F394852
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 202 | 272 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10930958|Ga0157380_109309581 |
| Length | 212 |
| Sequence | MTESARPVTASQTTITELMIPSYANFGGKIHGGILLSLMDKVAYACASKHAGAYCVTVSVDRVEFMQPVEVGELVSLHASVNYVGRSSMIVGIRVEAQQVKTGTIRHTNSCYFTMVAKDDDDKPAEVPKLILHTPEEVKRFIEAMRMKEIRIKVREQLDDAKSQIEVSHAAPRRVFLTTQLCDVGCISPVSFAQSLCERCPMETGGTAMRTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 4 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 5 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 6 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 7 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 8 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 9 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 10 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 11 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 12 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 13 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 14 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 15 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 16 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 17 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 18 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 19 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 20 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 21 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 22 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 23 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 24 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 25 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 26 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 27 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 28 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 29 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 30 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 31 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 32 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 33 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 92 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 126 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 129 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 130 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 137 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 142 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 144 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 147 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 157 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 158 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 173 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 174 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 175 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 176 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 177 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 178 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 179 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 181 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 182 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 187 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 188 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 189 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 190 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 191 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 192 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 193 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 195 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 196 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 197 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 198 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 199 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 200 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 201 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 202 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.97 |
| Metatranscriptomes | 0 |
| Isolates | 9.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.7 |
| Nodule | 1 |
| Rhizoplane | 0.67 |
| Rhizosphere | 75.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4602050 | 2162886012 | Bacteria | 1557 |
| 2 | 2214631065 | 2209111006 | Bacteria | 1101 |
| 3 | JGI24736J21556_1020903 | 3300001904 | Bacteria | 1027 |
| 4 | JGI24737J22298_10018666 | 3300001990 | Bacteria | 2224 |
| 5 | JGI25162J39368_1000121 | 3300002737 | Bacteria | 85899 |
| 6 | rootH1_10006069 | 3300003316 | Bacteria | 6073 |
| 7 | rootH1_10132912 | 3300003316 | Bacteria | 4239 |
| 8 | rootH1_10168076 | 3300003316 | Bacteria | 1914 |
| 9 | rootH2_10031646 | 3300003320 | Bacteria | 23569 |
| 10 | rootH2_10246397 | 3300003320 | Bacteria | 2805 |
| 11 | rootL2_10027925 | 3300003322 | Bacteria | 2513 |
| 12 | rootL2_10075349 | 3300003322 | Bacteria | 21885 |
| 13 | rootH1_10027193 | 3300003323 | Bacteria | 2635 |
| 14 | rootH1_10062951 | 3300003323 | Bacteria | 8844 |
| 15 | Ga0055536_1004087 | 3300003781 | Bacteria | 7588 |
| 16 | Ga0055531_10000148 | 3300003794 | Bacteria | 80963 |
| 17 | Ga0065165_1000131 | 3300005262 | Bacteria | 128880 |
| 18 | Ga0065714_10003028 | 3300005288 | Bacteria | 8948 |
| 19 | Ga0065714_10069240 | 3300005288 | Bacteria | 4323 |
