F394876

General Info

Members Datasets Scaffolds Average Seq Length
299 181 598 153

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10053139|Ga0207646_100531395
Length 171
Sequence MPGWTDSKRTCAEKETEMSDSTPAAAADAQVLITRVFEAPRERVFNAWTDPAQVAAWFGPEQMESPRERIHIDLRVGGRYEITMVQRGGGAEFSIGYEIIELVEPELIVLRSDPMPEVGMHEPTIVRVEFHDHGDKTRMTLSDGPLPSEGRGHAEAGWNAAFDKLAVMLAG

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
162 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
175 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.34
Nodule 0
Rhizoplane 9.36
Rhizosphere 83.95
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10053139 3300025922 Bacteria 3624
2 JGI25406J46586_10040002 3300003203 Bacteria 1666
3 JGI25406J46586_10149709 3300003203 Bacteria 681
4 JGI25407J50210_10001304 3300003373 Bacteria 5600
5 JGI25407J50210_10023897 3300003373 Unclassified 1587
6 Ga0070683_100645125 3300005329 Bacteria 1014
7 Ga0070682_100497235 3300005337 Bacteria 944
8 Ga0070689_100233194 3300005340 Bacteria 1514
9 Ga0070692_10389555 3300005345 Bacteria 877
10 Ga0070668_100102287 3300005347 Bacteria 2272
11 Ga0070669_100922343 3300005353 Bacteria 747
12 Ga0070673_100718205 3300005364 Bacteria 918
13 Ga0070694_100215703 3300005444 Bacteria 1437
14 Ga0070708_100001803 3300005445 Bacteria 16453
15 Ga0070663_100537365 3300005455 Bacteria 975
16 Ga0070678_100595807 3300005456 Bacteria 986
17 Ga0068867_100588721 3300005459 Bacteria 968
18 Ga0070706_100308750 3300005467 Bacteria 1475
19 Ga0070698_100825197 3300005471 Unclassified 872
20 Ga0070699_100838184 3300005518 Bacteria 842
21 Ga0068853_100355394 3300005539 Bacteria 1364
22 Ga0070672_100674975 3300005543 Bacteria 904
23 Ga0070665_100082569 3300005548 Bacteria 3219
24 Ga0070665_100459626 3300005548 Bacteria 1283
25 Ga0070704_100665209 3300005549 Bacteria 920
26 Ga0070664_100215660 3300005564 Bacteria 1716
27 Ga0068854_100066349 3300005578 Bacteria 2626
28 Ga0068854_100310764 3300005578 Bacteria 1278
29 Ga0068856_100207725 3300005614 Bacteria 1973
30 Ga0068856_100379465 3300005614 Bacteria 1433
31 Ga0070702_100141284 3300005615 Bacteria 1534
32 Ga0070702_100569993 3300005615 Bacteria 844
33 Ga0068852_100308911 3300005616 Bacteria 1533
34 Ga0068866_10103593 3300005718 Bacteria 1574
35 Ga0068861_100011111 3300005719 Bacteria 6252
36 Ga0068861_100838475 3300005719 Bacteria 866
37 Ga0068851_10035865 3300005834 Bacteria 2481
38 Ga0068870_10292494 3300005840 Bacteria 1025
39 Ga0068858_100140007 3300005842 Bacteria 2271
40 Ga0081455_10013874 3300005937 Bacteria 7924
41 Ga0081455_10064178 3300005937 Bacteria 3077
42 Ga0081455_10165610 3300005937 Bacteria 1689
43 Ga0081455_10289130 3300005937 Bacteria 1181
44 Ga0081455_10340100 3300005937 Unclassified 1062
45 Ga0081538_10000027 3300005981 Bacteria 125924
46 Ga0081538_10000691 3300005981 Bacteria 37035
47 Ga0081538_10001002 3300005981 Bacteria 30063
48 Ga0081538_10003745 3300005981 Bacteria 14232
