810
499 Ga0307415_100149481
500 Ga0307415_101821195
501 Ga0316588_1000021
502 Ga0373949_0180082
503 Ga0373939_0105508
504 Ga0373960_0180239
505 Ga0373962_0228559
506 Ga0373927_0323471
507 Ga0400483_168849
508 Ga0436363_0875424
509 Ga0436363_0876648
510 Ga0436362_0014478
511 Ga0436362_1025650
512 Ga0439465_0302359
513 Ga0451797_0262521
514 Ga0451795_0005139
515 Ga0451795_1034946
516 Ga0451795_1546141
517 Ga0451807_0424907
518 Ga0451837_0118706
519 Ga0451837_0951068
520 Ga0451855_0750244
521 Ga0450902_079529
522 Ga0466972_0002629
523 Ga0466965_0004970
524 Ga0466968_0002163
525 Ga0466960_0002207
526 Ga0466959_0424068
527 Ga0466959_0448133
528 Ga0466959_0636206
529 Ga0466958_0202859
530 Ga0466958_0421520
531 Ga0496102_0067414
532 Ga0496102_0669662
533 Ga0496106_0112458
534 Ga0496108_0000307
535 Ga0496109_0441795
536 Ga0496109_0683750
537 Ga0496110_0040963
538 Ga0496110_0105501
539 Ga0496110_0775426
540 Ga0496114_0453689
541 Ga0501311_004409
542 Ga0501317_003817
543 Ga0501317_096106
544 Ga0501318_010563
545 Ga0501318_015067
546 Ga0501318_042371
547 Ga0501320_023279
548 Ga0501321_019472
549 Ga0501323_039934
550 Ga0501034_0049192
551 Ga0501034_0169228
552 Ga0501034_0494747
553 Ga0501034_0859883
554 Ga0501034_1331401
555 Ga0501040_1164745
556 Ga0501042_0491552
557 Ga0501047_0389273
558 Ga0501047_0587257
559 Ga0501047_1092712
560 Ga0501048_0848910
561 Ga0501048_1039159
562 Ga0501068_0583187
563 Ga0501073_0228306
564 Ga0501073_0614950
565 Ga0501074_0255707
566 Ga0501076_0408276
567 Ga0501076_1678216
568 Ga0501202_198067
569 Ga0501249_149267
570 Ga0501225_0250371
571 Ga0501080_0082414
572 Ga0501080_0370213
573 Ga0501081_1074410
574 nmdc:mga05p37_1516812_c1
575 nmdc:mga05p37_50510_c1
576 nmdc:mga05p37_635023_c1
577 nmdc:mga05p37_790718_c1
578 nmdc:mga09592_302628_c1
579 nmdc:mga09592_3850_c1
580 nmdc:mga0qj67_38452_c1
581 nmdc:mga0qj67_5215_c1
582 nmdc:mga06r32_1281255_c1
583 nmdc:mga06r32_1321_c1
584 nmdc:mga06r32_960748_c1
585 nmdc:mga08x19_1174236_c1
586 nmdc:mga0a205_9011_c1
587 Ga0501084_0109312
588 Ga0501084_0730327
589 Ga0587073_0083153
590 Ga0587082_045726
591 Ga0587085_000796
592 Ga0587085_043525
593 Ga0587062_000749
594 Ga0587068_101028
595 Ga0501082_1427184
596 Ga0530510_0005256
597 Ga0530510_0381917
598 Ga0530510_0998527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

16

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9757 5 133
7nhn-assembly1.cif.gz_i vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9752 5 133
6yef-assembly1.cif.gz_h 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9724 5 133
5xyu-assembly1.cif.gz_H small subunit of mycobacterium smegmatis ribosome 0.9686 5 133
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.9683 5 133
ID Description Score Start End Superfamily
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.971 77 133 3.30.1490.10
4pdbA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9709 5 75 3.30.1370.30
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.97 77 133 3.30.1490.10
4pdbA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9577 5 75 3.30.1370.30
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9392 77 133 3.30.1490.10
ID Description Score Start End GO Terms
AF-A0A7K0F3I4-F1-model_v4 deleted 0.9972 72 133
AF-A0A2V7M5U0-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9971 74 133 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2V7XB09-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9961 72 133 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D2E2Q9-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9936 72 133 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3C0SPA1-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.993 67 133 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map