| 20 | Ga0065715_10089794 | 3300005293 | Bacteria | 8498 |
| 21 | Ga0070658_10000018 | 3300005327 | Bacteria | 200558 |
| 22 | Ga0070680_100490909 | 3300005336 | Bacteria | 1050 |
| 23 | Ga0068868_100012170 | 3300005338 | Bacteria | 6284 |
| 24 | Ga0070660_100082603 | 3300005339 | Unclassified | 2523 |
| 25 | Ga0070660_100109650 | 3300005339 | Bacteria | 2195 |
| 26 | Ga0070691_10074448 | 3300005341 | Bacteria | 1652 |
| 27 | Ga0070687_100344757 | 3300005343 | Bacteria | 959 |
| 28 | Ga0070669_100839365 | 3300005353 | Bacteria | 782 |
| 29 | Ga0070673_100003122 | 3300005364 | Bacteria | 10259 |
| 30 | Ga0070673_100177806 | 3300005364 | Unclassified | 1820 |
| 31 | Ga0070663_100364007 | 3300005455 | Unclassified | 1174 |
| 32 | Ga0070678_100012887 | 3300005456 | Bacteria | 5218 |
| 33 | Ga0070662_100000081 | 3300005457 | Bacteria | 53265 |
| 34 | Ga0070662_100041245 | 3300005457 | Bacteria | 3292 |
| 35 | Ga0068867_100008949 | 3300005459 | Bacteria | 7065 |
| 36 | Ga0070679_100020219 | 3300005530 | Bacteria | 6490 |
| 37 | Ga0068853_100016443 | 3300005539 | Bacteria | 6088 |
| 38 | Ga0068853_100046226 | 3300005539 | Bacteria | 3731 |
| 39 | Ga0068853_100668675 | 3300005539 | Bacteria | 989 |
| 40 | Ga0070672_100564234 | 3300005543 | Unclassified | 989 |
| 41 | Ga0068855_100028946 | 3300005563 | Bacteria | 6627 |
| 42 | Ga0068855_100576877 | 3300005563 | Bacteria | 1215 |
| 43 | Ga0068855_100626795 | 3300005563 | Unclassified | 1157 |
| 44 | Ga0068855_100655167 | 3300005563 | Bacteria | 1127 |
| 45 | Ga0068855_100655823 | 3300005563 | Bacteria | 1126 |
| 46 | Ga0068857_100446787 | 3300005577 | Bacteria | 1208 |
| 47 | Ga0068856_100047978 | 3300005614 | Bacteria | 4207 |
| 48 | Ga0068856_100206260 | 3300005614 | Unclassified | 1980 |
| 49 | Ga0068852_100002760 | 3300005616 | Bacteria | 12169 |
| 50 | Ga0068864_100178079 | 3300005618 | Unclassified | 1942 |
| 51 | Ga0068864_100435703 | 3300005618 | Bacteria | 1251 |
| 52 | Ga0068858_100258361 | 3300005842 | Unclassified | 1655 |
| 53 | Ga0097621_100000039 | 3300006237 | Bacteria | 67231 |
| 54 | Ga0097621_100197857 | 3300006237 | Unclassified | 1743 |
| 55 | Ga0068871_100000857 | 3300006358 | Bacteria | 20286 |
| 56 | Ga0075428_100010944 | 3300006844 | Bacteria | 10087 |
| 57 | Ga0068865_100002192 | 3300006881 | Bacteria | 11508 |
| 58 | Ga0099824_1001951 | 3300006942 | Bacteria | 29917 |
| 59 | Ga0105244_10000163 | 3300009036 | Bacteria | 68575 |
| 60 | Ga0105240_10036632 | 3300009093 | Bacteria | 6308 |
| 61 | Ga0105240_10043072 | 3300009093 | Bacteria | 5747 |
| 62 | Ga0105240_10221601 | 3300009093 | Bacteria | 2203 |
| 63 | Ga0105240_10373641 | 3300009093 | Bacteria | 1611 |
| 64 | Ga0111539_10003202 | 3300009094 | Bacteria | 21659 |
| 65 | Ga0105243_10032488 | 3300009148 | Bacteria | 4033 |
| 66 | Ga0105241_10001088 | 3300009174 | Bacteria | 20688 |
| 67 | Ga0105241_10002132 | 3300009174 | Bacteria | 14966 |
| 68 | Ga0105241_11139527 | 3300009174 | Unclassified | 736 |
| 69 | Ga0105242_10025126 | 3300009176 | Bacteria | 4710 |
| 70 | Ga0105237_10004703 | 3300009545 | Bacteria | 15711 |
| 71 | Ga0105237_10026943 | 3300009545 | Bacteria | 5871 |
| 72 | Ga0105237_10037819 | 3300009545 | Bacteria | 4876 |
| 73 | Ga0105238_10009249 | 3300009551 | Bacteria | 9862 |
| 74 | Ga0105249_10953745 | 3300009553 | Bacteria | 926 |
| 75 | Ga0105239_10000132 | 3300010375 | Bacteria | 105380 |
| 76 | Ga0105239_10000139 | 3300010375 | Bacteria | 102090 |
| 77 | Ga0105239_10006154 | 3300010375 | Bacteria | 13964 |
| 78 | Ga0105239_10099796 | 3300010375 | Bacteria | 3210 |
| 79 | Ga0105239_10745117 | 3300010375 | Unclassified | 1121 |
| 80 | Ga0105246_10054914 | 3300011119 | Bacteria | 2747 |
| 81 | Ga0157327_1041322 | 3300012512 | Bacteria | 621 |
| 82 | Ga0157373_10000007 | 3300013100 | Bacteria | 216734 |
| 83 | Ga0157373_10001984 | 3300013100 | Bacteria | 15508 |
| 84 | Ga0157373_10064739 | 3300013100 | Unclassified | 2588 |
| 85 | Ga0157371_10000251 | 3300013102 | Bacteria | 74986 |
| 86 | Ga0157371_10004516 | 3300013102 | Bacteria | 12125 |
| 87 | Ga0157371_10014036 | 3300013102 | Bacteria | 6062 |
| 88 | Ga0157370_10000134 | 3300013104 | Bacteria | 89337 |
| 89 | Ga0157370_10002078 | 3300013104 | Bacteria | 24515 |
| 90 | Ga0157370_10011954 | 3300013104 | Bacteria | 9048 |
| 91 | Ga0157370_10054256 | 3300013104 | Bacteria | 3820 |
| 92 | Ga0157370_10138128 | 3300013104 | Bacteria | 2271 |
| 93 | Ga0157370_10382703 | 3300013104 | Bacteria | 1296 |
| 94 | Ga0157370_10454253 | 3300013104 | Bacteria | 1178 |
| 95 | Ga0157370_10495766 | 3300013104 | Bacteria | 1122 |
| 96 | Ga0157370_10674537 | 3300013104 | Bacteria | 944 |
| 97 | Ga0157370_10703273 | 3300013104 | Unclassified | 922 |
| 98 | Ga0157369_10022177 | 3300013105 | Bacteria | 7093 |
| 99 | Ga0157369_10050214 | 3300013105 | Bacteria | 4519 |
| 100 | Ga0157369_10151100 | 3300013105 | Bacteria | 2454 |
| 101 | Ga0157374_10000135 | 3300013296 | Bacteria | 67340 |
| 102 | Ga0157374_10001901 | 3300013296 | Bacteria | 17499 |
| 103 | Ga0157374_10036399 | 3300013296 | Bacteria | 4508 |
| 104 | Ga0157374_10364944 | 3300013296 | Bacteria | 1437 |
| 105 | Ga0157378_10013175 | 3300013297 | Bacteria | 7234 |
| 106 | Ga0157372_10000181 | 3300013307 | Bacteria | 69472 |
| 107 | Ga0157372_10017927 | 3300013307 | Bacteria | 7609 |
| 108 | Ga0157372_10061899 | 3300013307 | Bacteria | 4192 |
| 109 | Ga0157372_11123891 | 3300013307 | Unclassified | 909 |