49 Ga0081538_10008288 3300005981 Bacteria 8852
50 Ga0081538_10008356 3300005981 Bacteria 8807
51 Ga0081539_10005308 3300005985 Bacteria 13253
52 Ga0081539_10005785 3300005985 Bacteria 12319
53 Ga0081539_10005974 3300005985 Bacteria 11989
54 Ga0081539_10189860 3300005985 Bacteria 957
55 Ga0075364_10389245 3300006051 Bacteria 951
56 Ga0075432_10036618 3300006058 Bacteria 1706
57 Ga0097621_101782656 3300006237 Bacteria 587
58 Ga0068871_101435665 3300006358 Bacteria 651
59 Ga0075428_100150234 3300006844 Bacteria 2531
60 Ga0075430_100145790 3300006846 Bacteria 1972
61 Ga0075430_100180750 3300006846 Bacteria 1754
62 Ga0075430_100817630 3300006846 Unclassified 768
63 Ga0075431_100071591 3300006847 Bacteria 3577
64 Ga0075433_10645875 3300006852 Bacteria 928
65 Ga0075434_101335160 3300006871 Unclassified 728
66 Ga0075429_100231482 3300006880 Bacteria 1618
67 Ga0068865_100042502 3300006881 Bacteria 3100
68 Ga0068865_100073082 3300006881 Bacteria 2438
69 Ga0068865_100508920 3300006881 Bacteria 1005
70 Ga0075436_100138254 3300006914 Bacteria 1711
71 Ga0075436_100146807 3300006914 Bacteria 1659
72 Ga0075436_100849030 3300006914 Bacteria 681
73 Ga0075435_100030790 3300007076 Bacteria 4222
74 Ga0075435_100141589 3300007076 Bacteria 2018
75 Ga0111539_10029621 3300009094 Bacteria 6663
76 Ga0111539_10683091 3300009094 Bacteria 1195
77 Ga0111539_11444356 3300009094 Unclassified 798
78 Ga0105245_10011945 3300009098 Bacteria 7549
79 Ga0105245_10247901 3300009098 Bacteria 1729
80 Ga0105247_10167965 3300009101 Bacteria 1457
81 Ga0114129_10212413 3300009147 Bacteria 2615
82 Ga0114129_10488859 3300009147 Bacteria 1609
83 Ga0105243_10030966 3300009148 Bacteria 4123
84 Ga0105243_10032352 3300009148 Bacteria 4040
85 Ga0105242_10051469 3300009176 Bacteria 3356
86 Ga0105242_10270533 3300009176 Bacteria 1539
87 Ga0105237_10340436 3300009545 Bacteria 1504
88 Ga0105238_10591288 3300009551 Bacteria 1117
89 Ga0105249_10114620 3300009553 Bacteria 2552
90 Ga0105249_10173501 3300009553 Bacteria 2092
91 Ga0105239_10106436 3300010375 Bacteria 3107
92 Ga0157371_10896540 3300013102 Bacteria 672
93 Ga0157372_10079255 3300013307 Bacteria 3714
94 Ga0157372_10294091 3300013307 Bacteria 1889
95 Ga0157372_10952321 3300013307 Bacteria 995
96 Ga0157375_10067077 3300013308 Bacteria 3584
97 Ga0157375_10398912 3300013308 Bacteria 1542
98 Ga0163163_10156612 3300014325 Bacteria 2322
99 Ga0157380_10217436 3300014326 Bacteria 1707
100 Ga0157380_10259130 3300014326 Bacteria 1578
101 Ga0157377_10093124 3300014745 Bacteria 1783
102 Ga0157379_10037252 3300014968 Bacteria 4336
103 Ga0157376_10242219 3300014969 Bacteria 1680
104 Ga0207656_10249299 3300025321 Bacteria 869
105 Ga0207688_10013835 3300025901 Bacteria 4386
106 Ga0207688_10145626 3300025901 Bacteria 1396
107 Ga0207662_10008890 3300025918 Bacteria 5511
108 Ga0207657_10307367 3300025919 Bacteria 1255
109 Ga0207681_10286954 3300025923 Bacteria 1298
110 Ga0207687_10142998 3300025927 Bacteria 1817
