F394639

General Info

Members Datasets Scaffolds Average Seq Length
299 165 598 130

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10354075|Ga0065712_103540751
Length 133
Sequence MIAAMKRRRPTDAELAILRVLWTRGPSTVREVVDAMRHQGAYTTVLKTLQIMTEKGLVDRDDAARTHVYAAAASEGSTQRQLVTDLMQRLFDGSAAKLVLHALEAGKASSEELAEIRKLLDARRGEKRRGGRS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
113 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
114 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.33
Rhizosphere 99.67
Stem 0
Stem Tuber 0
Unclassified 33.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10354075 3300005290 Unclassified 783
2 MRS1b_contig_2991825 2162886011 Bacteria 944
3 Ga0065712_10114118 3300005290 Unclassified 1769
4 Ga0065715_10028930 3300005293 Bacteria 1476
5 Ga0065715_10069031 3300005293 Bacteria 804
6 Ga0065707_10090712 3300005295 Bacteria 4082
7 Ga0065707_10288923 3300005295 Bacteria 1030
8 Ga0070676_10689492 3300005328 Unclassified 745
9 Ga0070676_11061756 3300005328 Unclassified 610
10 Ga0068869_100345891 3300005334 Bacteria 1211
11 Ga0070680_100846425 3300005336 Unclassified 788
12 Ga0070689_100418746 3300005340 Bacteria 1135
13 Ga0070671_101149324 3300005355 Unclassified 683
14 Ga0070671_101537940 3300005355 Unclassified 589
15 Ga0070674_100789291 3300005356 Unclassified 819
16 Ga0070673_100568547 3300005364 Bacteria 1031
17 Ga0070673_102158649 3300005364 Bacteria 529
18 Ga0070688_100278428 3300005365 Bacteria 1201
19 Ga0070659_100946368 3300005366 Bacteria 754
20 Ga0070713_100012435 3300005436 Bacteria 6243
21 Ga0070701_10134247 3300005438 Bacteria 1409
22 Ga0070700_100171638 3300005441 Bacteria 1502
23 Ga0070708_100929745 3300005445 Unclassified 816
24 Ga0070662_100899039 3300005457 Bacteria 755
25 Ga0070662_101983920 3300005457 Unclassified 503
26 Ga0070685_10078800 3300005466 Bacteria 1970
27 Ga0070698_100180125 3300005471 Bacteria 2052
28 Ga0070697_100042786 3300005536 Bacteria 3666
29 Ga0070672_100129897 3300005543 Bacteria 2069
30 Ga0070672_101645869 3300005543 Unclassified 576
31 Ga0070686_100232457 3300005544 Bacteria 1338
32 Ga0070686_100518872 3300005544 Bacteria 927
33 Ga0070704_101816271 3300005549 Unclassified 564
34 Ga0070664_101374797 3300005564 Unclassified 667
35 Ga0068859_100311151 3300005617 Bacteria 1669
36 Ga0068859_101308974 3300005617 Bacteria 799
37 Ga0068864_100462786 3300005618 Unclassified 1215
38 Ga0068864_101512906 3300005618 Bacteria 674
39 Ga0068861_100295055 3300005719 Bacteria 1402
40 Ga0068861_100771215 3300005719 Bacteria 900
41 Ga0068870_10636746 3300005840 Bacteria 729
42 Ga0068870_11373577 3300005840 Unclassified 517
43 Ga0068863_100724052 3300005841 Bacteria 990
44 Ga0068863_101101652 3300005841 Bacteria 799
45 Ga0068863_102711466 3300005841 Unclassified 504
46 Ga0068858_101090821 3300005842 Unclassified 784
47 Ga0068858_101185072 3300005842 Unclassified 751
48 Ga0068860_101098195 3300005843 Unclassified 815
49 Ga0068862_100158773 3300005844 Bacteria 2017