| 110 | Ga0157375_10011045 | 3300013308 | Bacteria | 7963 |
| 111 | Ga0157375_10105663 | 3300013308 | Bacteria | 2906 |
| 112 | Ga0157375_10789383 | 3300013308 | Bacteria | 1099 |
| 113 | Ga0157375_12362625 | 3300013308 | Unclassified | 634 |
| 114 | Ga0157380_10012415 | 3300014326 | Bacteria | 6181 |
| 115 | Ga0157380_10930958 | 3300014326 | Bacteria | 897 |
| 116 | Ga0157377_10071739 | 3300014745 | Unclassified | 2003 |
| 117 | Ga0157376_10785477 | 3300014969 | Bacteria | 964 |
| 118 | Ga0182006_1000410 | 3300015261 | Bacteria | 34736 |
| 119 | Ga0182007_10151442 | 3300015262 | Bacteria | 789 |
| 120 | Ga0163161_10000134 | 3300017792 | Bacteria | 69955 |
| 121 | Ga0163161_10377622 | 3300017792 | Bacteria | 1132 |
| 122 | Ga0213872_10015347 | 3300021361 | Bacteria | 3564 |
| 123 | Ga0207427_108482 | 3300025231 | Bacteria | 1143 |
| 124 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 125 | Ga0209233_1001460 | 3300025261 | Bacteria | 9332 |
| 126 | Ga0209676_1001085 | 3300025292 | Bacteria | 30593 |
| 127 | Ga0209050_1001591 | 3300025298 | Bacteria | 23468 |
| 128 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 129 | Ga0207655_1000131 | 3300025728 | Bacteria | 148173 |
| 130 | Ga0207647_10000058 | 3300025904 | Bacteria | 84631 |
| 131 | Ga0207647_10006654 | 3300025904 | Bacteria | 8399 |
| 132 | Ga0207645_10000957 | 3300025907 | Bacteria | 23915 |
| 133 | Ga0207705_10000036 | 3300025909 | Bacteria | 200787 |
| 134 | Ga0207654_10006232 | 3300025911 | Bacteria | 5994 |
| 135 | Ga0207654_10009271 | 3300025911 | Bacteria | 4995 |
| 136 | Ga0207695_10007179 | 3300025913 | Bacteria | 14247 |
| 137 | Ga0207695_10032160 | 3300025913 | Bacteria | 5744 |
| 138 | Ga0207695_10280497 | 3300025913 | Bacteria | 1560 |
| 139 | Ga0207671_10008839 | 3300025914 | Bacteria | 8484 |
| 140 | Ga0207671_10011791 | 3300025914 | Bacteria | 7076 |
| 141 | Ga0207671_10020439 | 3300025914 | Bacteria | 5039 |
| 142 | Ga0207662_10405350 | 3300025918 | Bacteria | 925 |
| 143 | Ga0207657_10133355 | 3300025919 | Bacteria | 2034 |
| 144 | Ga0207652_10017559 | 3300025921 | Bacteria | 5857 |
| 145 | Ga0207694_10015828 | 3300025924 | Bacteria | 5690 |
| 146 | Ga0207644_10014575 | 3300025931 | Bacteria | 5262 |
| 147 | Ga0207706_10000317 | 3300025933 | Bacteria | 52169 |
| 148 | Ga0207706_10060427 | 3300025933 | Bacteria | 3337 |
| 149 | Ga0207686_10019615 | 3300025934 | Bacteria | 3850 |
| 150 | Ga0207709_10161970 | 3300025935 | Bacteria | 1561 |
| 151 | Ga0207704_10000076 | 3300025938 | Bacteria | 61793 |
| 152 | Ga0207691_10525901 | 3300025940 | Unclassified | 1004 |
| 153 | Ga0207667_10057102 | 3300025949 | Bacteria | 4099 |
| 154 | Ga0207667_10335826 | 3300025949 | Bacteria | 1543 |
| 155 | Ga0207667_11305892 | 3300025949 | Unclassified | 702 |
| 156 | Ga0207651_10286931 | 3300025960 | Unclassified | 1363 |
| 157 | Ga0207677_10057708 | 3300026023 | Bacteria | 2668 |
| 158 | Ga0207639_10012033 | 3300026041 | Bacteria | 6020 |
| 159 | Ga0207639_10964640 | 3300026041 | Bacteria | 798 |
| 160 | Ga0207702_10034122 | 3300026078 | Bacteria | 4253 |
| 161 | Ga0207702_10214732 | 3300026078 | Unclassified | 1790 |
| 162 | Ga0207648_10000648 | 3300026089 | Bacteria | 39101 |
| 163 | Ga0207676_10192602 | 3300026095 | Bacteria | 1795 |
| 164 | Ga0207674_10467372 | 3300026116 | Bacteria | 1219 |
| 165 | Ga0207674_10763959 | 3300026116 | Bacteria | 933 |
| 166 | Ga0207683_10009295 | 3300026121 | Bacteria | 8375 |
| 167 | Ga0207698_10014707 | 3300026142 | Bacteria | 5213 |
| 168 | Ga0209281_1000388 | 3300027111 | Bacteria | 69493 |
| 169 | Ga0209489_104877 | 3300027361 | Bacteria | 24119 |
| 170 | Ga0307515_10000872 | 3300028794 | Bacteria | 69248 |
| 171 | Ga0307515_10266603 | 3300028794 | Bacteria | 1440 |
| 172 | Ga0307515_10568341 | 3300028794 | Bacteria | 744 |
| 173 | Ga0307509_10052222 | 3300031507 | Unclassified | 4365 |
| 174 | Ga0307514_10139173 | 3300031649 | Unclassified | 1654 |
| 175 | Ga0316576_10213254 | 3300031727 | Bacteria | 1453 |
| 176 | Ga0307410_10086452 | 3300031852 | Bacteria | 2215 |
| 177 | Ga0307407_10247703 | 3300031903 | Bacteria | 1219 |
| 178 | Ga0307412_10563487 | 3300031911 | Bacteria | 959 |
| 179 | Ga0307412_11247566 | 3300031911 | Unclassified | 667 |
| 180 | Ga0307416_100003851 | 3300032002 | Bacteria | 8927 |
| 181 | Ga0307416_100110847 | 3300032002 | Bacteria | 2417 |
| 182 | Ga0307414_10154297 | 3300032004 | Bacteria | 1815 |
| 183 | Ga0307414_10596621 | 3300032004 | Bacteria | 990 |
| 184 | Ga0307414_10751690 | 3300032004 | Bacteria | 886 |
| 185 | Ga0307414_10765233 | 3300032004 | Bacteria | 879 |
| 186 | Ga0307414_10923842 | 3300032004 | Bacteria | 801 |
| 187 | Ga0307510_10010559 | 3300033180 | Bacteria | 10972 |
| 188 | Ga0307510_10071106 | 3300033180 | Bacteria | 3468 |
| 189 | Ga0373941_0035470 | 3300035115 | Bacteria | 1511 |
| 190 | Ga0373935_0306471 | 3300035692 | Bacteria | 1124 |
| 191 | Ga0395900_0000181 | 3300037418 | Bacteria | 101531 |
| 192 | Ga0395901_0001313 | 3300038443 | Bacteria | 26228 |
| 193 | Ga0436361_0458961 | 3300039447 | Bacteria | 22334 |
| 194 | Ga0451802_0330236 | 3300041460 | Bacteria | 739 |
| 195 | Ga0451802_0696731 | 3300041460 | Bacteria | 864 |
| 196 | Ga0451851_0581581 | 3300041507 | Bacteria | 1425 |
| 197 | Ga0439434_0230648 | 3300042435 | Unclassified | 630 |
| 198 | Ga0451577_0957088 | 3300042876 | Bacteria | 770 |
| 199 | Ga0466964_0119304 | 3300044706 | Bacteria | 1187 |
| 200 | Ga0453684_0061136 | 3300044712 | Bacteria | 4838 |