111 Ga0207687_10226503 3300025927 Bacteria 1476
112 Ga0207690_10781225 3300025932 Bacteria 788
113 Ga0207709_10017671 3300025935 Bacteria 3983
114 Ga0207704_10610487 3300025938 Bacteria 894
115 Ga0207691_10523506 3300025940 Bacteria 1006
116 Ga0207689_10624759 3300025942 Bacteria 907
117 Ga0207661_10236952 3300025944 Bacteria 1618
118 Ga0207661_10653124 3300025944 Bacteria 967
119 Ga0207679_10038153 3300025945 Bacteria 3421
120 Ga0207667_10750549 3300025949 Bacteria 975
121 Ga0207651_10569788 3300025960 Bacteria 987
122 Ga0207712_10063907 3300025961 Bacteria 2622
123 Ga0207640_10725809 3300025981 Bacteria 854
124 Ga0207677_10074987 3300026023 Bacteria 2402
125 Ga0207677_11408582 3300026023 Bacteria 642
126 Ga0207703_10690045 3300026035 Bacteria 970
127 Ga0207639_10310487 3300026041 Bacteria 1397
128 Ga0207639_10355941 3300026041 Bacteria 1309
129 Ga0207678_11308262 3300026067 Bacteria 641
130 Ga0207702_10376470 3300026078 Bacteria 1364
131 Ga0207675_100030372 3300026118 Bacteria 5032
132 Ga0207675_100518751 3300026118 Bacteria 1188
133 Ga0207683_10537823 3300026121 Bacteria 1080
134 Ga0207698_10117690 3300026142 Bacteria 2242
135 Ga0207698_10343378 3300026142 Bacteria 1407
136 Ga0207428_10244455 3300027907 Unclassified 1340
137 Ga0207428_10280980 3300027907 Unclassified 1236
138 Ga0268266_10080572 3300028379 Bacteria 2837
139 Ga0268264_10389434 3300028381 Bacteria 1337
140 Ga0268264_11606769 3300028381 Bacteria 661
141 Ga0307515_10045366 3300028794 Bacteria 6756
142 Ga0307513_10655541 3300031456 Bacteria 757
143 Ga0307408_100132175 3300031548 Unclassified 1948
144 Ga0307408_100223665 3300031548 Bacteria 1537
145 Ga0307408_100653025 3300031548 Bacteria 941
146 Ga0307405_10020413 3300031731 Bacteria 3701
147 Ga0307405_10391207 3300031731 Bacteria 1085
148 Ga0307405_10475462 3300031731 Bacteria 996
149 Ga0307405_11224901 3300031731 Bacteria 650
150 Ga0307413_10031612 3300031824 Bacteria 2989
151 Ga0307413_10584641 3300031824 Bacteria 911
152 Ga0307413_10704852 3300031824 Bacteria 839
153 Ga0307410_10200141 3300031852 Bacteria 1524
154 Ga0307410_10492331 3300031852 Bacteria 1007
155 Ga0307410_10640622 3300031852 Bacteria 890
156 Ga0307406_10004063 3300031901 Bacteria 7964
157 Ga0307406_10068765 3300031901 Bacteria 2313
158 Ga0307406_10072189 3300031901 Bacteria 2265
159 Ga0307406_10159996 3300031901 Bacteria 1617
160 Ga0307406_10454097 3300031901 Bacteria 1029
161 Ga0307407_10025086 3300031903 Bacteria 3137
162 Ga0307407_10034576 3300031903 Bacteria 2768
163 Ga0307412_10728709 3300031911 Unclassified 854
164 Ga0307412_11197243 3300031911 Unclassified 680
165 Ga0307409_100015674 3300031995 Bacteria 4983
166 Ga0307409_100057095 3300031995 Bacteria 3023
167 Ga0307409_100228485 3300031995 Bacteria 1685
168 Ga0307409_100269753 3300031995 Bacteria 1566
169 Ga0307409_100402750 3300031995 Bacteria 1307
170 Ga0307409_100475659 3300031995 Bacteria 1211
