F394852

General Info

Members Datasets Scaffolds Average Seq Length
299 202 272 187

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10930958|Ga0157380_109309581
Length 212
Sequence MTESARPVTASQTTITELMIPSYANFGGKIHGGILLSLMDKVAYACASKHAGAYCVTVSVDRVEFMQPVEVGELVSLHASVNYVGRSSMIVGIRVEAQQVKTGTIRHTNSCYFTMVAKDDDDKPAEVPKLILHTPEEVKRFIEAMRMKEIRIKVREQLDDAKSQIEVSHAAPRRVFLTTQLCDVGCISPVSFAQSLCERCPMETGGTAMRTE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
6 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
7 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
8 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
9 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
10 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
11 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
12 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
13 2738543023 Pedobacter sp. OK628 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
16 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
17 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
18 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
19 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
20 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
21 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
22 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
23 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
24 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
25 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
26 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
126 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
173 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
174 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
181 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
190 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
197 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
198 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
199 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
200 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
201 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
202 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.97
Metatranscriptomes 0
Isolates 9.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.7
Nodule 1
Rhizoplane 0.67
Rhizosphere 75.59
Stem 0
Stem Tuber 0
Unclassified 12.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4602050 2162886012 Bacteria 1557
2 2214631065 2209111006 Bacteria 1101
3 JGI24736J21556_1020903 3300001904 Bacteria 1027
4 JGI24737J22298_10018666 3300001990 Bacteria 2224
5 JGI25162J39368_1000121 3300002737 Bacteria 85899
6 rootH1_10006069 3300003316 Bacteria 6073
7 rootH1_10132912 3300003316 Bacteria 4239
8 rootH1_10168076 3300003316 Bacteria 1914
9 rootH2_10031646 3300003320 Bacteria 23569
10 rootH2_10246397 3300003320 Bacteria 2805
11 rootL2_10027925 3300003322 Bacteria 2513
12 rootL2_10075349 3300003322 Bacteria 21885
13 rootH1_10027193 3300003323 Bacteria 2635
14 rootH1_10062951 3300003323 Bacteria 8844
15 Ga0055536_1004087 3300003781 Bacteria 7588
16 Ga0055531_10000148 3300003794 Bacteria 80963
17 Ga0065165_1000131 3300005262 Bacteria 128880
18 Ga0065714_10003028 3300005288 Bacteria 8948
19 Ga0065714_10069240 3300005288 Bacteria 4323
20 Ga0065715_10089794 3300005293 Bacteria 8498
21 Ga0070658_10000018 3300005327 Bacteria 200558
22 Ga0070680_100490909 3300005336 Bacteria 1050
23 Ga0068868_100012170 3300005338 Bacteria 6284
24 Ga0070660_100082603 3300005339 Unclassified 2523
25 Ga0070660_100109650 3300005339 Bacteria 2195
26 Ga0070691_10074448 3300005341 Bacteria 1652
27 Ga0070687_100344757 3300005343 Bacteria 959
28 Ga0070669_100839365 3300005353 Bacteria 782
29 Ga0070673_100003122 3300005364 Bacteria 10259
30 Ga0070673_100177806 3300005364 Unclassified 1820
31 Ga0070663_100364007 3300005455 Unclassified 1174
32 Ga0070678_100012887 3300005456 Bacteria 5218
33 Ga0070662_100000081 3300005457 Bacteria 53265
34 Ga0070662_100041245 3300005457 Bacteria 3292
35 Ga0068867_100008949 3300005459 Bacteria 7065
36 Ga0070679_100020219 3300005530 Bacteria 6490
37 Ga0068853_100016443 3300005539 Bacteria 6088
38 Ga0068853_100046226 3300005539 Bacteria 3731
39 Ga0068853_100668675 3300005539 Bacteria 989
40 Ga0070672_100564234 3300005543 Unclassified 989