| 201 | Ga0453684_1003984 | 3300044712 | Unclassified | 887 |
| 202 | Ga0451576_0017811 | 3300045051 | Bacteria | 7803 |
| 203 | Ga0451576_0092444 | 3300045051 | Bacteria | 3147 |
| 204 | Ga0451576_0170080 | 3300045051 | Unclassified | 2274 |
| 205 | Ga0495638_0000013 | 3300046460 | Bacteria | 430133 |
| 206 | Ga0495616_0024718 | 3300046513 | Bacteria | 3218 |
| 207 | Ga0495631_0001100 | 3300046518 | Bacteria | 16760 |
| 208 | Ga0495625_0009020 | 3300046660 | Bacteria | 8424 |
| 209 | Ga0495625_0062356 | 3300046660 | Bacteria | 2635 |
| 210 | Ga0495625_0078653 | 3300046660 | Bacteria | 2302 |
| 211 | Ga0495671_0069472 | 3300046692 | Bacteria | 1731 |
| 212 | Ga0495687_002794 | 3300047443 | Bacteria | 13475 |
| 213 | Ga0495687_092176 | 3300047443 | Bacteria | 1157 |
| 214 | Ga0495686_0001050 | 3300047472 | Bacteria | 33105 |
| 215 | Ga0495686_0045045 | 3300047472 | Bacteria | 2792 |
| 216 | Ga0496121_0012350 | 3300048924 | Bacteria | 9337 |
| 217 | Ga0496121_0025129 | 3300048924 | Bacteria | 5667 |
| 218 | Ga0496124_0006718 | 3300048927 | Bacteria | 12447 |
| 219 | Ga0496124_0094657 | 3300048927 | Bacteria | 2429 |
| 220 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 221 | Ga0496126_0021502 | 3300048929 | Bacteria | 6301 |
| 222 | Ga0495682_0095103 | 3300049460 | Unclassified | 1070 |
| 223 | Ga0501296_027011 | 3300049519 | Unclassified | 758 |
| 224 | Ga0501032_0046382 | 3300049569 | Bacteria | 2937 |
| 225 | Ga0501033_0000004 | 3300049570 | Bacteria | 441310 |
| 226 | Ga0501034_0000359 | 3300049571 | Bacteria | 77578 |
| 227 | Ga0501036_0011088 | 3300049572 | Bacteria | 7455 |
| 228 | Ga0501037_0024702 | 3300049573 | Bacteria | 4443 |
| 229 | Ga0501038_0002748 | 3300049574 | Bacteria | 16402 |
| 230 | Ga0501039_0007537 | 3300049575 | Bacteria | 8315 |
| 231 | Ga0501043_0003612 | 3300049579 | Bacteria | 12706 |
| 232 | Ga0501048_0325415 | 3300049582 | Unclassified | 1095 |
| 233 | Ga0501069_0130077 | 3300049585 | Bacteria | 1441 |
| 234 | Ga0501217_000416 | 3300049661 | Bacteria | 6903 |
| 235 | Ga0501222_009937 | 3300049662 | Bacteria | 1257 |
| 236 | Ga0501247_000176 | 3300049677 | Bacteria | 4035 |
| 237 | Ga0501249_000020 | 3300049679 | Bacteria | 98438 |
| 238 | Ga0501253_088111 | 3300049683 | Unclassified | 710 |
| 239 | Ga0501257_000589 | 3300049686 | Bacteria | 7184 |
| 240 | Ga0501257_004192 | 3300049686 | Unclassified | 3135 |
| 241 | Ga0501259_001221 | 3300049688 | Bacteria | 4275 |
| 242 | Ga0501225_0019602 | 3300049705 | Bacteria | 1872 |
| 243 | Ga0501271_005679 | 3300049768 | Bacteria | 1222 |
| 244 | Ga0501271_018674 | 3300049768 | Bacteria | 793 |
| 245 | Ga0501279_045311 | 3300049775 | Bacteria | 685 |
| 246 | Ga0501035_0002299 | 3300049822 | Bacteria | 18858 |
| 247 | Ga0501044_0044680 | 3300049823 | Bacteria | 4595 |
| 248 | Ga0501045_0000290 | 3300049824 | Bacteria | 29331 |
| 249 | nmdc:mga08y16_11789_c1 | 3300050511 | Bacteria | 9185 |
| 250 | nmdc:mga08y16_69925_c1 | 3300050511 | Bacteria | 3659 |
| 251 | Ga0500635_0000615 | 3300053080 | Bacteria | 9293 |
| 252 | Ga0500635_0004168 | 3300053080 | Bacteria | 3705 |
| 253 | Ga0500646_0002854 | 3300053090 | Bacteria | 4435 |
| 254 | Ga0500646_0130049 | 3300053090 | Unclassified | 818 |
| 255 | Ga0500641_0000010 | 3300053096 | Bacteria | 171383 |
| 256 | Ga0500641_0001589 | 3300053096 | Bacteria | 8083 |
| 257 | Ga0500557_018415 | 3300053105 | Bacteria | 1948 |
| 258 | Ga0500562_000018 | 3300053108 | Bacteria | 126890 |
| 259 | Ga0500594_0020641 | 3300053118 | Bacteria | 1645 |
| 260 | Ga0500608_000174 | 3300053122 | Bacteria | 26422 |
| 261 | Ga0500568_0153242 | 3300053139 | Bacteria | 852 |
| 262 | Ga0500616_0000013 | 3300053153 | Bacteria | 674172 |
| 263 | Ga0500616_0044317 | 3300053153 | Bacteria | 2374 |
| 264 | Ga0500616_0056191 | 3300053153 | Bacteria | 2055 |
| 265 | Ga0500616_0286959 | 3300053153 | Unclassified | 688 |
| 266 | Ga0500622_0000041 | 3300053156 | Bacteria | 170067 |
| 267 | Ga0500622_0000045 | 3300053156 | Bacteria | 158316 |
| 268 | Ga0500622_0000114 | 3300053156 | Bacteria | 83162 |
| 269 | Ga0500624_000854 | 3300053157 | Bacteria | 6736 |
| 270 | Ga0500584_160072 | 3300053726 | Bacteria | 824 |
| 271 | Ga0500587_013943 | 3300053739 | Bacteria | 1018 |
| 272 | Ga0500661_001810 | 3300055283 | Bacteria | 4032 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10138128 | Ga0157370_101381282 | 164 |
| 2 | 3300013104 | Ga0157370_10382703 | Ga0157370_103827033 | 164 |
| 3 | 3300049519 | Ga0501296_027011 | Ga0501296_027011_53_586 | 169 |
| 4 | 3300005343 | Ga0070687_100344757 | Ga0070687_1003447571 | 172 |
| 5 | 3300025918 | Ga0207662_10405350 | Ga0207662_104053502 | 172 |
| 6 | iso_pu_bacteria | 2513020052 | 2513235690 | 176 |
| 7 | iso_pu_bacteria | 2519899754 | 2520879897 | 176 |
| 8 | iso_pu_bacteria | 2522125168 | 2522549486 | 176 |
| 9 | iso_pu_bacteria | 2643221600 | 2644009568 | 176 |
| 10 | iso_pu_bacteria | 2643221667 | 2644371917 | 176 |
| 11 | iso_pu_bacteria | 2643221716 | 2644643627 | 176 |
| 12 | iso_pu_bacteria | 2643221725 | 2644684621 | 176 |
| 13 | iso_pu_bacteria | 2738541279 | 2738732745 | 176 |
| 14 | iso_pu_bacteria | 2738541285 | 2738765283 | 176 |
| 15 | iso_pu_bacteria | 2738543007 | 2739214326 | 176 |
| 16 | iso_pu_bacteria | 2802428842 | 2802654858 | 176 |
| 17 | iso_pu_bacteria | 2816332280 | 2817413232 | 176 |
| 18 | iso_pu_bacteria | 2881359912 | 2881361827 | 176 |