50 Ga0068862_100325066 3300005844 Bacteria 1421
51 Ga0068862_101201602 3300005844 Unclassified 757
52 Ga0068862_101488495 3300005844 Bacteria 682
53 Ga0075432_10111363 3300006058 Bacteria 1020
54 Ga0070716_100777436 3300006173 Unclassified 739
55 Ga0070712_100248879 3300006175 Bacteria 1419
56 Ga0097621_100031302 3300006237 Bacteria 4222
57 Ga0097621_100847331 3300006237 Bacteria 849
58 Ga0097621_101122657 3300006237 Bacteria 739
59 Ga0068871_100204589 3300006358 Bacteria 1706
60 Ga0068871_100217281 3300006358 Bacteria 1655
61 Ga0068871_100527706 3300006358 Unclassified 1067
62 Ga0068871_100759319 3300006358 Unclassified 892
63 Ga0075428_100004696 3300006844 Bacteria 15126
64 Ga0075428_100005432 3300006844 Bacteria 14161
65 Ga0075428_100036943 3300006844 Bacteria 5379
66 Ga0075428_100121663 3300006844 Bacteria 2842
67 Ga0075428_100163983 3300006844 Bacteria 2411
68 Ga0075428_100303119 3300006844 Bacteria 1717
69 Ga0075428_100647688 3300006844 Bacteria 1127
70 Ga0075430_100002051 3300006846 Bacteria 16602
71 Ga0075430_100083478 3300006846 Unclassified 2676
72 Ga0075430_100206708 3300006846 Bacteria 1629
73 Ga0075430_100285739 3300006846 Unclassified 1365
74 Ga0075431_100027505 3300006847 Bacteria 5837
75 Ga0075431_100056028 3300006847 Bacteria 4067
76 Ga0075431_100569294 3300006847 Unclassified 1119
77 Ga0075431_100589843 3300006847 Bacteria 1096
78 Ga0075433_10001454 3300006852 Bacteria 17493
79 Ga0075433_10002492 3300006852 Bacteria 14013
80 Ga0075434_100002718 3300006871 Bacteria 15622
81 Ga0075434_100684186 3300006871 Bacteria 1043
82 Ga0075434_100890689 3300006871 Unclassified 905
83 Ga0075434_101027616 3300006871 Bacteria 838
84 Ga0075429_100010324 3300006880 Bacteria 8079
85 Ga0075429_100097990 3300006880 Bacteria 2558
86 Ga0075429_100178679 3300006880 Bacteria 1860
87 Ga0075429_100373269 3300006880 Unclassified 1249
88 Ga0075429_101094319 3300006880 Unclassified 696
89 Ga0075429_101358831 3300006880 Bacteria 619
90 Ga0068865_100800870 3300006881 Bacteria 813
91 Ga0068865_100912823 3300006881 Bacteria 764
92 Ga0075436_101323632 3300006914 Bacteria 545
93 Ga0097620_100311156 3300006931 Bacteria 1669
94 Ga0097620_101308891 3300006931 Bacteria 799
95 Ga0075435_100223073 3300007076 Bacteria 1601
96 Ga0075435_100602140 3300007076 Unclassified 953
97 Ga0111539_10010802 3300009094 Bacteria 11496
98 Ga0111539_10226568 3300009094 Unclassified 2177
99 Ga0111539_10654285 3300009094 Bacteria 1223
100 Ga0111539_11797932 3300009094 Unclassified 711
101 Ga0111539_12609851 3300009094 Unclassified 586
102 Ga0105247_10087699 3300009101 Unclassified 1971
103 Ga0114129_10005715 3300009147 Bacteria 17621
104 Ga0114129_10226876 3300009147 Unclassified 2517
105 Ga0114129_10523212 3300009147 Bacteria 1546
106 Ga0114129_10621300 3300009147 Unclassified 1398
107 Ga0114129_10983238 3300009147 Unclassified 1064
108 Ga0114129_11017188 3300009147 Bacteria 1043
109 Ga0114129_11301473 3300009147 Bacteria 901