41 Ga0068855_100028946 3300005563 Bacteria 6627
42 Ga0068855_100576877 3300005563 Bacteria 1215
43 Ga0068855_100626795 3300005563 Unclassified 1157
44 Ga0068855_100655167 3300005563 Bacteria 1127
45 Ga0068855_100655823 3300005563 Bacteria 1126
46 Ga0068857_100446787 3300005577 Bacteria 1208
47 Ga0068856_100047978 3300005614 Bacteria 4207
48 Ga0068856_100206260 3300005614 Unclassified 1980
49 Ga0068852_100002760 3300005616 Bacteria 12169
50 Ga0068864_100178079 3300005618 Unclassified 1942
51 Ga0068864_100435703 3300005618 Bacteria 1251
52 Ga0068858_100258361 3300005842 Unclassified 1655
53 Ga0097621_100000039 3300006237 Bacteria 67231
54 Ga0097621_100197857 3300006237 Unclassified 1743
55 Ga0068871_100000857 3300006358 Bacteria 20286
56 Ga0075428_100010944 3300006844 Bacteria 10087
57 Ga0068865_100002192 3300006881 Bacteria 11508
58 Ga0099824_1001951 3300006942 Bacteria 29917
59 Ga0105244_10000163 3300009036 Bacteria 68575
60 Ga0105240_10036632 3300009093 Bacteria 6308
61 Ga0105240_10043072 3300009093 Bacteria 5747
62 Ga0105240_10221601 3300009093 Bacteria 2203
63 Ga0105240_10373641 3300009093 Bacteria 1611
64 Ga0111539_10003202 3300009094 Bacteria 21659
65 Ga0105243_10032488 3300009148 Bacteria 4033
66 Ga0105241_10001088 3300009174 Bacteria 20688
67 Ga0105241_10002132 3300009174 Bacteria 14966
68 Ga0105241_11139527 3300009174 Unclassified 736
69 Ga0105242_10025126 3300009176 Bacteria 4710
70 Ga0105237_10004703 3300009545 Bacteria 15711
71 Ga0105237_10026943 3300009545 Bacteria 5871
72 Ga0105237_10037819 3300009545 Bacteria 4876
73 Ga0105238_10009249 3300009551 Bacteria 9862
74 Ga0105249_10953745 3300009553 Bacteria 926
75 Ga0105239_10000132 3300010375 Bacteria 105380
76 Ga0105239_10000139 3300010375 Bacteria 102090
77 Ga0105239_10006154 3300010375 Bacteria 13964
78 Ga0105239_10099796 3300010375 Bacteria 3210
79 Ga0105239_10745117 3300010375 Unclassified 1121
80 Ga0105246_10054914 3300011119 Bacteria 2747
81 Ga0157327_1041322 3300012512 Bacteria 621
82 Ga0157373_10000007 3300013100 Bacteria 216734
83 Ga0157373_10001984 3300013100 Bacteria 15508
84 Ga0157373_10064739 3300013100 Unclassified 2588
85 Ga0157371_10000251 3300013102 Bacteria 74986
86 Ga0157371_10004516 3300013102 Bacteria 12125
87 Ga0157371_10014036 3300013102 Bacteria 6062
88 Ga0157370_10000134 3300013104 Bacteria 89337
89 Ga0157370_10002078 3300013104 Bacteria 24515
90 Ga0157370_10011954 3300013104 Bacteria 9048
91 Ga0157370_10054256 3300013104 Bacteria 3820
92 Ga0157370_10138128 3300013104 Bacteria 2271
93 Ga0157370_10382703 3300013104 Bacteria 1296
94 Ga0157370_10454253 3300013104 Bacteria 1178
95 Ga0157370_10495766 3300013104 Bacteria 1122
96 Ga0157370_10674537 3300013104 Bacteria 944
97 Ga0157370_10703273 3300013104 Unclassified 922
98 Ga0157369_10022177 3300013105 Bacteria 7093
99 Ga0157369_10050214 3300013105 Bacteria 4519
100 Ga0157369_10151100 3300013105 Bacteria 2454
101 Ga0157374_10000135 3300013296 Bacteria 67340
102 Ga0157374_10001901 3300013296 Bacteria 17499
103 Ga0157374_10036399 3300013296 Bacteria 4508
104 Ga0157374_10364944 3300013296 Bacteria 1437
105 Ga0157378_10013175 3300013297 Bacteria 7234
106 Ga0157372_10000181 3300013307 Bacteria 69472
107 Ga0157372_10017927 3300013307 Bacteria 7609
108 Ga0157372_10061899 3300013307 Bacteria 4192
109 Ga0157372_11123891 3300013307 Unclassified 909
110 Ga0157375_10011045 3300013308 Bacteria 7963
111 Ga0157375_10105663 3300013308 Bacteria 2906
112 Ga0157375_10789383 3300013308 Bacteria 1099
113 Ga0157375_12362625 3300013308 Unclassified 634
114 Ga0157380_10012415 3300014326 Bacteria 6181
115 Ga0157380_10930958 3300014326 Bacteria 897
116 Ga0157377_10071739 3300014745 Unclassified 2003
117 Ga0157376_10785477 3300014969 Bacteria 964
118 Ga0182006_1000410 3300015261 Bacteria 34736
119 Ga0182007_10151442 3300015262 Bacteria 789
120 Ga0163161_10000134 3300017792 Bacteria 69955
121 Ga0163161_10377622 3300017792 Bacteria 1132
122 Ga0213872_10015347 3300021361 Bacteria 3564
123 Ga0207427_108482 3300025231 Bacteria 1143
124 Ga0209437_100017 3300025233 Bacteria 694471
125 Ga0209233_1001460 3300025261 Bacteria 9332
126 Ga0209676_1001085 3300025292 Bacteria 30593
127 Ga0209050_1001591 3300025298 Bacteria 23468
128 Ga0209257_1000006 3300025304 Bacteria 1570111
129 Ga0207655_1000131 3300025728 Bacteria 148173
130 Ga0207647_10000058 3300025904 Bacteria 84631