171 Ga0307416_100051105 3300032002 Bacteria 3299
172 Ga0307416_100104366 3300032002 Bacteria 2477
173 Ga0307416_100131032 3300032002 Bacteria 2257
174 Ga0307416_100428190 3300032002 Bacteria 1370
175 Ga0307416_100560454 3300032002 Bacteria 1217
176 Ga0307416_101624315 3300032002 Bacteria 751
177 Ga0307416_101650400 3300032002 Bacteria 746
178 Ga0307416_102603707 3300032002 Unclassified 603
179 Ga0307414_10004187 3300032004 Bacteria 7800
180 Ga0307414_10094067 3300032004 Bacteria 2236
181 Ga0307414_10716585 3300032004 Bacteria 907
182 Ga0307411_10008286 3300032005 Bacteria 5371
183 Ga0307411_10030783 3300032005 Bacteria 3294
184 Ga0307411_10064728 3300032005 Bacteria 2449
185 Ga0307411_10267855 3300032005 Bacteria 1353
186 Ga0307415_100001048 3300032126 Bacteria 12829
187 Ga0307415_100023675 3300032126 Bacteria 3818
188 Ga0307415_100389506 3300032126 Bacteria 1186
189 Ga0307415_100458350 3300032126 Bacteria 1104
190 Ga0307415_100492794 3300032126 Bacteria 1069
191 Ga0307415_101366250 3300032126 Unclassified 673
192 Ga0373947_1060947 3300035725 Unclassified 553
193 Ga0395899_0077127 3300037312 Bacteria 2431
194 Ga0395899_0094826 3300037312 Bacteria 2159
195 Ga0395899_0537018 3300037312 Bacteria 754
196 Ga0395900_0053473 3300037418 Bacteria 4156
197 Ga0395900_0135355 3300037418 Bacteria 2524
198 Ga0395898_0004684 3300037466 Bacteria 14895
199 Ga0395898_0032291 3300037466 Bacteria 5225
200 Ga0395898_0083336 3300037466 Bacteria 3082
201 Ga0395898_0367052 3300037466 Bacteria 1373
202 Ga0395905_0005576 3300037471 Bacteria 12823
203 Ga0395905_0011436 3300037471 Bacteria 8576
204 Ga0395901_0018072 3300038443 Bacteria 7196
205 Ga0395901_0023418 3300038443 Bacteria 6330
206 Ga0395901_0087900 3300038443 Bacteria 3250
207 Ga0395901_0169871 3300038443 Bacteria 2288
208 Ga0395901_0234820 3300038443 Bacteria 1914
209 Ga0451793_1800294 3300041452 Unclassified 620
210 Ga0451797_1286269 3300041453 Bacteria 1430
211 Ga0451807_0915094 3300041486 Bacteria 550
212 Ga0451853_3719450 3300041512 Bacteria 1582
213 Ga0439450_093405 3300042008 Bacteria 757
214 Ga0439435_0028013 3300042436 Bacteria 1511
215 Ga0439444_0008188 3300042437 Bacteria 1625
216 Ga0439464_0092602 3300042439 Bacteria 912
217 Ga0439460_0008567 3300042461 Bacteria 2585
218 Ga0439440_0071980 3300042993 Bacteria 901
219 Ga0495638_0021864 3300046460 Bacteria 4205
220 Ga0495584_0653141 3300046491 Bacteria 536
221 Ga0495637_0036214 3300046520 Bacteria 2151
222 Ga0495644_0167350 3300046523 Bacteria 844
223 Ga0495663_0247019 3300046525 Bacteria 633
224 Ga0495609_0313071 3300046538 Unclassified 638
225 Ga0495656_0153823 3300046615 Bacteria 1113
226 Ga0495656_0419560 3300046615 Bacteria 702
227 Ga0495625_0736176 3300046660 Unclassified 579
228 Ga0495670_0211127 3300046691 Bacteria 1030
229 Ga0495581_0573981 3300047315 Unclassified 654
230 Ga0495686_0325746 3300047472 Bacteria 841
231 Ga0496100_0028257 3300048903 Bacteria 3458