| 19 | iso_pu_bacteria | 2903895155 | 2903898963 | 176 |
| 20 | iso_pu_bacteria | 2919191525 | 2919196452 | 176 |
| 21 | iso_pu_bacteria | 2958458903 | 2958462166 | 176 |
| 22 | iso_pu_bacteria | 2977268062 | 2977271762 | 176 |
| 23 | iso_pu_bacteria | 8054307821 | 8054309812 | 176 |
| 24 | iso_pu_bacteria | 8055419101 | 8055423263 | 176 |
| 25 | iso_pu_bacteria | 8055592153 | 8055595382 | 176 |
| 26 | iso_pu_bacteria | 2977232053 | 2977236212 | 177 |
| 27 | iso_pu_bacteria | 2738543023 | 2739305221 | 178 |
| 28 | iso_pu_bacteria | 2839989709 | 2839990554 | 179 |
| 29 | 2209111006 | 2214631065 | 2213661923 | 180 |
| 30 | 3300003316 | rootH1_10168076 | rootH1_101680761 | 180 |
| 31 | 3300003781 | Ga0055536_1004087 | Ga0055536_10040872 | 180 |
| 32 | 3300003794 | Ga0055531_10000148 | Ga0055531_1000014810 | 180 |
| 33 | 3300005262 | Ga0065165_1000131 | Ga0065165_1000131112 | 180 |
| 34 | 3300005288 | Ga0065714_10069240 | Ga0065714_100692406 | 180 |
| 35 | 3300005618 | Ga0068864_100178079 | Ga0068864_1001780792 | 180 |
| 36 | 3300006942 | Ga0099824_1001951 | Ga0099824_100195126 | 180 |
| 37 | 3300009036 | Ga0105244_10000163 | Ga0105244_1000016347 | 180 |
| 38 | 3300012512 | Ga0157327_1041322 | Ga0157327_10413221 | 180 |
| 39 | 3300013100 | Ga0157373_10000007 | Ga0157373_10000007170 | 180 |
| 40 | 3300013104 | Ga0157370_10000134 | Ga0157370_1000013431 | 180 |
| 41 | 3300013104 | Ga0157370_10002078 | Ga0157370_1000207810 | 180 |
| 42 | 3300013308 | Ga0157375_10105663 | Ga0157375_101056633 | 180 |
| 43 | 3300014326 | Ga0157380_10012415 | Ga0157380_100124154 | 180 |
| 44 | 3300015261 | Ga0182006_1000410 | Ga0182006_100041021 | 180 |
| 45 | 3300017792 | Ga0163161_10000134 | Ga0163161_1000013422 | 180 |
| 46 | 3300025292 | Ga0209676_1001085 | Ga0209676_10010856 | 180 |
| 47 | 3300025304 | Ga0209257_1000006 | Ga0209257_10000061283 | 180 |
| 48 | 3300025728 | Ga0207655_1000131 | Ga0207655_100013198 | 180 |
| 49 | 3300026095 | Ga0207676_10192602 | Ga0207676_101926022 | 180 |
| 50 | 3300026116 | Ga0207674_10763959 | Ga0207674_107639592 | 180 |
| 51 | 3300027361 | Ga0209489_104877 | Ga0209489_10487726 | 180 |
| 52 | 3300028794 | Ga0307515_10568341 | Ga0307515_105683412 | 180 |
| 53 | 3300031507 | Ga0307509_10052222 | Ga0307509_100522222 | 180 |
| 54 | 3300031911 | Ga0307412_11247566 | Ga0307412_112475661 | 180 |
| 55 | 3300032002 | Ga0307416_100003851 | Ga0307416_1000038513 | 180 |
| 56 | 3300032004 | Ga0307414_10154297 | Ga0307414_101542972 | 180 |
| 57 | 3300032004 | Ga0307414_10765233 | Ga0307414_107652332 | 180 |
| 58 | 3300033180 | Ga0307510_10071106 | Ga0307510_100711063 | 180 |
| 59 | 3300041460 | Ga0451802_0696731 | Ga0451802_0696731_62_613 | 180 |
| 60 | 3300042435 | Ga0439434_0230648 | Ga0439434_0230648_30_581 | 180 |
| 61 | 3300046660 | Ga0495625_0078653 | Ga0495625_0078653_57_605 | 180 |
| 62 | 3300046692 | Ga0495671_0069472 | Ga0495671_0069472_1118_1666 | 180 |
| 63 | 3300048924 | Ga0496121_0012350 | Ga0496121_0012350_3797_4345 | 180 |
| 64 | 3300048927 | Ga0496124_0094657 | Ga0496124_0094657_1128_1676 | 180 |
| 65 | 3300049585 | Ga0501069_0130077 | Ga0501069_0130077_378_929 | 180 |
| 66 | 3300049679 | Ga0501249_000020 | Ga0501249_000020_46103_46651 | 180 |
| 67 | 3300049705 | Ga0501225_0019602 | Ga0501225_0019602_201_758 | 180 |
| 68 | 3300050511 | nmdc:mga08y16_69925_c1 | nmdc:mga08y16_69925_c1_2752_3303 | 180 |
| 69 | 3300053090 | Ga0500646_0002854 | Ga0500646_0002854_3827_4375 | 180 |
| 70 | 3300053090 | Ga0500646_0130049 | Ga0500646_0130049_165_713 | 180 |
| 71 | 3300053096 | Ga0500641_0000010 | Ga0500641_0000010_18868_19416 | 180 |
| 72 | 3300053096 | Ga0500641_0001589 | Ga0500641_0001589_2875_3423 | 180 |
| 73 | 3300053118 | Ga0500594_0020641 | Ga0500594_0020641_292_840 | 180 |
| 74 | 3300053153 | Ga0500616_0044317 | Ga0500616_0044317_1004_1552 | 180 |
| 75 | 3300053156 | Ga0500622_0000041 | Ga0500622_0000041_22734_23282 | 180 |
| 76 | 3300053156 | Ga0500622_0000045 | Ga0500622_0000045_141255_141803 | 180 |
| 77 | 3300053726 | Ga0500584_160072 | Ga0500584_160072_103_651 | 180 |
| 78 | 3300053739 | Ga0500587_013943 | Ga0500587_013943_72_620 | 180 |
| 79 | 3300003316 | rootH1_10006069 | rootH1_100060693 | 181 |
| 80 | 3300003320 | rootH2_10031646 | rootH2_100316469 | 181 |
| 81 | 3300003322 | rootL2_10027925 | rootL2_100279253 | 181 |
| 82 | 3300015262 | Ga0182007_10151442 | Ga0182007_101514422 | 181 |
| 83 | 3300044706 | Ga0466964_0119304 | Ga0466964_0119304_156_707 | 181 |
| 84 | 3300049661 | Ga0501217_000416 | Ga0501217_000416_4250_4801 | 181 |
| 85 | 3300049677 | Ga0501247_000176 | Ga0501247_000176_46_597 | 181 |
| 86 | 3300049683 | Ga0501253_088111 | Ga0501253_088111_114_671 | 181 |
| 87 | 3300049686 | Ga0501257_000589 | Ga0501257_000589_5097_5654 | 181 |
| 88 | 3300049768 | Ga0501271_018674 | Ga0501271_018674_93_644 | 181 |
| 89 | 3300053108 | Ga0500562_000018 | Ga0500562_000018_68429_68989 | 181 |
| 90 | 3300053153 | Ga0500616_0286959 | Ga0500616_0286959_92_652 | 181 |
| 91 | 3300053156 | Ga0500622_0000114 | Ga0500622_0000114_16579_17142 | 181 |
| 92 | 3300055283 | Ga0500661_001810 | Ga0500661_001810_1163_1723 | 181 |
| 93 | 3300003322 | rootL2_10075349 | rootL2_100753499 | 182 |
| 94 | 3300003323 | rootH1_10027193 | rootH1_100271931 | 182 |
| 95 | 3300003323 | rootH1_10062951 | rootH1_100629514 | 182 |
| 96 | 3300005455 | Ga0070663_100364007 | Ga0070663_1003640072 | 182 |
| 97 | 3300005577 | Ga0068857_100446787 | Ga0068857_1004467872 | 182 |