131 Ga0207647_10006654 3300025904 Bacteria 8399
132 Ga0207645_10000957 3300025907 Bacteria 23915
133 Ga0207705_10000036 3300025909 Bacteria 200787
134 Ga0207654_10006232 3300025911 Bacteria 5994
135 Ga0207654_10009271 3300025911 Bacteria 4995
136 Ga0207695_10007179 3300025913 Bacteria 14247
137 Ga0207695_10032160 3300025913 Bacteria 5744
138 Ga0207695_10280497 3300025913 Bacteria 1560
139 Ga0207671_10008839 3300025914 Bacteria 8484
140 Ga0207671_10011791 3300025914 Bacteria 7076
141 Ga0207671_10020439 3300025914 Bacteria 5039
142 Ga0207662_10405350 3300025918 Bacteria 925
143 Ga0207657_10133355 3300025919 Bacteria 2034
144 Ga0207652_10017559 3300025921 Bacteria 5857
145 Ga0207694_10015828 3300025924 Bacteria 5690
146 Ga0207644_10014575 3300025931 Bacteria 5262
147 Ga0207706_10000317 3300025933 Bacteria 52169
148 Ga0207706_10060427 3300025933 Bacteria 3337
149 Ga0207686_10019615 3300025934 Bacteria 3850
150 Ga0207709_10161970 3300025935 Bacteria 1561
151 Ga0207704_10000076 3300025938 Bacteria 61793
152 Ga0207691_10525901 3300025940 Unclassified 1004
153 Ga0207667_10057102 3300025949 Bacteria 4099
154 Ga0207667_10335826 3300025949 Bacteria 1543
155 Ga0207667_11305892 3300025949 Unclassified 702
156 Ga0207651_10286931 3300025960 Unclassified 1363
157 Ga0207677_10057708 3300026023 Bacteria 2668
158 Ga0207639_10012033 3300026041 Bacteria 6020
159 Ga0207639_10964640 3300026041 Bacteria 798
160 Ga0207702_10034122 3300026078 Bacteria 4253
161 Ga0207702_10214732 3300026078 Unclassified 1790
162 Ga0207648_10000648 3300026089 Bacteria 39101
163 Ga0207676_10192602 3300026095 Bacteria 1795
164 Ga0207674_10467372 3300026116 Bacteria 1219
165 Ga0207674_10763959 3300026116 Bacteria 933
166 Ga0207683_10009295 3300026121 Bacteria 8375
167 Ga0207698_10014707 3300026142 Bacteria 5213
168 Ga0209281_1000388 3300027111 Bacteria 69493
169 Ga0209489_104877 3300027361 Bacteria 24119
170 Ga0307515_10000872 3300028794 Bacteria 69248
171 Ga0307515_10266603 3300028794 Bacteria 1440
172 Ga0307515_10568341 3300028794 Bacteria 744
173 Ga0307509_10052222 3300031507 Unclassified 4365
174 Ga0307514_10139173 3300031649 Unclassified 1654
175 Ga0316576_10213254 3300031727 Bacteria 1453
176 Ga0307410_10086452 3300031852 Bacteria 2215
177 Ga0307407_10247703 3300031903 Bacteria 1219
178 Ga0307412_10563487 3300031911 Bacteria 959
179 Ga0307412_11247566 3300031911 Unclassified 667
180 Ga0307416_100003851 3300032002 Bacteria 8927
181 Ga0307416_100110847 3300032002 Bacteria 2417
182 Ga0307414_10154297 3300032004 Bacteria 1815
183 Ga0307414_10596621 3300032004 Bacteria 990
184 Ga0307414_10751690 3300032004 Bacteria 886
185 Ga0307414_10765233 3300032004 Bacteria 879
186 Ga0307414_10923842 3300032004 Bacteria 801
187 Ga0307510_10010559 3300033180 Bacteria 10972
188 Ga0307510_10071106 3300033180 Bacteria 3468
189 Ga0373941_0035470 3300035115 Bacteria 1511
190 Ga0373935_0306471 3300035692 Bacteria 1124
191 Ga0395900_0000181 3300037418 Bacteria 101531
192 Ga0395901_0001313 3300038443 Bacteria 26228
193 Ga0436361_0458961 3300039447 Bacteria 22334
194 Ga0451802_0330236 3300041460 Bacteria 739
195 Ga0451802_0696731 3300041460 Bacteria 864
196 Ga0451851_0581581 3300041507 Bacteria 1425
197 Ga0439434_0230648 3300042435 Unclassified 630
198 Ga0451577_0957088 3300042876 Bacteria 770
199 Ga0466964_0119304 3300044706 Bacteria 1187
200 Ga0453684_0061136 3300044712 Bacteria 4838
201 Ga0453684_1003984 3300044712 Unclassified 887
202 Ga0451576_0017811 3300045051 Bacteria 7803
203 Ga0451576_0092444 3300045051 Bacteria 3147
204 Ga0451576_0170080 3300045051 Unclassified 2274
205 Ga0495638_0000013 3300046460 Bacteria 430133
206 Ga0495616_0024718 3300046513 Bacteria 3218
207 Ga0495631_0001100 3300046518 Bacteria 16760
208 Ga0495625_0009020 3300046660 Bacteria 8424
209 Ga0495625_0062356 3300046660 Bacteria 2635
210 Ga0495625_0078653 3300046660 Bacteria 2302
211 Ga0495671_0069472 3300046692 Bacteria 1731
212 Ga0495687_002794 3300047443 Bacteria 13475
213 Ga0495687_092176 3300047443 Bacteria 1157
214 Ga0495686_0001050 3300047472 Bacteria 33105
215 Ga0495686_0045045 3300047472 Bacteria 2792
216 Ga0496121_0012350 3300048924 Bacteria 9337
217 Ga0496121_0025129 3300048924 Bacteria 5667
218 Ga0496124_0006718 3300048927 Bacteria 12447
219 Ga0496124_0094657 3300048927 Bacteria 2429
220 Ga0496125_0000018 3300048928 Bacteria 482390
221 Ga0496126_0021502 3300048929 Bacteria 6301
222 Ga0495682_0095103 3300049460 Unclassified 1070
223 Ga0501296_027011 3300049519 Unclassified 758
224 Ga0501032_0046382 3300049569 Bacteria 2937
225 Ga0501033_0000004 3300049570 Bacteria 441310
226 Ga0501034_0000359 3300049571 Bacteria 77578
227 Ga0501036_0011088 3300049572 Bacteria 7455
228 Ga0501037_0024702 3300049573 Bacteria 4443
229 Ga0501038_0002748 3300049574 Bacteria 16402
230 Ga0501039_0007537 3300049575 Bacteria 8315
231 Ga0501043_0003612 3300049579 Bacteria 12706
232 Ga0501048_0325415 3300049582 Unclassified 1095
233 Ga0501069_0130077 3300049585 Bacteria 1441
234 Ga0501217_000416 3300049661 Bacteria 6903
235 Ga0501222_009937 3300049662 Bacteria 1257
236 Ga0501247_000176 3300049677 Bacteria 4035
237 Ga0501249_000020 3300049679 Bacteria 98438
238 Ga0501253_088111 3300049683 Unclassified 710
239 Ga0501257_000589 3300049686 Bacteria 7184
240 Ga0501257_004192 3300049686 Unclassified 3135
241 Ga0501259_001221 3300049688 Bacteria 4275
242 Ga0501225_0019602 3300049705 Bacteria 1872
243 Ga0501271_005679 3300049768 Bacteria 1222
244 Ga0501271_018674 3300049768 Bacteria 793
245 Ga0501279_045311 3300049775 Bacteria 685
246 Ga0501035_0002299 3300049822 Bacteria 18858
247 Ga0501044_0044680 3300049823 Bacteria 4595
248 Ga0501045_0000290 3300049824 Bacteria 29331
249 nmdc:mga08y16_11789_c1 3300050511 Bacteria 9185
250 nmdc:mga08y16_69925_c1 3300050511 Bacteria 3659
251 Ga0500635_0000615 3300053080 Bacteria 9293
252 Ga0500635_0004168 3300053080 Bacteria 3705
253 Ga0500646_0002854 3300053090 Bacteria 4435
254 Ga0500646_0130049 3300053090 Unclassified 818
255 Ga0500641_0000010 3300053096 Bacteria 171383
256 Ga0500641_0001589 3300053096 Bacteria 8083
257 Ga0500557_018415 3300053105 Bacteria 1948
258 Ga0500562_000018 3300053108 Bacteria 126890
259 Ga0500594_0020641 3300053118 Bacteria 1645
260 Ga0500608_000174 3300053122 Bacteria 26422
261 Ga0500568_0153242 3300053139 Bacteria 852
262 Ga0500616_0000013 3300053153 Bacteria 674172
263 Ga0500616_0044317 3300053153 Bacteria 2374
264 Ga0500616_0056191 3300053153 Bacteria 2055
265 Ga0500616_0286959 3300053153 Unclassified 688
266 Ga0500622_0000041 3300053156 Bacteria 170067
267 Ga0500622_0000045 3300053156 Bacteria 158316
268 Ga0500622_0000114 3300053156 Bacteria 83162
269 Ga0500624_000854 3300053157 Bacteria 6736
270 Ga0500584_160072 3300053726 Bacteria 824
271 Ga0500587_013943 3300053739 Bacteria 1018
272 Ga0500661_001810 3300055283 Bacteria 4032

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10138128 Ga0157370_101381282 164
2 3300013104 Ga0157370_10382703 Ga0157370_103827033 164
3 3300049519 Ga0501296_027011 Ga0501296_027011_53_586 169
4 3300005343 Ga0070687_100344757 Ga0070687_1003447571 172
5 3300025918 Ga0207662_10405350 Ga0207662_104053502 172
6 iso_pu_bacteria 2513020052 2513235690 176
7 iso_pu_bacteria 2519899754 2520879897 176
8 iso_pu_bacteria 2522125168 2522549486 176
9 iso_pu_bacteria 2643221600 2644009568 176
10 iso_pu_bacteria 2643221667 2644371917 176
11 iso_pu_bacteria 2643221716 2644643627 176
12 iso_pu_bacteria 2643221725 2644684621 176
13 iso_pu_bacteria 2738541279 2738732745 176
14 iso_pu_bacteria 2738541285 2738765283 176
15 iso_pu_bacteria 2738543007 2739214326 176
16 iso_pu_bacteria 2802428842 2802654858 176
17 iso_pu_bacteria 2816332280 2817413232 176
18 iso_pu_bacteria 2881359912 2881361827 176
19 iso_pu_bacteria 2903895155 2903898963 176
20 iso_pu_bacteria 2919191525 2919196452 176
21 iso_pu_bacteria 2958458903 2958462166 176
22 iso_pu_bacteria 2977268062 2977271762 176
23 iso_pu_bacteria 8054307821 8054309812 176
24 iso_pu_bacteria 8055419101 8055423263 176
25 iso_pu_bacteria 8055592153 8055595382 176
26 iso_pu_bacteria 2977232053 2977236212 177
27 iso_pu_bacteria 2738543023 2739305221 178
28 iso_pu_bacteria 2839989709 2839990554 179
29 2209111006 2214631065 2213661923 180
30 3300003316 rootH1_10168076 rootH1_101680761 180
31 3300003781 Ga0055536_1004087 Ga0055536_10040872 180
32 3300003794 Ga0055531_10000148 Ga0055531_1000014810 180
33 3300005262 Ga0065165_1000131 Ga0065165_1000131112 180
34 3300005288 Ga0065714_10069240 Ga0065714_100692406 180
35 3300005618 Ga0068864_100178079 Ga0068864_1001780792 180
36 3300006942 Ga0099824_1001951 Ga0099824_100195126 180
37 3300009036 Ga0105244_10000163 Ga0105244_1000016347 180
38 3300012512 Ga0157327_1041322 Ga0157327_10413221 180
39 3300013100 Ga0157373_10000007 Ga0157373_10000007170 180
40 3300013104 Ga0157370_10000134 Ga0157370_1000013431 180
41 3300013104 Ga0157370_10002078 Ga0157370_1000207810 180
42 3300013308 Ga0157375_10105663 Ga0157375_101056633 180
43 3300014326 Ga0157380_10012415 Ga0157380_100124154 180
44 3300015261 Ga0182006_1000410 Ga0182006_100041021 180
45 3300017792 Ga0163161_10000134 Ga0163161_1000013422 180
46 3300025292 Ga0209676_1001085 Ga0209676_10010856 180
47 3300025304 Ga0209257_1000006 Ga0209257_10000061283 180
48 3300025728 Ga0207655_1000131 Ga0207655_100013198 180
49 3300026095 Ga0207676_10192602 Ga0207676_101926022 180
50 3300026116 Ga0207674_10763959 Ga0207674_107639592 180
51 3300027361 Ga0209489_104877 Ga0209489_10487726 180
52 3300028794 Ga0307515_10568341 Ga0307515_105683412 180
53 3300031507 Ga0307509_10052222 Ga0307509_100522222 180
54 3300031911 Ga0307412_11247566 Ga0307412_112475661 180
55 3300032002 Ga0307416_100003851 Ga0307416_1000038513 180
56 3300032004 Ga0307414_10154297 Ga0307414_101542972 180
57 3300032004 Ga0307414_10765233 Ga0307414_107652332 180
58 3300033180 Ga0307510_10071106 Ga0307510_100711063 180
59 3300041460 Ga0451802_0696731 Ga0451802_0696731_62_613 180
60 3300042435 Ga0439434_0230648 Ga0439434_0230648_30_581 180
61 3300046660 Ga0495625_0078653 Ga0495625_0078653_57_605 180
62 3300046692 Ga0495671_0069472 Ga0495671_0069472_1118_1666 180
63 3300048924 Ga0496121_0012350 Ga0496121_0012350_3797_4345 180
64 3300048927 Ga0496124_0094657 Ga0496124_0094657_1128_1676 180
65 3300049585 Ga0501069_0130077 Ga0501069_0130077_378_929 180
66 3300049679 Ga0501249_000020 Ga0501249_000020_46103_46651 180
67 3300049705 Ga0501225_0019602 Ga0501225_0019602_201_758 180
68 3300050511 nmdc:mga08y16_69925_c1 nmdc:mga08y16_69925_c1_2752_3303 180
69 3300053090 Ga0500646_0002854 Ga0500646_0002854_3827_4375 180
70 3300053090 Ga0500646_0130049 Ga0500646_0130049_165_713 180
71 3300053096 Ga0500641_0000010 Ga0500641_0000010_18868_19416 180
72 3300053096 Ga0500641_0001589 Ga0500641_0001589_2875_3423 180
73 3300053118 Ga0500594_0020641 Ga0500594_0020641_292_840 180
74 3300053153 Ga0500616_0044317 Ga0500616_0044317_1004_1552 180
75 3300053156 Ga0500622_0000041 Ga0500622_0000041_22734_23282 180
76 3300053156 Ga0500622_0000045 Ga0500622_0000045_141255_141803 180
77 3300053726 Ga0500584_160072 Ga0500584_160072_103_651 180
78 3300053739 Ga0500587_013943 Ga0500587_013943_72_620 180
79 3300003316 rootH1_10006069 rootH1_100060693 181
80 3300003320 rootH2_10031646 rootH2_100316469 181
81 3300003322 rootL2_10027925 rootL2_100279253 181
82 3300015262 Ga0182007_10151442 Ga0182007_101514422 181
83 3300044706 Ga0466964_0119304 Ga0466964_0119304_156_707 181
84 3300049661 Ga0501217_000416 Ga0501217_000416_4250_4801 181
85 3300049677 Ga0501247_000176 Ga0501247_000176_46_597 181
86 3300049683 Ga0501253_088111 Ga0501253_088111_114_671 181
87 3300049686 Ga0501257_000589 Ga0501257_000589_5097_5654 181
88 3300049768 Ga0501271_018674 Ga0501271_018674_93_644 181
89 3300053108 Ga0500562_000018 Ga0500562_000018_68429_68989 181
90 3300053153 Ga0500616_0286959 Ga0500616_0286959_92_652 181
91 3300053156 Ga0500622_0000114 Ga0500622_0000114_16579_17142 181
92 3300055283 Ga0500661_001810 Ga0500661_001810_1163_1723 181
93 3300003322 rootL2_10075349 rootL2_100753499 182
94 3300003323 rootH1_10027193 rootH1_100271931 182
95 3300003323 rootH1_10062951 rootH1_100629514 182
96 3300005455 Ga0070663_100364007 Ga0070663_1003640072 182
97 3300005577 Ga0068857_100446787 Ga0068857_1004467872 182
98 3300005614 Ga0068856_100047978 Ga0068856_1000479782 182
99 3300005614 Ga0068856_100206260 Ga0068856_1002062602 182
100 3300005618 Ga0068864_100435703 Ga0068864_1004357032 182
101 3300013308 Ga0157375_12362625 Ga0157375_123626251 182
102 3300025298 Ga0209050_1001591 Ga0209050_100159116 182
103 3300026078 Ga0207702_10034122 Ga0207702_100341223 182
104 3300026116 Ga0207674_10467372 Ga0207674_104673722 182
105 3300028794 Ga0307515_10000872 Ga0307515_1000087248 182
106 3300028794 Ga0307515_10266603 Ga0307515_102666032 182
107 3300031649 Ga0307514_10139173 Ga0307514_101391732 182
108 3300031727 Ga0316576_10213254 Ga0316576_102132543 182
109 3300031852 Ga0307410_10086452 Ga0307410_100864524 182