232 Ga0496100_1000641 3300048903 Bacteria 658
233 Ga0496101_0036461 3300048904 Bacteria 3483
234 Ga0496101_0531324 3300048904 Bacteria 930
235 Ga0496102_0004260 3300048905 Bacteria 12094
236 Ga0496103_0001008 3300048906 Bacteria 19706
237 Ga0496103_0126964 3300048906 Bacteria 1627
238 Ga0496106_0018974 3300048909 Bacteria 5096
239 Ga0496107_0061763 3300048910 Bacteria 2713
240 Ga0496107_0279148 3300048910 Bacteria 1244
241 Ga0496108_0002510 3300048911 Bacteria 14672
242 Ga0496108_0010287 3300048911 Bacteria 7594
243 Ga0496109_0000167 3300048912 Bacteria 64493
244 Ga0496109_0014168 3300048912 Bacteria 6933
245 Ga0496110_0049955 3300048913 Bacteria 3671
246 Ga0496110_0281376 3300048913 Bacteria 1515
247 Ga0496110_1461673 3300048913 Bacteria 593
248 Ga0496111_0009490 3300048914 Bacteria 6498
249 Ga0496111_0038884 3300048914 Bacteria 3409
250 Ga0496111_0178792 3300048914 Bacteria 1577
251 Ga0496112_0027766 3300048915 Bacteria 5458
252 Ga0496112_0380179 3300048915 Bacteria 1353
253 Ga0496113_0087149 3300048916 Bacteria 2400
254 Ga0496113_0590973 3300048916 Bacteria 889
255 Ga0496115_0174393 3300048918 Bacteria 1778
256 Ga0496116_0192933 3300048919 Bacteria 1076
257 Ga0496118_0022127 3300048921 Bacteria 5569
258 Ga0496119_0218910 3300048922 Bacteria 975
259 Ga0496120_0253356 3300048923 Bacteria 825
260 Ga0496121_0010575 3300048924 Bacteria 10375
261 Ga0496121_0669120 3300048924 Bacteria 629
262 Ga0496125_0028895 3300048928 Bacteria 4994
263 Ga0501032_0443518 3300049569 Bacteria 832
264 Ga0501043_0150746 3300049579 Bacteria 1820
265 Ga0501046_1089527 3300049580 Bacteria 552
266 Ga0501047_0139229 3300049581 Bacteria 2306
267 Ga0501070_0247367 3300049586 Bacteria 1459
268 Ga0501235_232978 3300049669 Bacteria 509
269 Ga0501243_055710 3300049675 Bacteria 723
270 Ga0501259_104652 3300049688 Bacteria 654
271 Ga0501044_0101656 3300049823 Bacteria 2892
272 nmdc:mga00v17_347798_c1 3300050491 Bacteria 964
273 nmdc:mga05p37_1315098_c1 3300050507 Unclassified 736
274 nmdc:mga05p37_1678295_c1 3300050507 Bacteria 621
275 nmdc:mga05p37_215760_c1 3300050507 Bacteria 2318
276 nmdc:mga0qj67_145270_c1 3300050509 Bacteria 1923
277 nmdc:mga0qj67_485899_c1 3300050509 Bacteria 993
278 nmdc:mga06r32_47972_c1 3300050510 Bacteria 4082
279 nmdc:mga06r32_997066_c1 3300050510 Bacteria 790
280 nmdc:mga08y16_22432_c1 3300050511 Bacteria 6663
281 nmdc:mga08y16_627129_c1 3300050511 Bacteria 1081
282 nmdc:mga0n895_18647_c1 3300050512 Bacteria 6426
283 nmdc:mga0n895_267537_c1 3300050512 Bacteria 1734
284 nmdc:mga0n895_437281_c1 3300050512 Bacteria 1322
285 nmdc:mga0rr50_90176_c1 3300050513 Bacteria 2385
286 nmdc:mga08x19_105761_c1 3300050514 Bacteria 1872
287 nmdc:mga08x19_193955_c1 3300050514 Bacteria 1390
288 nmdc:mga0a205_26130_c2 3300050515 Bacteria 1178
289 nmdc:mga0a205_626410_c1 3300050515 Bacteria 928
290 Ga0495612_0106070 3300053078 Bacteria 1200
291 Ga0495655_0164267 3300053083 Unclassified 707