| 98 | 3300005614 | Ga0068856_100047978 | Ga0068856_1000479782 | 182 |
| 99 | 3300005614 | Ga0068856_100206260 | Ga0068856_1002062602 | 182 |
| 100 | 3300005618 | Ga0068864_100435703 | Ga0068864_1004357032 | 182 |
| 101 | 3300013308 | Ga0157375_12362625 | Ga0157375_123626251 | 182 |
| 102 | 3300025298 | Ga0209050_1001591 | Ga0209050_100159116 | 182 |
| 103 | 3300026078 | Ga0207702_10034122 | Ga0207702_100341223 | 182 |
| 104 | 3300026116 | Ga0207674_10467372 | Ga0207674_104673722 | 182 |
| 105 | 3300028794 | Ga0307515_10000872 | Ga0307515_1000087248 | 182 |
| 106 | 3300028794 | Ga0307515_10266603 | Ga0307515_102666032 | 182 |
| 107 | 3300031649 | Ga0307514_10139173 | Ga0307514_101391732 | 182 |
| 108 | 3300031727 | Ga0316576_10213254 | Ga0316576_102132543 | 182 |
| 109 | 3300031852 | Ga0307410_10086452 | Ga0307410_100864524 | 182 |
| 110 | 3300031903 | Ga0307407_10247703 | Ga0307407_102477032 | 182 |
| 111 | 3300031911 | Ga0307412_10563487 | Ga0307412_105634871 | 182 |
| 112 | 3300032002 | Ga0307416_100110847 | Ga0307416_1001108472 | 182 |
| 113 | 3300035692 | Ga0373935_0306471 | Ga0373935_0306471_526_1083 | 182 |
| 114 | 3300041460 | Ga0451802_0330236 | Ga0451802_0330236_84_641 | 182 |
| 115 | 3300041507 | Ga0451851_0581581 | Ga0451851_0581581_693_1250 | 182 |
| 116 | 3300042876 | Ga0451577_0957088 | Ga0451577_0957088_77_631 | 182 |
| 117 | 3300044712 | Ga0453684_1003984 | Ga0453684_1003984_174_734 | 182 |
| 118 | 3300045051 | Ga0451576_0017811 | Ga0451576_0017811_1637_2197 | 182 |
| 119 | 3300045051 | Ga0451576_0092444 | Ga0451576_0092444_414_968 | 182 |
| 120 | 3300045051 | Ga0451576_0170080 | Ga0451576_0170080_1633_2187 | 182 |
| 121 | 3300046460 | Ga0495638_0000013 | Ga0495638_0000013_206215_206778 | 182 |
| 122 | 3300049569 | Ga0501032_0046382 | Ga0501032_0046382_1791_2411 | 182 |
| 123 | 3300049570 | Ga0501033_0000004 | Ga0501033_0000004_360606_361226 | 182 |
| 124 | 3300049571 | Ga0501034_0000359 | Ga0501034_0000359_71265_71885 | 182 |
| 125 | 3300049572 | Ga0501036_0011088 | Ga0501036_0011088_6687_7307 | 182 |
| 126 | 3300049573 | Ga0501037_0024702 | Ga0501037_0024702_2274_2894 | 182 |
| 127 | 3300049574 | Ga0501038_0002748 | Ga0501038_0002748_12886_13506 | 182 |
| 128 | 3300049575 | Ga0501039_0007537 | Ga0501039_0007537_5982_6602 | 182 |
| 129 | 3300049579 | Ga0501043_0003612 | Ga0501043_0003612_5844_6464 | 182 |
| 130 | 3300049582 | Ga0501048_0325415 | Ga0501048_0325415_379_999 | 182 |
| 131 | 3300049662 | Ga0501222_009937 | Ga0501222_009937_255_809 | 182 |
| 132 | 3300049686 | Ga0501257_004192 | Ga0501257_004192_202_756 | 182 |
| 133 | 3300049688 | Ga0501259_001221 | Ga0501259_001221_1829_2383 | 182 |
| 134 | 3300049768 | Ga0501271_005679 | Ga0501271_005679_549_1103 | 182 |
| 135 | 3300049822 | Ga0501035_0002299 | Ga0501035_0002299_2780_3400 | 182 |
| 136 | 3300049823 | Ga0501044_0044680 | Ga0501044_0044680_3852_4472 | 182 |
| 137 | 3300049824 | Ga0501045_0000290 | Ga0501045_0000290_21479_22099 | 182 |
| 138 | 3300053105 | Ga0500557_018415 | Ga0500557_018415_291_854 | 182 |
| 139 | 3300053153 | Ga0500616_0000013 | Ga0500616_0000013_512200_512763 | 182 |
| 140 | 3300005336 | Ga0070680_100490909 | Ga0070680_1004909092 | 183 |
| 141 | 3300006844 | Ga0075428_100010944 | Ga0075428_1000109449 | 183 |
| 142 | 3300009094 | Ga0111539_10003202 | Ga0111539_1000320216 | 183 |
| 143 | 3300009148 | Ga0105243_10032488 | Ga0105243_100324882 | 183 |
| 144 | 3300013102 | Ga0157371_10004516 | Ga0157371_100045167 | 183 |
| 145 | 3300013104 | Ga0157370_10011954 | Ga0157370_100119546 | 183 |
| 146 | 3300013105 | Ga0157369_10022177 | Ga0157369_100221777 | 183 |
| 147 | 3300025935 | Ga0207709_10161970 | Ga0207709_101619703 | 183 |
| 148 | 3300026078 | Ga0207702_10214732 | Ga0207702_102147322 | 183 |
| 149 | 3300027111 | Ga0209281_1000388 | Ga0209281_10003882 | 183 |
| 150 | 3300032004 | Ga0307414_10596621 | Ga0307414_105966211 | 183 |
| 151 | 3300032004 | Ga0307414_10751690 | Ga0307414_107516901 | 183 |
| 152 | 3300032004 | Ga0307414_10923842 | Ga0307414_109238422 | 183 |
| 153 | 3300048924 | Ga0496121_0025129 | Ga0496121_0025129_5007_5600 | 183 |
| 154 | 3300048927 | Ga0496124_0006718 | Ga0496124_0006718_6127_6720 | 183 |
| 155 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_42753_43346 | 183 |
| 156 | 3300048929 | Ga0496126_0021502 | Ga0496126_0021502_2656_3249 | 183 |
| 157 | 3300049775 | Ga0501279_045311 | Ga0501279_045311_103_672 | 183 |
| 158 | 3300050511 | nmdc:mga08y16_11789_c1 | nmdc:mga08y16_11789_c1_6765_7328 | 183 |
| 159 | 3300053139 | Ga0500568_0153242 | Ga0500568_0153242_239_799 | 183 |
| 160 | 3300053153 | Ga0500616_0056191 | Ga0500616_0056191_692_1252 | 183 |
| 161 | 3300005353 | Ga0070669_100839365 | Ga0070669_1008393652 | 184 |
| 162 | 3300013296 | Ga0157374_10364944 | Ga0157374_103649442 | 184 |
| 163 | 3300014326 | Ga0157380_10930958 | Ga0157380_109309581 | 184 |
| 164 | iso_pu_bacteria | 2852627209 | 2852630959 | 184 |
| 165 | iso_pu_bacteria | 2919437846 | 2919438521 | 184 |
| 166 | 3300003316 | rootH1_10132912 | rootH1_101329123 | 185 |
| 167 | 3300003320 | rootH2_10246397 | rootH2_102463972 | 185 |
| 168 | 3300005530 | Ga0070679_100020219 | Ga0070679_1000202194 | 185 |
| 169 | 3300025921 | Ga0207652_10017559 | Ga0207652_100175595 | 185 |
| 170 | 3300035115 | Ga0373941_0035470 | Ga0373941_0035470_864_1427 | 185 |
| 171 | 3300038443 | Ga0395901_0001313 | Ga0395901_0001313_23694_24260 | 185 |