110 Ga0114129_12171494 3300009147 Unclassified 668
111 Ga0105243_10307679 3300009148 Bacteria 1439
112 Ga0105243_10547904 3300009148 Bacteria 1105
113 Ga0105242_10154937 3300009176 Bacteria 2001
114 Ga0105248_10240100 3300009177 Bacteria 2040
115 Ga0105248_10372205 3300009177 Bacteria 1608
116 Ga0105248_10526630 3300009177 Bacteria 1333
117 Ga0105248_11113698 3300009177 Unclassified 892
118 Ga0105249_10394444 3300009553 Bacteria 1413
119 Ga0105249_10798521 3300009553 Bacteria 1008
120 Ga0157374_10328012 3300013296 Bacteria 1518
121 Ga0157375_10070064 3300013308 Bacteria 3515
122 Ga0157375_10260593 3300013308 Bacteria 1895
123 Ga0157375_13290366 3300013308 Unclassified 539
124 Ga0163163_10118861 3300014325 Bacteria 2676
125 Ga0157380_10377052 3300014326 Bacteria 1337
126 Ga0157380_10665309 3300014326 Bacteria 1041
127 Ga0157377_10167517 3300014745 Unclassified 1371
128 Ga0157377_11437814 3300014745 Bacteria 545
129 Ga0157379_10307662 3300014968 Bacteria 1445
130 Ga0157379_10354813 3300014968 Bacteria 1343
131 Ga0157376_10280246 3300014969 Unclassified 1570
132 Ga0157376_11236726 3300014969 Bacteria 776
133 Ga0207710_10049738 3300025900 Unclassified 1879
134 Ga0207645_10748509 3300025907 Unclassified 664
135 Ga0207643_11002825 3300025908 Bacteria 540
136 Ga0207693_10259321 3300025915 Bacteria 1363
137 Ga0207660_10395011 3300025917 Bacteria 1113
138 Ga0207681_10398668 3300025923 Bacteria 1111
139 Ga0207681_10994361 3300025923 Bacteria 704
140 Ga0207700_10042148 3300025928 Bacteria 3345
141 Ga0207706_10452449 3300025933 Bacteria 1110
142 Ga0207686_11159665 3300025934 Unclassified 631
143 Ga0207670_10376414 3300025936 Bacteria 1130
144 Ga0207670_10614485 3300025936 Bacteria 894
145 Ga0207704_10569734 3300025938 Bacteria 923
146 Ga0207704_10775499 3300025938 Bacteria 799
147 Ga0207665_10835134 3300025939 Unclassified 729
148 Ga0207691_10121638 3300025940 Bacteria 2313
149 Ga0207691_10974388 3300025940 Unclassified 708
150 Ga0207711_10229063 3300025941 Bacteria 1701
151 Ga0207711_10993497 3300025941 Bacteria 779
152 Ga0207689_10228931 3300025942 Bacteria 1536
153 Ga0207651_11260742 3300025960 Bacteria 664
154 Ga0207712_11168277 3300025961 Bacteria 686
155 Ga0207677_12058018 3300026023 Bacteria 531
156 Ga0207703_10061752 3300026035 Bacteria 3068
157 Ga0207703_11121650 3300026035 Unclassified 756
158 Ga0207703_11276508 3300026035 Unclassified 706
159 Ga0207708_10050237 3300026075 Bacteria 3175
160 Ga0207708_10188721 3300026075 Bacteria 1640
161 Ga0207708_10295947 3300026075 Bacteria 1315
162 Ga0207641_12122977 3300026088 Unclassified 562
163 Ga0207648_10505198 3300026089 Unclassified 1106
164 Ga0207648_10813944 3300026089 Bacteria 870
165 Ga0207676_10138093 3300026095 Bacteria 2083
166 Ga0207675_100054669 3300026118 Bacteria 3725
167 Ga0209995_1034160 3300027471 Unclassified 854
168 Ga0209971_1061228 3300027682 Bacteria 911
169 Ga0209974_10040997 3300027876 Bacteria 1541
170 Ga0207428_10006115 3300027907 Bacteria 11125
171 Ga0207428_10210833 3300027907 Unclassified 1459
172 Ga0268265_10041991 3300028380 Bacteria 3390
173 Ga0268265_10073156 3300028380 Bacteria 2676
174 Ga0268265_10361688 3300028380 Bacteria 1329
175 Ga0268265_11178495 3300028380 Unclassified 763
176 Ga0268264_10380945 3300028381 Unclassified 1351
177 Ga0316182_1384122 3300030745 Bacteria 711
178 Ga0265329_10077697 3300031242 Bacteria 1051
179 Ga0307408_101414504 3300031548 Unclassified 655
180 Ga0307405_11183369 3300031731 Bacteria 660
181 Ga0307413_10378288 3300031824 Bacteria 1102
182 Ga0307410_10225042 3300031852 Bacteria 1445
183 Ga0307407_10320507 3300031903 Bacteria 1088
184 Ga0307412_10691377 3300031911 Unclassified 874
185 Ga0307416_100538718 3300032002 Bacteria 1239
186 Ga0307416_100976995 3300032002 Bacteria 949
187 Ga0307416_101258671 3300032002 Bacteria 846
188 Ga0307411_10305790 3300032005 Bacteria 1277
189 Ga0307411_11252961 3300032005 Unclassified 674
190 Ga0307415_101802549 3300032126 Bacteria 592
191 Ga0373923_0369058 3300035111 Unclassified 687
192 Ga0373923_0659564 3300035111 Unclassified 518
193 Ga0373941_0083529 3300035115 Bacteria 1083
194 Ga0373953_0070575 3300035117 Bacteria 1441
195 Ga0373953_0152317 3300035117 Unclassified 992
196 Ga0373953_0245214 3300035117 Unclassified 778
197 Ga0373953_0313570 3300035117 Unclassified 685
198 Ga0373956_0574160 3300035119 Unclassified 538
199 Ga0373957_0017132 3300035120 Bacteria 2518
200 Ga0373957_0281494 3300035120 Unclassified 703
201 Ga0373955_0261972 3300035172 Bacteria 1038
202 Ga0373955_0487933 3300035172 Unclassified 752
203 Ga0373924_0105106 3300035410 Bacteria 1217
204 Ga0373937_0007851 3300036401 Bacteria 9251
205 Ga0373937_0008218 3300036401 Bacteria 9062
206 Ga0373937_0026936 3300036401 Bacteria 5197
207 Ga0373937_0646165 3300036401 Unclassified 1003
208 Ga0242420_052841 3300038996 Bacteria 797
209 Ga0439433_0053465 3300041999 Bacteria 955
210 Ga0439454_090225 3300042011 Bacteria 566
211 Ga0439435_0144697 3300042436 Bacteria 759
212 Ga0439464_0312443 3300042439 Unclassified 514
213 Ga0439460_0050244 3300042461 Bacteria 1249
214 Ga0439440_0073147 3300042993 Unclassified 895
215 Ga0451576_1133360 3300045051 Unclassified 818
216 Ga0451576_1317741 3300045051 Unclassified 753
217 Ga0451576_1504207 3300045051 Bacteria 699
218 Ga0451576_1763432 3300045051 Bacteria 640
219 Ga0495629_0073531 3300046459 Bacteria 2387
220 Ga0495651_0042425 3300046462 Unclassified 3532
221 Ga0495653_0220219 3300046463 Bacteria 1276
222 Ga0495662_0107430 3300046476 Bacteria 1367
223 Ga0495608_0042706 3300046511 Unclassified 3031
224 Ga0495618_0242289 3300046514 Unclassified 1133
225 Ga0495618_0932234 3300046514 Unclassified 500
226 Ga0495628_0631371 3300046516 Unclassified 762
227 Ga0495630_1425732 3300046517 Unclassified 520
228 Ga0495652_1057488 3300046529 Unclassified 529
229 Ga0495640_0105426 3300046533 Bacteria 1847
230 Ga0495586_0036580 3300046535 Bacteria 2636
231 Ga0495586_0239485 3300046535 Unclassified 1034
232 Ga0495586_0785488 3300046535 Bacteria 549
233 Ga0495587_0127995 3300046536 Bacteria 1452
234 Ga0495645_0015118 3300046543 Bacteria 5486
235 Ga0495667_0037465 3300046559 Bacteria 3231
236 Ga0495634_0019479 3300046642 Bacteria 4821
237 Ga0495635_0477183 3300046663 Unclassified 823
238 Ga0495588_0703444 3300046674 Bacteria 528
239 Ga0495657_0000586 3300046675 Bacteria 33357
240 Ga0495599_0010929 3300046678 Bacteria 5567
241 Ga0495599_0337424 3300046678 Unclassified 905
242 Ga0495623_0208745 3300046679 Bacteria 1119
243 Ga0495613_0016599 3300046689 Bacteria 5481
244 Ga0495613_0055155 3300046689 Bacteria 2921
245 Ga0495613_0484496 3300046689 Unclassified 834
246 Ga0495600_0249892 3300046809 Bacteria 1128
247 Ga0495600_0436863 3300046809 Unclassified 811
248 Ga0495674_0008173 3300047319 Bacteria 9983
249 Ga0495675_0048586 3300047444 Bacteria 2699
250 Ga0495684_0146637 3300047471 Bacteria 1767
251 Ga0496114_0574590 3300048917 Bacteria 995
252 Ga0501039_0601003 3300049575 Unclassified 862
253 Ga0501041_0456793 3300049577 Unclassified 811
254 Ga0501068_0433129 3300049584 Unclassified 850
255 Ga0501072_0745054 3300049588 Unclassified 769
256 Ga0501075_0965905 3300049591 Unclassified 647
257 Ga0501249_129550 3300049679 Unclassified 621
258 Ga0501225_0290243 3300049705 Unclassified 550
259 Ga0501079_0979854 3300049741 Bacteria 666
260 nmdc:mga05p37_1208849_c1 3300050507 Bacteria 780
261 nmdc:mga05p37_1896672_c1 3300050507 Bacteria 569
262 nmdc:mga05p37_287496_c1 3300050507 Unclassified 1958
263 nmdc:mga05p37_72810_c1 3300050507 Bacteria 3867
264 nmdc:mga09592_170838_c1 3300050508 Bacteria 1880
265 nmdc:mga09592_271226_c1 3300050508 Bacteria 1472
266 nmdc:mga09592_284407_c1 3300050508 Bacteria 1434
267 nmdc:mga09592_392711_c1 3300050508 Bacteria 1199
268 nmdc:mga09592_487103_c1 3300050508 Unclassified 1062
269 nmdc:mga09592_527357_c1 3300050508 Bacteria 1015
270 nmdc:mga09592_78250_c1 3300050508 Bacteria 2814
271 nmdc:mga09592_9838_c1 3300050508 Bacteria 7774
272 nmdc:mga0qj67_1158_c1 3300050509 Bacteria 18251
273 nmdc:mga0qj67_1240762_c1 3300050509 Unclassified 579
274 nmdc:mga0qj67_263387_c1 3300050509 Bacteria 1398
275 nmdc:mga0qj67_52039_c1 3300050509 Unclassified 3240
276 nmdc:mga06r32_307066_c1 3300050510 Bacteria 1572
277 nmdc:mga06r32_44488_c1 3300050510 Bacteria 4228
278 nmdc:mga06r32_536565_c1 3300050510 Unclassified 1145
279 nmdc:mga06r32_59455_c1 3300050510 Unclassified 3676
280 nmdc:mga06r32_72208_c1 3300050510 Unclassified 3341
281 nmdc:mga08y16_123626_c1 3300050511 Bacteria 2693
282 nmdc:mga08y16_172105_c1 3300050511 Unclassified 2249
283 nmdc:mga08y16_278106_c1 3300050511 Bacteria 1727
284 nmdc:mga08y16_441573_c1 3300050511 Bacteria 1328
285 nmdc:mga0n895_2599_c1 3300050512 Bacteria 14188
286 nmdc:mga0n895_27462_c1 3300050512 Bacteria 5407
287 nmdc:mga0n895_465796_c1 3300050512 Bacteria 1275
288 nmdc:mga0n895_951010_c1 3300050512 Bacteria 842
289 nmdc:mga0rr50_1316363_c1 3300050513 Unclassified 612
290 nmdc:mga0rr50_650241_c1 3300050513 Bacteria 900
291 nmdc:mga08x19_1038446_c1 3300050514 Bacteria 582
292 nmdc:mga08x19_3017_c1 3300050514 Bacteria 10118
293 nmdc:mga0a205_1175_c1 3300050515 Bacteria 21836
294 nmdc:mga0a205_2639_c1 3300050515 Bacteria 15837
295 nmdc:mga0a205_411711_c1 3300050515 Bacteria 1215
296 Ga0495601_0414455 3300053077 Bacteria 873
297 Ga0495619_0082518 3300053085 Bacteria 2167
298 Ga0495619_0861338 3300053085 Bacteria 611
299 Ga0501082_1385647 3300060353 Bacteria 614
300 Ga0065712_10354075
301 MRS1b_contig_2991825
302 Ga0065712_10114118
303 Ga0065715_10028930
304 Ga0065715_10069031
305 Ga0065707_10090712
306 Ga0065707_10288923
307 Ga0070676_10689492
308 Ga0070676_11061756
309 Ga0068869_100345891
310 Ga0070680_100846425
311 Ga0070689_100418746
312 Ga0070671_101149324
313 Ga0070671_101537940
314 Ga0070674_100789291
315 Ga0070673_100568547
316 Ga0070673_102158649
317 Ga0070688_100278428
318 Ga0070659_100946368
319 Ga0070713_100012435
320 Ga0070701_10134247
321 Ga0070700_100171638
322 Ga0070708_100929745
323 Ga0070662_100899039
324 Ga0070662_101983920
325 Ga0070685_10078800
326 Ga0070698_100180125
327 Ga0070697_100042786
328 Ga0070672_100129897
329 Ga0070672_101645869
330 Ga0070686_100232457
331 Ga0070686_100518872
332 Ga0070704_101816271
333 Ga0070664_101374797
334 Ga0068859_100311151
335 Ga0068859_101308974
336 Ga0068864_100462786
337 Ga0068864_101512906
338 Ga0068861_100295055
339 Ga0068861_100771215
340 Ga0068870_10636746
341 Ga0068870_11373577
342 Ga0068863_100724052
343 Ga0068863_101101652
344 Ga0068863_102711466
345 Ga0068858_101090821
346 Ga0068858_101185072
347 Ga0068860_101098195
348 Ga0068862_100158773
349 Ga0068862_100325066
350 Ga0068862_101201602
351 Ga0068862_101488495
352 Ga0075432_10111363
353 Ga0070716_100777436
354 Ga0070712_100248879
355 Ga0097621_100031302
356 Ga0097621_100847331
357 Ga0097621_101122657
358 Ga0068871_100204589
359 Ga0068871_100217281
360 Ga0068871_100527706
361 Ga0068871_100759319
362 Ga0075428_100004696
363 Ga0075428_100005432
364 Ga0075428_100036943
365 Ga0075428_100121663
366 Ga0075428_100163983
367 Ga0075428_100303119
368 Ga0075428_100647688
369 Ga0075430_100002051
370 Ga0075430_100083478
371 Ga0075430_100206708
372 Ga0075430_100285739
373 Ga0075431_100027505
374 Ga0075431_100056028
375 Ga0075431_100569294
376 Ga0075431_100589843
377 Ga0075433_10001454
378 Ga0075433_10002492
379 Ga0075434_100002718
380 Ga0075434_100684186
381 Ga0075434_100890689
382 Ga0075434_101027616
383 Ga0075429_100010324
384 Ga0075429_100097990
385 Ga0075429_100178679
386 Ga0075429_100373269
387 Ga0075429_101094319
388 Ga0075429_101358831
389 Ga0068865_100800870
390 Ga0068865_100912823
391 Ga0075436_101323632
392 Ga0097620_100311156
393 Ga0097620_101308891
394 Ga0075435_100223073
395 Ga0075435_100602140
396 Ga0111539_10010802
397 Ga0111539_10226568
398 Ga0111539_10654285
399 Ga0111539_11797932
400 Ga0111539_12609851
401 Ga0105247_10087699
402 Ga0114129_10005715
403 Ga0114129_10226876
404 Ga0114129_10523212
405 Ga0114129_10621300
406 Ga0114129_10983238
407 Ga0114129_11017188
408 Ga0114129_11301473
409 Ga0114129_12171494
410 Ga0105243_10307679
411 Ga0105243_10547904
412 Ga0105242_10154937
413 Ga0105248_10240100
414 Ga0105248_10372205
415 Ga0105248_10526630
416 Ga0105248_11113698
417 Ga0105249_10394444
418 Ga0105249_10798521
419 Ga0157374_10328012
420 Ga0157375_10070064
421 Ga0157375_10260593
422 Ga0157375_13290366
423 Ga0163163_10118861
424 Ga0157380_10377052
425 Ga0157380_10665309
426 Ga0157377_10167517
427 Ga0157377_11437814
428 Ga0157379_10307662
429 Ga0157379_10354813
430 Ga0157376_10280246
431 Ga0157376_11236726
432 Ga0207710_10049738
433 Ga0207645_10748509
434 Ga0207643_11002825
435 Ga0207693_10259321
436 Ga0207660_10395011
437 Ga0207681_10398668
438 Ga0207681_10994361
439 Ga0207700_10042148
440 Ga0207706_10452449
441 Ga0207686_11159665
442 Ga0207670_10376414
443 Ga0207670_10614485
444 Ga0207704_10569734
445 Ga0207704_10775499
446 Ga0207665_10835134
447 Ga0207691_10121638
448 Ga0207691_10974388
449 Ga0207711_10229063
450 Ga0207711_10993497
451 Ga0207689_10228931
452 Ga0207651_11260742
453 Ga0207712_11168277
454 Ga0207677_12058018
455 Ga0207703_10061752
456 Ga0207703_11121650
457 Ga0207703_11276508
458 Ga0207708_10050237
459 Ga0207708_10188721
460 Ga0207708_10295947
461 Ga0207641_12122977
462 Ga0207648_10505198
463 Ga0207648_10813944
464 Ga0207676_10138093
465 Ga0207675_100054669
466 Ga0209995_1034160
467 Ga0209971_1061228
468 Ga0209974_10040997
469 Ga0207428_10006115
470 Ga0207428_10210833
471 Ga0268265_10041991
472 Ga0268265_10073156
473 Ga0268265_10361688
474 Ga0268265_11178495
475 Ga0268264_10380945
476 Ga0316182_1384122
477 Ga0265329_10077697
478 Ga0307408_101414504
479 Ga0307405_11183369
480 Ga0307413_10378288
481 Ga0307410_10225042
482 Ga0307407_10320507
483 Ga0307412_10691377
484 Ga0307416_100538718
485 Ga0307416_100976995
486 Ga0307416_101258671
487 Ga0307411_10305790
488 Ga0307411_11252961
489 Ga0307415_101802549
490 Ga0373923_0369058
491 Ga0373923_0659564
492 Ga0373941_0083529
493 Ga0373953_0070575
494 Ga0373953_0152317
495 Ga0373953_0245214
496 Ga0373953_0313570
497 Ga0373956_0574160
498 Ga0373957_0017132
499 Ga0373957_0281494
500 Ga0373955_0261972
501 Ga0373955_0487933
502 Ga0373924_0105106
503 Ga0373937_0007851
504 Ga0373937_0008218
505 Ga0373937_0026936
506 Ga0373937_0646165
507 Ga0242420_052841
508 Ga0439433_0053465
509 Ga0439454_090225
510 Ga0439435_0144697
511 Ga0439464_0312443
512 Ga0439460_0050244
513 Ga0439440_0073147
514 Ga0451576_1133360
515 Ga0451576_1317741
516 Ga0451576_1504207
517 Ga0451576_1763432
518 Ga0495629_0073531
519 Ga0495651_0042425
520 Ga0495653_0220219
521 Ga0495662_0107430
522 Ga0495608_0042706
523 Ga0495618_0242289
524 Ga0495618_0932234
525 Ga0495628_0631371
526 Ga0495630_1425732
527 Ga0495652_1057488
528 Ga0495640_0105426
529 Ga0495586_0036580
530 Ga0495586_0239485
531 Ga0495586_0785488
532 Ga0495587_0127995
533 Ga0495645_0015118
534 Ga0495667_0037465
535 Ga0495634_0019479
536 Ga0495635_0477183
537 Ga0495588_0703444
538 Ga0495657_0000586
539 Ga0495599_0010929
540 Ga0495599_0337424
541 Ga0495623_0208745
542 Ga0495613_0016599
543 Ga0495613_0055155
544 Ga0495613_0484496
545 Ga0495600_0249892
546 Ga0495600_0436863
547 Ga0495674_0008173
548 Ga0495675_0048586
549 Ga0495684_0146637
550 Ga0496114_0574590
551 Ga0501039_0601003
552 Ga0501041_0456793
553 Ga0501068_0433129
554 Ga0501072_0745054
555 Ga0501075_0965905
556 Ga0501249_129550
557 Ga0501225_0290243
558 Ga0501079_0979854
559 nmdc:mga05p37_1208849_c1
560 nmdc:mga05p37_1896672_c1
561 nmdc:mga05p37_287496_c1
562 nmdc:mga05p37_72810_c1
563 nmdc:mga09592_170838_c1
564 nmdc:mga09592_271226_c1
565 nmdc:mga09592_284407_c1
566 nmdc:mga09592_392711_c1
567 nmdc:mga09592_487103_c1
568 nmdc:mga09592_527357_c1
569 nmdc:mga09592_78250_c1
570 nmdc:mga09592_9838_c1
571 nmdc:mga0qj67_1158_c1
572 nmdc:mga0qj67_1240762_c1
573 nmdc:mga0qj67_263387_c1
574 nmdc:mga0qj67_52039_c1
575 nmdc:mga06r32_307066_c1
576 nmdc:mga06r32_44488_c1
577 nmdc:mga06r32_536565_c1
578 nmdc:mga06r32_59455_c1
579 nmdc:mga06r32_72208_c1
580 nmdc:mga08y16_123626_c1
581 nmdc:mga08y16_172105_c1
582 nmdc:mga08y16_278106_c1
583 nmdc:mga08y16_441573_c1
584 nmdc:mga0n895_2599_c1
585 nmdc:mga0n895_27462_c1
586 nmdc:mga0n895_465796_c1
587 nmdc:mga0n895_951010_c1
588 nmdc:mga0rr50_1316363_c1
589 nmdc:mga0rr50_650241_c1
590 nmdc:mga08x19_1038446_c1
591 nmdc:mga08x19_3017_c1
592 nmdc:mga0a205_1175_c1
593 nmdc:mga0a205_2639_c1
594 nmdc:mga0a205_411711_c1
595 Ga0495601_0414455
596 Ga0495619_0082518
597 Ga0495619_0861338
598 Ga0501082_1385647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

10

122

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.8915 13 71
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8879 15 71
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8688 10 71
1p6r-assembly1.cif.gz_A solution structure of the dna binding domain of the repressor blai. 0.8642 4 75
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8602 7 71
ID Description Score Start End Superfamily
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9299 9 71 1.10.10.10
2g9wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.914 7 71 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 9 71 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.903 9 71 1.10.10.10
2hr3C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8992 13 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A420YU64-F1-model_v4 CopY/TcrY family copper transport repressor 0.9317 8 80 GO:0003677
GO:0045892
AF-A0A838QGT6-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9254 1 87 GO:0003677
GO:0045892
AF-A0A3F3LEU3-F1-model_v4 deleted 0.9221 4 86
AF-A0A348NJ08-F1-model_v4 Transcriptional regulator 0.9203 8 96 GO:0003677
GO:0045892
AF-A0A352HCE1-F1-model_v4 deleted 0.9185 7 93

Map