292 Ga0500651_0107715 3300053093 Bacteria 1703
293 Ga0500556_0395664 3300053104 Bacteria 531
294 Ga0500594_0057883 3300053118 Bacteria 1109
295 Ga0500595_002935 3300053119 Bacteria 8146
296 Ga0500595_012071 3300053119 Bacteria 3351
297 Ga0500642_0116817 3300053130 Bacteria 1247
298 Ga0500604_0115286 3300053151 Bacteria 895
299 Ga0500622_0093694 3300053156 Bacteria 1487
300 Ga0207646_10053139
301 JGI25406J46586_10040002
302 JGI25406J46586_10149709
303 JGI25407J50210_10001304
304 JGI25407J50210_10023897
305 Ga0070683_100645125
306 Ga0070682_100497235
307 Ga0070689_100233194
308 Ga0070692_10389555
309 Ga0070668_100102287
310 Ga0070669_100922343
311 Ga0070673_100718205
312 Ga0070694_100215703
313 Ga0070708_100001803
314 Ga0070663_100537365
315 Ga0070678_100595807
316 Ga0068867_100588721
317 Ga0070706_100308750
318 Ga0070698_100825197
319 Ga0070699_100838184
320 Ga0068853_100355394
321 Ga0070672_100674975
322 Ga0070665_100082569
323 Ga0070665_100459626
324 Ga0070704_100665209
325 Ga0070664_100215660
326 Ga0068854_100066349
327 Ga0068854_100310764
328 Ga0068856_100207725
329 Ga0068856_100379465
330 Ga0070702_100141284
331 Ga0070702_100569993
332 Ga0068852_100308911
333 Ga0068866_10103593
334 Ga0068861_100011111
335 Ga0068861_100838475
336 Ga0068851_10035865
337 Ga0068870_10292494
338 Ga0068858_100140007
339 Ga0081455_10013874
340 Ga0081455_10064178
341 Ga0081455_10165610
342 Ga0081455_10289130
343 Ga0081455_10340100
344 Ga0081538_10000027
345 Ga0081538_10000691
346 Ga0081538_10001002
347 Ga0081538_10003745
348 Ga0081538_10008288
349 Ga0081538_10008356
350 Ga0081539_10005308
351 Ga0081539_10005785
352 Ga0081539_10005974
353 Ga0081539_10189860
354 Ga0075364_10389245
355 Ga0075432_10036618
356 Ga0097621_101782656
357 Ga0068871_101435665
358 Ga0075428_100150234
359 Ga0075430_100145790
360 Ga0075430_100180750
361 Ga0075430_100817630
362 Ga0075431_100071591
363 Ga0075433_10645875
364 Ga0075434_101335160
365 Ga0075429_100231482
366 Ga0068865_100042502
367 Ga0068865_100073082
368 Ga0068865_100508920
369 Ga0075436_100138254
370 Ga0075436_100146807
371 Ga0075436_100849030
372 Ga0075435_100030790
373 Ga0075435_100141589
374 Ga0111539_10029621
375 Ga0111539_10683091
376 Ga0111539_11444356
377 Ga0105245_10011945
378 Ga0105245_10247901
379 Ga0105247_10167965
380 Ga0114129_10212413
381 Ga0114129_10488859
382 Ga0105243_10030966
383 Ga0105243_10032352
384 Ga0105242_10051469
385 Ga0105242_10270533
386 Ga0105237_10340436
387 Ga0105238_10591288
388 Ga0105249_10114620
389 Ga0105249_10173501
390 Ga0105239_10106436
391 Ga0157371_10896540
392 Ga0157372_10079255
393 Ga0157372_10294091
394 Ga0157372_10952321
395 Ga0157375_10067077
396 Ga0157375_10398912
397 Ga0163163_10156612
398 Ga0157380_10217436
399 Ga0157380_10259130
400 Ga0157377_10093124
401 Ga0157379_10037252
402 Ga0157376_10242219
403 Ga0207656_10249299
404 Ga0207688_10013835
405 Ga0207688_10145626
406 Ga0207662_10008890
407 Ga0207657_10307367
408 Ga0207681_10286954
409 Ga0207687_10142998
410 Ga0207687_10226503
411 Ga0207690_10781225
412 Ga0207709_10017671
413 Ga0207704_10610487
414 Ga0207691_10523506
415 Ga0207689_10624759
416 Ga0207661_10236952
417 Ga0207661_10653124
418 Ga0207679_10038153
419 Ga0207667_10750549
420 Ga0207651_10569788
421 Ga0207712_10063907
422 Ga0207640_10725809
423 Ga0207677_10074987
424 Ga0207677_11408582
425 Ga0207703_10690045
426 Ga0207639_10310487
427 Ga0207639_10355941
428 Ga0207678_11308262
429 Ga0207702_10376470
430 Ga0207675_100030372
431 Ga0207675_100518751
432 Ga0207683_10537823
433 Ga0207698_10117690
434 Ga0207698_10343378
435 Ga0207428_10244455
436 Ga0207428_10280980
437 Ga0268266_10080572
438 Ga0268264_10389434
439 Ga0268264_11606769
440 Ga0307515_10045366
441 Ga0307513_10655541
442 Ga0307408_100132175
443 Ga0307408_100223665
444 Ga0307408_100653025
445 Ga0307405_10020413
446 Ga0307405_10391207
447 Ga0307405_10475462
448 Ga0307405_11224901
449 Ga0307413_10031612
450 Ga0307413_10584641
451 Ga0307413_10704852
452 Ga0307410_10200141
453 Ga0307410_10492331
454 Ga0307410_10640622
455 Ga0307406_10004063
456 Ga0307406_10068765
457 Ga0307406_10072189
458 Ga0307406_10159996
459 Ga0307406_10454097
460 Ga0307407_10025086
461 Ga0307407_10034576
462 Ga0307412_10728709
463 Ga0307412_11197243
464 Ga0307409_100015674
465 Ga0307409_100057095
466 Ga0307409_100228485
467 Ga0307409_100269753
468 Ga0307409_100402750
469 Ga0307409_100475659
470 Ga0307416_100051105
471 Ga0307416_100104366
472 Ga0307416_100131032
473 Ga0307416_100428190
474 Ga0307416_100560454
475 Ga0307416_101624315
476 Ga0307416_101650400
477 Ga0307416_102603707
478 Ga0307414_10004187
479 Ga0307414_10094067
480 Ga0307414_10716585
481 Ga0307411_10008286
482 Ga0307411_10030783
483 Ga0307411_10064728
484 Ga0307411_10267855
485 Ga0307415_100001048
486 Ga0307415_100023675
487 Ga0307415_100389506
488 Ga0307415_100458350
489 Ga0307415_100492794
490 Ga0307415_101366250
491 Ga0373947_1060947
492 Ga0395899_0077127
493 Ga0395899_0094826
494 Ga0395899_0537018
495 Ga0395900_0053473
496 Ga0395900_0135355
497 Ga0395898_0004684
498 Ga0395898_0032291
499 Ga0395898_0083336
500 Ga0395898_0367052
501 Ga0395905_0005576
502 Ga0395905_0011436
503 Ga0395901_0018072
504 Ga0395901_0023418
505 Ga0395901_0087900
506 Ga0395901_0169871
507 Ga0395901_0234820
508 Ga0451793_1800294
509 Ga0451797_1286269
510 Ga0451807_0915094
511 Ga0451853_3719450
512 Ga0439450_093405
513 Ga0439435_0028013
514 Ga0439444_0008188
515 Ga0439464_0092602
516 Ga0439460_0008567
517 Ga0439440_0071980
518 Ga0495638_0021864
519 Ga0495584_0653141
520 Ga0495637_0036214
521 Ga0495644_0167350
522 Ga0495663_0247019
523 Ga0495609_0313071
524 Ga0495656_0153823
525 Ga0495656_0419560
526 Ga0495625_0736176
527 Ga0495670_0211127
528 Ga0495581_0573981
529 Ga0495686_0325746
530 Ga0496100_0028257
531 Ga0496100_1000641
532 Ga0496101_0036461
533 Ga0496101_0531324
534 Ga0496102_0004260
535 Ga0496103_0001008
536 Ga0496103_0126964
537 Ga0496106_0018974
538 Ga0496107_0061763
539 Ga0496107_0279148
540 Ga0496108_0002510
541 Ga0496108_0010287
542 Ga0496109_0000167
543 Ga0496109_0014168
544 Ga0496110_0049955
545 Ga0496110_0281376
546 Ga0496110_1461673
547 Ga0496111_0009490
548 Ga0496111_0038884
549 Ga0496111_0178792
550 Ga0496112_0027766
551 Ga0496112_0380179
552 Ga0496113_0087149
553 Ga0496113_0590973
554 Ga0496115_0174393
555 Ga0496116_0192933
556 Ga0496118_0022127
557 Ga0496119_0218910
558 Ga0496120_0253356
559 Ga0496121_0010575
560 Ga0496121_0669120
561 Ga0496125_0028895
562 Ga0501032_0443518
563 Ga0501043_0150746
564 Ga0501046_1089527
565 Ga0501047_0139229
566 Ga0501070_0247367
567 Ga0501235_232978
568 Ga0501243_055710
569 Ga0501259_104652
570 Ga0501044_0101656
571 nmdc:mga00v17_347798_c1
572 nmdc:mga05p37_1315098_c1
573 nmdc:mga05p37_1678295_c1
574 nmdc:mga05p37_215760_c1
575 nmdc:mga0qj67_145270_c1
576 nmdc:mga0qj67_485899_c1
577 nmdc:mga06r32_47972_c1
578 nmdc:mga06r32_997066_c1
579 nmdc:mga08y16_22432_c1
580 nmdc:mga08y16_627129_c1
581 nmdc:mga0n895_18647_c1
582 nmdc:mga0n895_267537_c1
583 nmdc:mga0n895_437281_c1
584 nmdc:mga0rr50_90176_c1
585 nmdc:mga08x19_105761_c1
586 nmdc:mga08x19_193955_c1
587 nmdc:mga0a205_26130_c2
588 nmdc:mga0a205_626410_c1
589 Ga0495612_0106070
590 Ga0495655_0164267
591 Ga0500651_0107715
592 Ga0500556_0395664
593 Ga0500594_0057883
594 Ga0500595_002935
595 Ga0500595_012071
596 Ga0500642_0116817
597 Ga0500604_0115286
598 Ga0500622_0093694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

38

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lcg-assembly1.cif.gz_A solution nmr structure of protein rmet_5065 from ralstonia metallidurans, northeast structural genomics consortium target crr115 0.9265 13 154
2lgh-assembly1.cif.gz_A solution nmr structure of the ahsa1-like protein aha_2358 from aeromonas hydrophila refined with nh rdcs, northeast structural genomics consortium target ahr99. 0.9037 13 154
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8979 13 152
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8906 11 152
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8789 12 152
ID Description Score Start End Superfamily
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9037 13 154 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.903 13 152 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8737 13 148 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8656 13 152 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8493 12 153 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A167GXJ0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9709 13 153
AF-A0A538KNF8-F1-model_v4 SRPBCC domain-containing protein 0.9663 1 153
AF-A0A1E4M564-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9634 12 153
AF-A0A6L6BYK7-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9614 24 93
AF-A0A0H0ZQN1-F1-model_v4 deleted 0.9588 13 153

Map