| 172 | 3300044712 | Ga0453684_0061136 | Ga0453684_0061136_1532_2107 | 185 |
| 173 | 3300053080 | Ga0500635_0004168 | Ga0500635_0004168_1645_2208 | 185 |
| 174 | iso_pu_bacteria | 2919186247 | 2919189284 | 185 |
| 175 | iso_pu_bacteria | 2939664404 | 2939666561 | 185 |
| 176 | 3300001904 | JGI24736J21556_1020903 | JGI24736J21556_10209032 | 186 |
| 177 | 3300001990 | JGI24737J22298_10018666 | JGI24737J22298_100186662 | 186 |
| 178 | 3300002737 | JGI25162J39368_1000121 | JGI25162J39368_100012121 | 186 |
| 179 | 3300005288 | Ga0065714_10003028 | Ga0065714_100030286 | 186 |
| 180 | 3300005327 | Ga0070658_10000018 | Ga0070658_10000018176 | 186 |
| 181 | 3300005338 | Ga0068868_100012170 | Ga0068868_1000121704 | 186 |
| 182 | 3300005339 | Ga0070660_100082603 | Ga0070660_1000826032 | 186 |
| 183 | 3300005339 | Ga0070660_100109650 | Ga0070660_1001096502 | 186 |
| 184 | 3300005341 | Ga0070691_10074448 | Ga0070691_100744481 | 186 |
| 185 | 3300005364 | Ga0070673_100003122 | Ga0070673_1000031223 | 186 |
| 186 | 3300005364 | Ga0070673_100177806 | Ga0070673_1001778062 | 186 |
| 187 | 3300005456 | Ga0070678_100012887 | Ga0070678_1000128874 | 186 |
| 188 | 3300005457 | Ga0070662_100000081 | Ga0070662_10000008134 | 186 |
| 189 | 3300005457 | Ga0070662_100041245 | Ga0070662_1000412452 | 186 |
| 190 | 3300005459 | Ga0068867_100008949 | Ga0068867_1000089493 | 186 |
| 191 | 3300005539 | Ga0068853_100016443 | Ga0068853_1000164432 | 186 |
| 192 | 3300005539 | Ga0068853_100046226 | Ga0068853_1000462262 | 186 |
| 193 | 3300005539 | Ga0068853_100668675 | Ga0068853_1006686751 | 186 |
| 194 | 3300005543 | Ga0070672_100564234 | Ga0070672_1005642342 | 186 |
| 195 | 3300005563 | Ga0068855_100028946 | Ga0068855_1000289464 | 186 |
| 196 | 3300005563 | Ga0068855_100576877 | Ga0068855_1005768772 | 186 |
| 197 | 3300005563 | Ga0068855_100626795 | Ga0068855_1006267951 | 186 |
| 198 | 3300005563 | Ga0068855_100655167 | Ga0068855_1006551672 | 186 |
| 199 | 3300005563 | Ga0068855_100655823 | Ga0068855_1006558231 | 186 |
| 200 | 3300005616 | Ga0068852_100002760 | Ga0068852_10000276010 | 186 |
| 201 | 3300005842 | Ga0068858_100258361 | Ga0068858_1002583612 | 186 |
| 202 | 3300006237 | Ga0097621_100000039 | Ga0097621_10000003947 | 186 |
| 203 | 3300006237 | Ga0097621_100197857 | Ga0097621_1001978572 | 186 |
| 204 | 3300006358 | Ga0068871_100000857 | Ga0068871_1000008578 | 186 |
| 205 | 3300006881 | Ga0068865_100002192 | Ga0068865_1000021922 | 186 |
| 206 | 3300009093 | Ga0105240_10036632 | Ga0105240_100366322 | 186 |
| 207 | 3300009093 | Ga0105240_10043072 | Ga0105240_100430722 | 186 |
| 208 | 3300009093 | Ga0105240_10221601 | Ga0105240_102216012 | 186 |
| 209 | 3300009093 | Ga0105240_10373641 | Ga0105240_103736413 | 186 |
| 210 | 3300009174 | Ga0105241_10001088 | Ga0105241_1000108813 | 186 |
| 211 | 3300009174 | Ga0105241_10002132 | Ga0105241_100021321 | 186 |
| 212 | 3300009174 | Ga0105241_11139527 | Ga0105241_111395271 | 186 |
| 213 | 3300009176 | Ga0105242_10025126 | Ga0105242_100251263 | 186 |
| 214 | 3300009545 | Ga0105237_10004703 | Ga0105237_100047038 | 186 |
| 215 | 3300009545 | Ga0105237_10026943 | Ga0105237_100269431 | 186 |
| 216 | 3300009545 | Ga0105237_10037819 | Ga0105237_100378193 | 186 |
| 217 | 3300009551 | Ga0105238_10009249 | Ga0105238_100092497 | 186 |
| 218 | 3300009553 | Ga0105249_10953745 | Ga0105249_109537451 | 186 |
| 219 | 3300010375 | Ga0105239_10000132 | Ga0105239_1000013249 | 186 |
| 220 | 3300010375 | Ga0105239_10000139 | Ga0105239_1000013915 | 186 |
| 221 | 3300010375 | Ga0105239_10006154 | Ga0105239_100061542 | 186 |
| 222 | 3300010375 | Ga0105239_10099796 | Ga0105239_100997962 | 186 |
| 223 | 3300010375 | Ga0105239_10745117 | Ga0105239_107451172 | 186 |
| 224 | 3300011119 | Ga0105246_10054914 | Ga0105246_100549141 | 186 |
| 225 | 3300013100 | Ga0157373_10001984 | Ga0157373_100019844 | 186 |
| 226 | 3300013100 | Ga0157373_10064739 | Ga0157373_100647392 | 186 |
| 227 | 3300013102 | Ga0157371_10000251 | Ga0157371_1000025153 | 186 |
| 228 | 3300013102 | Ga0157371_10014036 | Ga0157371_100140363 | 186 |
| 229 | 3300013104 | Ga0157370_10054256 | Ga0157370_100542562 | 186 |
| 230 | 3300013104 | Ga0157370_10454253 | Ga0157370_104542532 | 186 |
| 231 | 3300013104 | Ga0157370_10495766 | Ga0157370_104957661 | 186 |
| 232 | 3300013104 | Ga0157370_10674537 | Ga0157370_106745372 | 186 |
| 233 | 3300013104 | Ga0157370_10703273 | Ga0157370_107032731 | 186 |
| 234 | 3300013105 | Ga0157369_10050214 | Ga0157369_100502143 | 186 |
| 235 | 3300013105 | Ga0157369_10151100 | Ga0157369_101511003 | 186 |
| 236 | 3300013296 | Ga0157374_10000135 | Ga0157374_1000013526 | 186 |
| 237 | 3300013296 | Ga0157374_10001901 | Ga0157374_100019018 | 186 |
| 238 | 3300013296 | Ga0157374_10036399 | Ga0157374_100363993 | 186 |
| 239 | 3300013297 | Ga0157378_10013175 | Ga0157378_100131755 | 186 |
| 240 | 3300013307 | Ga0157372_10000181 | Ga0157372_1000018120 | 186 |
| 241 | 3300013307 | Ga0157372_10017927 | Ga0157372_100179275 | 186 |
| 242 | 3300013307 | Ga0157372_10061899 | Ga0157372_100618992 | 186 |
| 243 | 3300013307 | Ga0157372_11123891 | Ga0157372_111238912 | 186 |
| 244 | 3300013308 | Ga0157375_10011045 | Ga0157375_100110455 | 186 |
| 245 | 3300013308 | Ga0157375_10789383 | Ga0157375_107893832 | 186 |
| 246 | 3300014745 | Ga0157377_10071739 | Ga0157377_100717392 | 186 |
| 247 | 3300014969 | Ga0157376_10785477 | Ga0157376_107854772 | 186 |
| 248 | 3300017792 | Ga0163161_10377622 | Ga0163161_103776222 | 186 |