110 3300031903 Ga0307407_10247703 Ga0307407_102477032 182
111 3300031911 Ga0307412_10563487 Ga0307412_105634871 182
112 3300032002 Ga0307416_100110847 Ga0307416_1001108472 182
113 3300035692 Ga0373935_0306471 Ga0373935_0306471_526_1083 182
114 3300041460 Ga0451802_0330236 Ga0451802_0330236_84_641 182
115 3300041507 Ga0451851_0581581 Ga0451851_0581581_693_1250 182
116 3300042876 Ga0451577_0957088 Ga0451577_0957088_77_631 182
117 3300044712 Ga0453684_1003984 Ga0453684_1003984_174_734 182
118 3300045051 Ga0451576_0017811 Ga0451576_0017811_1637_2197 182
119 3300045051 Ga0451576_0092444 Ga0451576_0092444_414_968 182
120 3300045051 Ga0451576_0170080 Ga0451576_0170080_1633_2187 182
121 3300046460 Ga0495638_0000013 Ga0495638_0000013_206215_206778 182
122 3300049569 Ga0501032_0046382 Ga0501032_0046382_1791_2411 182
123 3300049570 Ga0501033_0000004 Ga0501033_0000004_360606_361226 182
124 3300049571 Ga0501034_0000359 Ga0501034_0000359_71265_71885 182
125 3300049572 Ga0501036_0011088 Ga0501036_0011088_6687_7307 182
126 3300049573 Ga0501037_0024702 Ga0501037_0024702_2274_2894 182
127 3300049574 Ga0501038_0002748 Ga0501038_0002748_12886_13506 182
128 3300049575 Ga0501039_0007537 Ga0501039_0007537_5982_6602 182
129 3300049579 Ga0501043_0003612 Ga0501043_0003612_5844_6464 182
130 3300049582 Ga0501048_0325415 Ga0501048_0325415_379_999 182
131 3300049662 Ga0501222_009937 Ga0501222_009937_255_809 182
132 3300049686 Ga0501257_004192 Ga0501257_004192_202_756 182
133 3300049688 Ga0501259_001221 Ga0501259_001221_1829_2383 182
134 3300049768 Ga0501271_005679 Ga0501271_005679_549_1103 182
135 3300049822 Ga0501035_0002299 Ga0501035_0002299_2780_3400 182
136 3300049823 Ga0501044_0044680 Ga0501044_0044680_3852_4472 182
137 3300049824 Ga0501045_0000290 Ga0501045_0000290_21479_22099 182
138 3300053105 Ga0500557_018415 Ga0500557_018415_291_854 182
139 3300053153 Ga0500616_0000013 Ga0500616_0000013_512200_512763 182
140 3300005336 Ga0070680_100490909 Ga0070680_1004909092 183
141 3300006844 Ga0075428_100010944 Ga0075428_1000109449 183
142 3300009094 Ga0111539_10003202 Ga0111539_1000320216 183
143 3300009148 Ga0105243_10032488 Ga0105243_100324882 183
144 3300013102 Ga0157371_10004516 Ga0157371_100045167 183
145 3300013104 Ga0157370_10011954 Ga0157370_100119546 183
146 3300013105 Ga0157369_10022177 Ga0157369_100221777 183
147 3300025935 Ga0207709_10161970 Ga0207709_101619703 183
148 3300026078 Ga0207702_10214732 Ga0207702_102147322 183
149 3300027111 Ga0209281_1000388 Ga0209281_10003882 183
150 3300032004 Ga0307414_10596621 Ga0307414_105966211 183
151 3300032004 Ga0307414_10751690 Ga0307414_107516901 183
152 3300032004 Ga0307414_10923842 Ga0307414_109238422 183
153 3300048924 Ga0496121_0025129 Ga0496121_0025129_5007_5600 183
154 3300048927 Ga0496124_0006718 Ga0496124_0006718_6127_6720 183
155 3300048928 Ga0496125_0000018 Ga0496125_0000018_42753_43346 183
156 3300048929 Ga0496126_0021502 Ga0496126_0021502_2656_3249 183
157 3300049775 Ga0501279_045311 Ga0501279_045311_103_672 183
158 3300050511 nmdc:mga08y16_11789_c1 nmdc:mga08y16_11789_c1_6765_7328 183
159 3300053139 Ga0500568_0153242 Ga0500568_0153242_239_799 183
160 3300053153 Ga0500616_0056191 Ga0500616_0056191_692_1252 183
161 3300005353 Ga0070669_100839365 Ga0070669_1008393652 184
162 3300013296 Ga0157374_10364944 Ga0157374_103649442 184
163 3300014326 Ga0157380_10930958 Ga0157380_109309581 184
164 iso_pu_bacteria 2852627209 2852630959 184
165 iso_pu_bacteria 2919437846 2919438521 184
166 3300003316 rootH1_10132912 rootH1_101329123 185
167 3300003320 rootH2_10246397 rootH2_102463972 185
168 3300005530 Ga0070679_100020219 Ga0070679_1000202194 185
169 3300025921 Ga0207652_10017559 Ga0207652_100175595 185
170 3300035115 Ga0373941_0035470 Ga0373941_0035470_864_1427 185
171 3300038443 Ga0395901_0001313 Ga0395901_0001313_23694_24260 185
172 3300044712 Ga0453684_0061136 Ga0453684_0061136_1532_2107 185
173 3300053080 Ga0500635_0004168 Ga0500635_0004168_1645_2208 185
174 iso_pu_bacteria 2919186247 2919189284 185
175 iso_pu_bacteria 2939664404 2939666561 185
176 3300001904 JGI24736J21556_1020903 JGI24736J21556_10209032 186
177 3300001990 JGI24737J22298_10018666 JGI24737J22298_100186662 186
178 3300002737 JGI25162J39368_1000121 JGI25162J39368_100012121 186
179 3300005288 Ga0065714_10003028 Ga0065714_100030286 186
180 3300005327 Ga0070658_10000018 Ga0070658_10000018176 186
181 3300005338 Ga0068868_100012170 Ga0068868_1000121704 186
182 3300005339 Ga0070660_100082603 Ga0070660_1000826032 186
183 3300005339 Ga0070660_100109650 Ga0070660_1001096502 186
184 3300005341 Ga0070691_10074448 Ga0070691_100744481 186
185 3300005364 Ga0070673_100003122 Ga0070673_1000031223 186
186 3300005364 Ga0070673_100177806 Ga0070673_1001778062 186
187 3300005456 Ga0070678_100012887 Ga0070678_1000128874 186
188 3300005457 Ga0070662_100000081 Ga0070662_10000008134 186
189 3300005457 Ga0070662_100041245 Ga0070662_1000412452 186
190 3300005459 Ga0068867_100008949 Ga0068867_1000089493 186
191 3300005539 Ga0068853_100016443 Ga0068853_1000164432 186
192 3300005539 Ga0068853_100046226 Ga0068853_1000462262 186
193 3300005539 Ga0068853_100668675 Ga0068853_1006686751 186
194 3300005543 Ga0070672_100564234 Ga0070672_1005642342 186
195 3300005563 Ga0068855_100028946 Ga0068855_1000289464 186
196 3300005563 Ga0068855_100576877 Ga0068855_1005768772 186
197 3300005563 Ga0068855_100626795 Ga0068855_1006267951 186
198 3300005563 Ga0068855_100655167 Ga0068855_1006551672 186
199 3300005563 Ga0068855_100655823 Ga0068855_1006558231 186
200 3300005616 Ga0068852_100002760 Ga0068852_10000276010 186
201 3300005842 Ga0068858_100258361 Ga0068858_1002583612 186
202 3300006237 Ga0097621_100000039 Ga0097621_10000003947 186
203 3300006237 Ga0097621_100197857 Ga0097621_1001978572 186
204 3300006358 Ga0068871_100000857 Ga0068871_1000008578 186
205 3300006881 Ga0068865_100002192 Ga0068865_1000021922 186
206 3300009093 Ga0105240_10036632 Ga0105240_100366322 186
207 3300009093 Ga0105240_10043072 Ga0105240_100430722 186
208 3300009093 Ga0105240_10221601 Ga0105240_102216012 186
209 3300009093 Ga0105240_10373641 Ga0105240_103736413 186
210 3300009174 Ga0105241_10001088 Ga0105241_1000108813 186
211 3300009174 Ga0105241_10002132 Ga0105241_100021321 186
212 3300009174 Ga0105241_11139527 Ga0105241_111395271 186
213 3300009176 Ga0105242_10025126 Ga0105242_100251263 186
214 3300009545 Ga0105237_10004703 Ga0105237_100047038 186
215 3300009545 Ga0105237_10026943 Ga0105237_100269431 186
216 3300009545 Ga0105237_10037819 Ga0105237_100378193 186
217 3300009551 Ga0105238_10009249 Ga0105238_100092497 186
218 3300009553 Ga0105249_10953745 Ga0105249_109537451 186
219 3300010375 Ga0105239_10000132 Ga0105239_1000013249 186
220 3300010375 Ga0105239_10000139 Ga0105239_1000013915 186
221 3300010375 Ga0105239_10006154 Ga0105239_100061542 186
222 3300010375 Ga0105239_10099796 Ga0105239_100997962 186
223 3300010375 Ga0105239_10745117 Ga0105239_107451172 186
224 3300011119 Ga0105246_10054914 Ga0105246_100549141 186
225 3300013100 Ga0157373_10001984 Ga0157373_100019844 186
226 3300013100 Ga0157373_10064739 Ga0157373_100647392 186
227 3300013102 Ga0157371_10000251 Ga0157371_1000025153 186
228 3300013102 Ga0157371_10014036 Ga0157371_100140363 186
229 3300013104 Ga0157370_10054256 Ga0157370_100542562 186
230 3300013104 Ga0157370_10454253 Ga0157370_104542532 186
231 3300013104 Ga0157370_10495766 Ga0157370_104957661 186
232 3300013104 Ga0157370_10674537 Ga0157370_106745372 186
233 3300013104 Ga0157370_10703273 Ga0157370_107032731 186
234 3300013105 Ga0157369_10050214 Ga0157369_100502143 186
235 3300013105 Ga0157369_10151100 Ga0157369_101511003 186
236 3300013296 Ga0157374_10000135 Ga0157374_1000013526 186
237 3300013296 Ga0157374_10001901 Ga0157374_100019018 186
238 3300013296 Ga0157374_10036399 Ga0157374_100363993 186
239 3300013297 Ga0157378_10013175 Ga0157378_100131755 186
240 3300013307 Ga0157372_10000181 Ga0157372_1000018120 186
241 3300013307 Ga0157372_10017927 Ga0157372_100179275 186
242 3300013307 Ga0157372_10061899 Ga0157372_100618992 186
243 3300013307 Ga0157372_11123891 Ga0157372_111238912 186
244 3300013308 Ga0157375_10011045 Ga0157375_100110455 186
245 3300013308 Ga0157375_10789383 Ga0157375_107893832 186
246 3300014745 Ga0157377_10071739 Ga0157377_100717392 186
247 3300014969 Ga0157376_10785477 Ga0157376_107854772 186
248 3300017792 Ga0163161_10377622 Ga0163161_103776222 186
249 3300021361 Ga0213872_10015347 Ga0213872_100153474 186
250 3300025231 Ga0207427_108482 Ga0207427_1084822 186
251 3300025233 Ga0209437_100017 Ga0209437_100017522 186
252 3300025261 Ga0209233_1001460 Ga0209233_10014603 186
253 3300025904 Ga0207647_10000058 Ga0207647_1000005845 186
254 3300025904 Ga0207647_10006654 Ga0207647_100066546 186
255 3300025907 Ga0207645_10000957 Ga0207645_100009577 186
256 3300025909 Ga0207705_10000036 Ga0207705_1000003619 186
257 3300025911 Ga0207654_10006232 Ga0207654_100062322 186
258 3300025911 Ga0207654_10009271 Ga0207654_100092713 186
259 3300025913 Ga0207695_10007179 Ga0207695_100071792 186
260 3300025913 Ga0207695_10032160 Ga0207695_100321607 186
261 3300025913 Ga0207695_10280497 Ga0207695_102804971 186
262 3300025914 Ga0207671_10008839 Ga0207671_100088393 186
263 3300025914 Ga0207671_10011791 Ga0207671_100117912 186
264 3300025914 Ga0207671_10020439 Ga0207671_100204392 186
265 3300025919 Ga0207657_10133355 Ga0207657_101333552 186
266 3300025924 Ga0207694_10015828 Ga0207694_100158284 186
267 3300025931 Ga0207644_10014575 Ga0207644_100145752 186
268 3300025933 Ga0207706_10000317 Ga0207706_100003175 186
269 3300025933 Ga0207706_10060427 Ga0207706_100604272 186
270 3300025934 Ga0207686_10019615 Ga0207686_100196152 186
271 3300025938 Ga0207704_10000076 Ga0207704_1000007643 186
272 3300025940 Ga0207691_10525901 Ga0207691_105259011 186
273 3300025949 Ga0207667_10057102 Ga0207667_100571024 186
274 3300025949 Ga0207667_10335826 Ga0207667_103358262 186
275 3300025949 Ga0207667_11305892 Ga0207667_113058921 186
276 3300025960 Ga0207651_10286931 Ga0207651_102869312 186
277 3300026023 Ga0207677_10057708 Ga0207677_100577081 186
278 3300026041 Ga0207639_10012033 Ga0207639_100120332 186
279 3300026041 Ga0207639_10964640 Ga0207639_109646401 186
280 3300026089 Ga0207648_10000648 Ga0207648_1000064827 186
281 3300026121 Ga0207683_10009295 Ga0207683_100092952 186
282 3300026142 Ga0207698_10014707 Ga0207698_100147074 186
283 3300033180 Ga0307510_10010559 Ga0307510_100105596 186
284 3300037418 Ga0395900_0000181 Ga0395900_0000181_5716_6288 186
285 3300039447 Ga0436361_0458961 Ga0436361_0458961_7329_7895 186
286 3300046513 Ga0495616_0024718 Ga0495616_0024718_1021_1590 186
287 3300046518 Ga0495631_0001100 Ga0495631_0001100_466_1032 186
288 3300046660 Ga0495625_0009020 Ga0495625_0009020_6773_7342 186
289 3300046660 Ga0495625_0062356 Ga0495625_0062356_1770_2339 186
290 3300047443 Ga0495687_002794 Ga0495687_002794_5389_5955 186
291 3300047443 Ga0495687_092176 Ga0495687_092176_434_1003 186
292 3300047472 Ga0495686_0001050 Ga0495686_0001050_25065_25634 186
293 3300047472 Ga0495686_0045045 Ga0495686_0045045_1989_2558 186
294 3300049460 Ga0495682_0095103 Ga0495682_0095103_278_844 186
295 3300053080 Ga0500635_0000615 Ga0500635_0000615_4145_4714 186
296 3300053122 Ga0500608_000174 Ga0500608_000174_15882_16448 186
297 3300053157 Ga0500624_000854 Ga0500624_000854_4985_5587 186
298 2162886012 MBSR1b_contig_4602050 MBSR1b_0675.00001140 187
299 3300005293 Ga0065715_10089794 Ga0065715_100897943 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

27

104

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5szu-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9764 15 154
4ien-assembly1.cif.gz_A crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 0.9732 15 154
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.969 15 154
2qq2-assembly2.cif.gz_J crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9665 10 150
2qq2-assembly1.cif.gz_E crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9631 8 150
ID Description Score Start End Superfamily
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9732 15 154 3.10.129.10
af_F1R1X8_276_424_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9535 6 152 3.10.129.10
2q2bB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9505 10 150 3.10.129.10
4mobA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9499 16 154 3.10.129.10
4mocA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9434 14 132 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2N2EEE8-F1-model_v4 Acyl-CoA thioesterase 0.9837 8 154 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A2V7MKA0-F1-model_v4 Acyl-CoA thioesterase 0.9834 8 134 GO:0005829
GO:0006637
GO:0052816
AF-A0A1Q7RLD8-F1-model_v4 deleted 0.9825 8 151
AF-A0A0N7GY75-F1-model_v4 Acyl-CoA thioester hydrolase 0.9818 15 154 GO:0005829
GO:0006637
GO:0052816
AF-A0A081PFX4-F1-model_v4 Thioesterase 0.9816 6 160 GO:0005829
GO:0006637
GO:0052816

Feature Viewer

pLDDT pTM Quality
89.53 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map