| 249 | 3300021361 | Ga0213872_10015347 | Ga0213872_100153474 | 186 |
| 250 | 3300025231 | Ga0207427_108482 | Ga0207427_1084822 | 186 |
| 251 | 3300025233 | Ga0209437_100017 | Ga0209437_100017522 | 186 |
| 252 | 3300025261 | Ga0209233_1001460 | Ga0209233_10014603 | 186 |
| 253 | 3300025904 | Ga0207647_10000058 | Ga0207647_1000005845 | 186 |
| 254 | 3300025904 | Ga0207647_10006654 | Ga0207647_100066546 | 186 |
| 255 | 3300025907 | Ga0207645_10000957 | Ga0207645_100009577 | 186 |
| 256 | 3300025909 | Ga0207705_10000036 | Ga0207705_1000003619 | 186 |
| 257 | 3300025911 | Ga0207654_10006232 | Ga0207654_100062322 | 186 |
| 258 | 3300025911 | Ga0207654_10009271 | Ga0207654_100092713 | 186 |
| 259 | 3300025913 | Ga0207695_10007179 | Ga0207695_100071792 | 186 |
| 260 | 3300025913 | Ga0207695_10032160 | Ga0207695_100321607 | 186 |
| 261 | 3300025913 | Ga0207695_10280497 | Ga0207695_102804971 | 186 |
| 262 | 3300025914 | Ga0207671_10008839 | Ga0207671_100088393 | 186 |
| 263 | 3300025914 | Ga0207671_10011791 | Ga0207671_100117912 | 186 |
| 264 | 3300025914 | Ga0207671_10020439 | Ga0207671_100204392 | 186 |
| 265 | 3300025919 | Ga0207657_10133355 | Ga0207657_101333552 | 186 |
| 266 | 3300025924 | Ga0207694_10015828 | Ga0207694_100158284 | 186 |
| 267 | 3300025931 | Ga0207644_10014575 | Ga0207644_100145752 | 186 |
| 268 | 3300025933 | Ga0207706_10000317 | Ga0207706_100003175 | 186 |
| 269 | 3300025933 | Ga0207706_10060427 | Ga0207706_100604272 | 186 |
| 270 | 3300025934 | Ga0207686_10019615 | Ga0207686_100196152 | 186 |
| 271 | 3300025938 | Ga0207704_10000076 | Ga0207704_1000007643 | 186 |
| 272 | 3300025940 | Ga0207691_10525901 | Ga0207691_105259011 | 186 |
| 273 | 3300025949 | Ga0207667_10057102 | Ga0207667_100571024 | 186 |
| 274 | 3300025949 | Ga0207667_10335826 | Ga0207667_103358262 | 186 |
| 275 | 3300025949 | Ga0207667_11305892 | Ga0207667_113058921 | 186 |
| 276 | 3300025960 | Ga0207651_10286931 | Ga0207651_102869312 | 186 |
| 277 | 3300026023 | Ga0207677_10057708 | Ga0207677_100577081 | 186 |
| 278 | 3300026041 | Ga0207639_10012033 | Ga0207639_100120332 | 186 |
| 279 | 3300026041 | Ga0207639_10964640 | Ga0207639_109646401 | 186 |
| 280 | 3300026089 | Ga0207648_10000648 | Ga0207648_1000064827 | 186 |
| 281 | 3300026121 | Ga0207683_10009295 | Ga0207683_100092952 | 186 |
| 282 | 3300026142 | Ga0207698_10014707 | Ga0207698_100147074 | 186 |
| 283 | 3300033180 | Ga0307510_10010559 | Ga0307510_100105596 | 186 |
| 284 | 3300037418 | Ga0395900_0000181 | Ga0395900_0000181_5716_6288 | 186 |
| 285 | 3300039447 | Ga0436361_0458961 | Ga0436361_0458961_7329_7895 | 186 |
| 286 | 3300046513 | Ga0495616_0024718 | Ga0495616_0024718_1021_1590 | 186 |
| 287 | 3300046518 | Ga0495631_0001100 | Ga0495631_0001100_466_1032 | 186 |
| 288 | 3300046660 | Ga0495625_0009020 | Ga0495625_0009020_6773_7342 | 186 |
| 289 | 3300046660 | Ga0495625_0062356 | Ga0495625_0062356_1770_2339 | 186 |
| 290 | 3300047443 | Ga0495687_002794 | Ga0495687_002794_5389_5955 | 186 |
| 291 | 3300047443 | Ga0495687_092176 | Ga0495687_092176_434_1003 | 186 |
| 292 | 3300047472 | Ga0495686_0001050 | Ga0495686_0001050_25065_25634 | 186 |
| 293 | 3300047472 | Ga0495686_0045045 | Ga0495686_0045045_1989_2558 | 186 |
| 294 | 3300049460 | Ga0495682_0095103 | Ga0495682_0095103_278_844 | 186 |
| 295 | 3300053080 | Ga0500635_0000615 | Ga0500635_0000615_4145_4714 | 186 |
| 296 | 3300053122 | Ga0500608_000174 | Ga0500608_000174_15882_16448 | 186 |
| 297 | 3300053157 | Ga0500624_000854 | Ga0500624_000854_4985_5587 | 186 |
| 298 | 2162886012 | MBSR1b_contig_4602050 | MBSR1b_0675.00001140 | 187 |
| 299 | 3300005293 | Ga0065715_10089794 | Ga0065715_100897943 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5szu-assembly1.cif.gz_A | novel structural insights into gdp-mediated regulation of acyl-coa thioesterases | 0.9764 | 15 | 154 |
| 4ien-assembly1.cif.gz_A | crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 | 0.9732 | 15 | 154 |
| 5t02-assembly1.cif.gz_F | structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis | 0.969 | 15 | 154 |
| 2qq2-assembly2.cif.gz_J | crystal structure of c-terminal domain of human acyl-coa thioesterase 7 | 0.9665 | 10 | 150 |
| 2qq2-assembly1.cif.gz_E | crystal structure of c-terminal domain of human acyl-coa thioesterase 7 | 0.9631 | 8 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ienA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9732 | 15 | 154 | 3.10.129.10 |
| af_F1R1X8_276_424_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9535 | 6 | 152 | 3.10.129.10 |
| 2q2bB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9505 | 10 | 150 | 3.10.129.10 |
| 4mobA02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9499 | 16 | 154 | 3.10.129.10 |
| 4mocA02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9434 | 14 | 132 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2EEE8-F1-model_v4 | Acyl-CoA thioesterase | 0.9837 | 8 | 154 |
GO:0005829
GO:0006637 GO:0009062 GO:0052816 |
| AF-A0A2V7MKA0-F1-model_v4 | Acyl-CoA thioesterase | 0.9834 | 8 | 134 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-A0A1Q7RLD8-F1-model_v4 | deleted | 0.9825 | 8 | 151 |
|
| AF-A0A0N7GY75-F1-model_v4 | Acyl-CoA thioester hydrolase | 0.9818 | 15 | 154 |
GO:0005829
GO:0006637 GO:0052816 |
| AF-A0A081PFX4-F1-model_v4 | Thioesterase | 0.9816 | 6 | 160 |
GO:0005829
GO:0006637 GO:0052816 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar