F394484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 182 | 298 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0002735|Ga0496109_0002735_716_1993 |
| Length | 425 |
| Sequence | MSRPRTCFEITAKDPESRGRAGVITTAHGQVRTPAFVPLATKGTVKGLEPRDVRELGYDMVLGNTFHLMTTPGKELVREFGGLHKFMRWDGPIITDSGGFQVFSMGHGTIADEVKGRSAQSGAGRDGKTLGITEKGASFRSYLDGSKQFLSPEESMDVQAHLHSDIALVFDECTPFHVTKNYTDKSTERTHRWLERCLDWHAANGPDDQLVYGIVQGGVYEDLRTASARRIGESRCDGIAIGGSLGENKPQMYQVVDWATAVLPEDRPRHLLGIGDVDDLLRGVELGIDTFDCAMPTRLARHGVALVPEPDKRWRKDLTGSPFRHADEPIMEGCPCPTCREGFTRGYLAYLHRSKEQTGPRLLTLHNLAYTARLMADLRGALAEGRVGERIAELRAGDAPKVFFQPDGTPYPGAPPLGAETLAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 25 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 26 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 59 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 102 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 103 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 109 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 110 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 111 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 112 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 113 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 114 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 134 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 135 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 144 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 145 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 179 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 180 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 182 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.01 |
| Nodule | 0 |
| Rhizoplane | 16.11 |
| Rhizosphere | 81.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000167 | 3300001977 | Bacteria | 8560 |
| 2 | Ga0070683_100052890 | 3300005329 | Bacteria | 3763 |
| 3 | Ga0070683_100122006 | 3300005329 | Bacteria | 2462 |
| 4 | Ga0070677_10000004 | 3300005333 | Bacteria | 81101 |
| 5 | Ga0070682_100003538 | 3300005337 | Bacteria | 8644 |
| 6 | Ga0068868_100006368 | 3300005338 | Bacteria | 8349 |
| 7 | Ga0068868_100034726 | 3300005338 | Bacteria | 3895 |
| 8 | Ga0068868_100172146 | 3300005338 | Bacteria | 1793 |
| 9 | Ga0070661_100083755 | 3300005344 | Bacteria | 2356 |
| 10 | Ga0070669_100037424 | 3300005353 | Bacteria | 3520 |
| 11 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 12 | Ga0070659_100000030 | 3300005366 | Bacteria | 128662 |
| 13 | Ga0070659_100113310 | 3300005366 | Bacteria | 2190 |
| 14 | Ga0070659_100270601 | 3300005366 | Bacteria | 1411 |
| 15 | Ga0070714_100000228 | 3300005435 | Bacteria | 44348 |
| 16 | Ga0070714_100017001 | 3300005435 | Bacteria | 5885 |
| 17 | Ga0070710_10000009 | 3300005437 | Bacteria | 165863 |
| 18 | Ga0070701_10020586 | 3300005438 | Bacteria | 3135 |
| 19 | Ga0070705_100003324 | 3300005440 | Bacteria | 7892 |
| 20 | Ga0070685_10008302 | 3300005466 | Bacteria | 5331 |
| 21 | Ga0070685_10024412 | 3300005466 | Bacteria | 3320 |
| 22 | Ga0070679_100066773 | 3300005530 | Bacteria | 3586 |
| 23 | Ga0070684_100001766 | 3300005535 | Bacteria | 15773 |
| 24 | Ga0070684_100060447 | 3300005535 | Bacteria | 3314 |
| 25 | Ga0070697_100127605 | 3300005536 | Bacteria | 2131 |
| 26 | Ga0070664_100015011 | 3300005564 | Bacteria | 6323 |
| 27 | Ga0070664_100137097 | 3300005564 | Bacteria | 2152 |
| 28 | Ga0070664_100169424 | 3300005564 | Bacteria | 1937 |
| 29 | Ga0068856_100026071 | 3300005614 | Bacteria | 5700 |
| 30 | Ga0070702_100006498 | 3300005615 | Bacteria | 5540 |
| 31 | Ga0068852_100079739 | 3300005616 | Bacteria | 2901 |
| 32 | Ga0068859_100026595 | 3300005617 | Bacteria | 5802 |
| 33 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 34 | Ga0068866_10056196 | 3300005718 | Bacteria | 2024 |
| 35 | Ga0068861_100024432 | 3300005719 | Bacteria | 4370 |
| 36 | Ga0068870_10082224 | 3300005840 | Bacteria | 1783 |
| 37 | Ga0068858_100000091 | 3300005842 | Bacteria | 93802 |
| 38 | Ga0068858_100383029 | 3300005842 | Bacteria | 1350 |
| 39 | Ga0081455_10063641 | 3300005937 | Bacteria | 3094 |
| 40 | Ga0081538_10001885 | 3300005981 | Bacteria | 21119 |
| 41 | Ga0081538_10097635 | 3300005981 | Bacteria | 1492 |
| 42 | Ga0081540_1002568 | 3300005983 | Bacteria | 14732 |
| 43 | Ga0081539_10003769 | 3300005985 | Bacteria | 17944 |
| 44 | Ga0081539_10006119 | 3300005985 | Bacteria | 11731 |
| 45 | Ga0081539_10009201 | 3300005985 | Bacteria | 8323 |
| 46 | Ga0070717_10000013 | 3300006028 | Bacteria | 228046 |
| 47 | Ga0070715_10038859 | 3300006163 | Bacteria | 1978 |
| 48 | Ga0075431_100026586 | 3300006847 | Bacteria | 5937 |
| 49 | Ga0075434_100052931 | 3300006871 | Bacteria | 4034 |
| 50 | Ga0075436_100171822 | 3300006914 | Bacteria | 1530 |
| 51 | Ga0097620_100026594 | 3300006931 | Bacteria | 5802 |
| 52 | Ga0075435_100038300 | 3300007076 | Bacteria | 3822 |
| 53 | Ga0105240_10060146 | 3300009093 | Bacteria | 4737 |
| 54 | Ga0111539_10072012 | 3300009094 | Bacteria | 4077 |
| 55 | Ga0105245_10014206 | 3300009098 | Bacteria | 6940 |
| 56 | Ga0105245_10186812 | 3300009098 | Bacteria | 1983 |
| 57 | Ga0114129_10169063 | 3300009147 | Bacteria | 2982 |
| 58 | Ga0105243_10026794 | 3300009148 | Bacteria | 4414 |
| 59 | Ga0105243_10307817 | 3300009148 | Bacteria | 1438 |
| 60 | Ga0105248_10139918 | 3300009177 | Bacteria | 2730 |
| 61 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 62 | Ga0105249_10000068 | 3300009553 | Bacteria | 148594 |
| 63 | Ga0105249_10199627 | 3300009553 | Bacteria | 1957 |
| 64 | Ga0105239_10085557 | 3300010375 | Bacteria | 3475 |
| 65 | Ga0105239_10141262 | 3300010375 | Bacteria | 2683 |
| 66 | Ga0105239_10383364 | 3300010375 | Bacteria | 1589 |
| 67 | Ga0157370_10016361 | 3300013104 | Bacteria | 7510 |
| 68 | Ga0157374_10005737 | 3300013296 | Bacteria | 10475 |
| 69 | Ga0157378_10132599 | 3300013297 | Bacteria | 2308 |
| 70 | Ga0163162_10017994 | 3300013306 | Bacteria | 6917 |
| 71 | Ga0157372_10007044 | 3300013307 | Bacteria | 11976 |
| 72 | Ga0157372_10125859 | 3300013307 | Bacteria | 2946 |
| 73 | Ga0157375_10140840 | 3300013308 | Bacteria | 2539 |
| 74 | Ga0163163_10089506 | 3300014325 | Bacteria | 3090 |
| 75 | Ga0163163_10137755 | 3300014325 | Bacteria | 2482 |
| 76 | Ga0163163_10262623 | 3300014325 | Bacteria | 1778 |
| 77 | Ga0157377_10009314 | 3300014745 | Bacteria | 4811 |
| 78 | Ga0157377_10126375 | 3300014745 | Bacteria | 1556 |
| 79 | Ga0157379_10001717 | 3300014968 | Bacteria | 18137 |
| 80 | Ga0157379_10003199 | 3300014968 | Bacteria | 13872 |
| 81 | Ga0157376_10177076 | 3300014969 | Bacteria | 1946 |
| 82 | Ga0213876_10031180 | 3300021384 | Bacteria | 2814 |
| 83 | Ga0207426_1016005 | 3300025302 | Bacteria | 2706 |
| 84 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 85 | Ga0207642_10000122 | 3300025899 | Bacteria | 21318 |
| 86 | Ga0207710_10060902 | 3300025900 | Bacteria | 1712 |
| 87 | Ga0207688_10000574 | 3300025901 | Bacteria | 18050 |
| 88 | Ga0207688_10033803 | 3300025901 | Bacteria | 2829 |
| 89 | Ga0207680_10228785 | 3300025903 | Bacteria | 1277 |
| 90 | Ga0207685_10025192 | 3300025905 | Bacteria | 2050 |
| 91 | Ga0207643_10078996 | 3300025908 | Bacteria | 1904 |
| 92 | Ga0207657_10054144 | 3300025919 | Bacteria | 3472 |
| 93 | Ga0207652_10191342 | 3300025921 | Bacteria | 1840 |
| 94 | Ga0207681_10034866 | 3300025923 | Bacteria | 3312 |
| 95 | Ga0207650_10258790 | 3300025925 | Bacteria | 1411 |
| 96 | Ga0207687_10099575 | 3300025927 | Bacteria | 2136 |
| 97 | Ga0207664_10000060 | 3300025929 | Bacteria | 116764 |
| 98 | Ga0207664_10002198 | 3300025929 | Bacteria | 12845 |
| 99 | Ga0207690_10000094 | 3300025932 | Bacteria | 74114 |
| 100 | Ga0207690_10043206 | 3300025932 | Bacteria | 2965 |
| 101 | Ga0207706_10010294 | 3300025933 | Bacteria | 8551 |
| 102 | Ga0207709_10090709 | 3300025935 | Bacteria | 1997 |
| 103 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 104 | Ga0207669_10201944 | 3300025937 | Bacteria | 1444 |
| 105 | Ga0207704_10051510 | 3300025938 | Bacteria | 2490 |
| 106 | Ga0207691_10071389 | 3300025940 | Bacteria | 3133 |
| 107 | Ga0207661_10020801 | 3300025944 | Bacteria | 4910 |
| 108 | Ga0207661_10028900 | 3300025944 | Bacteria | 4251 |
| 109 | Ga0207661_10091090 | 3300025944 | Bacteria | 2540 |
| 110 | Ga0207679_10009479 | 3300025945 | Bacteria | 6239 |
| 111 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 112 | Ga0207712_10032025 | 3300025961 | Bacteria | 3546 |
| 113 | Ga0207668_10056215 | 3300025972 | Bacteria | 2740 |
| 114 | Ga0207703_10000152 | 3300026035 | Bacteria | 79658 |
| 115 | Ga0207703_10038120 | 3300026035 | Bacteria | 3833 |
| 116 | Ga0207708_10001047 | 3300026075 | Bacteria | 20695 |
| 117 | Ga0207708_10001594 | 3300026075 | Bacteria | 16904 |
| 118 | Ga0207708_10010204 | 3300026075 | Bacteria | 6972 |
| 119 | Ga0207708_10158961 | 3300026075 | Bacteria | 1784 |
| 120 | Ga0207648_10076303 | 3300026089 | Bacteria | 2922 |
| 121 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 122 | Ga0207674_10107384 | 3300026116 | Bacteria | 2768 |
| 123 | Ga0207675_100031309 | 3300026118 | Bacteria | 4956 |
| 124 | Ga0207675_100089357 | 3300026118 | Bacteria | 2895 |
| 125 | Ga0207675_100165730 | 3300026118 | Bacteria | 2110 |
| 126 | Ga0207683_10031809 | 3300026121 | Bacteria | 4581 |
| 127 | Ga0207698_10049958 | 3300026142 | Bacteria | 3187 |
| 128 | Ga0268266_10014029 | 3300028379 | Bacteria | 6898 |
| 129 | Ga0268264_10074161 | 3300028381 | Bacteria | 2890 |
| 130 | Ga0265326_10000024 | 3300028558 | Bacteria | 112928 |
| 131 | Ga0265319_1000015 | 3300028563 | Bacteria | 176382 |
| 132 | Ga0265334_10000151 | 3300028573 | Bacteria | 42917 |
| 133 | Ga0265336_10000622 | 3300028666 | Bacteria | 19519 |
| 134 | Ga0265338_10024213 | 3300028800 | Bacteria | 6210 |
| 135 | Ga0265324_10038893 | 3300029957 | Bacteria | 1649 |
| 136 | Ga0265320_10011515 | 3300031240 | Bacteria | 5201 |
| 137 | Ga0307405_10202657 | 3300031731 | Bacteria | 1442 |
| 138 | Ga0307413_10178203 | 3300031824 | Bacteria | 1512 |
| 139 | Ga0307410_10060703 | 3300031852 | Bacteria | 2585 |
| 140 | Ga0307410_10097449 | 3300031852 | Bacteria | 2101 |
| 141 | Ga0307407_10008266 | 3300031903 | Bacteria | 4766 |
| 142 | Ga0307409_100171867 | 3300031995 | Bacteria | 1908 |
| 143 | Ga0307416_100004052 | 3300032002 | Bacteria | 8756 |
| 144 | Ga0307416_100088932 | 3300032002 | Bacteria | 2643 |
| 145 | Ga0307416_100205153 | 3300032002 | Bacteria | 1874 |
| 146 | Ga0307415_100076453 | 3300032126 | Bacteria | 2374 |
| 147 | Ga0307415_100159640 | 3300032126 | Bacteria | 1746 |
| 148 | Ga0395901_0003040 | 3300038443 | Bacteria | 16908 |
| 149 | Ga0395901_0140354 | 3300038443 | Bacteria | 2540 |
| 150 | Ga0395901_0208408 | 3300038443 | Bacteria | 2047 |
| 151 | Ga0436365_1102419 | 3300039437 | Bacteria | 6206 |
| 152 | Ga0436365_1135292 | 3300039437 | Bacteria | 3311 |
| 153 | Ga0439458_0012232 | 3300042157 | Bacteria | 1924 |
| 154 | Ga0466972_0040215 | 3300044658 | Bacteria | 2278 |
| 155 | Ga0466965_0005709 | 3300044683 | Bacteria | 5612 |
| 156 | Ga0466966_0057024 | 3300044684 | Bacteria | 2470 |
| 157 | Ga0466966_0058671 | 3300044684 | Bacteria | 2432 |
| 158 | Ga0466961_0001354 | 3300044693 | Bacteria | 15106 |
| 159 | Ga0466961_0116837 | 3300044693 | Bacteria | 1676 |
| 160 | Ga0466963_0003004 | 3300044694 | Bacteria | 9545 |
| 161 | Ga0466963_0045376 | 3300044694 | Bacteria | 2895 |
| 162 | Ga0466957_0013995 | 3300044842 | Bacteria | 4666 |
| 163 | Ga0466957_0052706 | 3300044842 | Bacteria | 2478 |
| 164 | Ga0466957_0161914 | 3300044842 | Bacteria | 1454 |
| 165 | Ga0466960_0030467 | 3300044901 | Bacteria | 2483 |
| 166 | Ga0466959_0006088 | 3300045049 | Bacteria | 8327 |
| 167 | Ga0466959_0016350 | 3300045049 | Bacteria | 5420 |
| 168 | Ga0466959_0148322 | 3300045049 | Bacteria | 1655 |
| 169 | Ga0466958_0003716 | 3300045836 | Bacteria | 7970 |
| 170 | Ga0466958_0124537 | 3300045836 | Bacteria | 1615 |
| 171 | Ga0466967_0008361 | 3300045976 | Bacteria | 7573 |
| 172 | Ga0466967_0021961 | 3300045976 | Bacteria | 5196 |
| 173 | Ga0466967_0025317 | 3300045976 | Bacteria | 4891 |
| 174 | Ga0466967_0026024 | 3300045976 | Bacteria | 4837 |
| 175 | Ga0466967_0062719 | 3300045976 | Bacteria | 3300 |
| 176 | Ga0466967_0096182 | 3300045976 | Bacteria | 2701 |
| 177 | Ga0466967_0112085 | 3300045976 | Bacteria | 2508 |
| 178 | Ga0466967_0130241 | 3300045976 | Bacteria | 2334 |
| 179 | Ga0466967_0173342 | 3300045976 | Bacteria | 2031 |
| 180 | Ga0466967_0185593 | 3300045976 | Bacteria | 1964 |
| 181 | Ga0495603_0001695 | 3300046455 | Bacteria | 12959 |
| 182 | Ga0495650_0000055 | 3300046471 | Bacteria | 308438 |
| 183 | Ga0495628_0158422 | 3300046516 | Bacteria | 1721 |
| 184 | Ga0495630_0000541 | 3300046517 | Bacteria | 27642 |
| 185 | Ga0495630_0051778 | 3300046517 | Bacteria | 3073 |
| 186 | Ga0495652_0219948 | 3300046529 | Bacteria | 1428 |
| 187 | Ga0495656_0000483 | 3300046615 | Bacteria | 12964 |
| 188 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 189 | Ga0495624_0000008 | 3300046690 | Bacteria | 145035 |
| 190 | Ga0496100_0000463 | 3300048903 | Bacteria | 19446 |
| 191 | Ga0496100_0019689 | 3300048903 | Bacteria | 4032 |
| 192 | Ga0496101_0001372 | 3300048904 | Bacteria | 14597 |
| 193 | Ga0496101_0012031 | 3300048904 | Bacteria | 5765 |
| 194 | Ga0496101_0133614 | 3300048904 | Bacteria | 1886 |
| 195 | Ga0496102_0008834 | 3300048905 | Bacteria | 8644 |
| 196 | Ga0496103_0100711 | 3300048906 | Bacteria | 1828 |
| 197 | Ga0496104_0016956 | 3300048907 | Bacteria | 6625 |
| 198 | Ga0496104_0021884 | 3300048907 | Bacteria | 5872 |
| 199 | Ga0496104_0088965 | 3300048907 | Bacteria | 2950 |
| 200 | Ga0496105_0014384 | 3300048908 | Bacteria | 6298 |
| 201 | Ga0496105_0086528 | 3300048908 | Bacteria | 2590 |
| 202 | Ga0496106_0017611 | 3300048909 | Bacteria | 5285 |
| 203 | Ga0496106_0022410 | 3300048909 | Bacteria | 4691 |
| 204 | Ga0496106_0121098 | 3300048909 | Bacteria | 2045 |
| 205 | Ga0496106_0332841 | 3300048909 | Bacteria | 1219 |
| 206 | Ga0496106_0390980 | 3300048909 | Bacteria | 1118 |
| 207 | Ga0496107_0010901 | 3300048910 | Bacteria | 6323 |
| 208 | Ga0496107_0121514 | 3300048910 | Bacteria | 1924 |
| 209 | Ga0496108_0000502 | 3300048911 | Bacteria | 30918 |
| 210 | Ga0496108_0000747 | 3300048911 | Bacteria | 25332 |
| 211 | Ga0496108_0001172 | 3300048911 | Bacteria | 20452 |
| 212 | Ga0496108_0038026 | 3300048911 | Bacteria | 4009 |
| 213 | Ga0496108_0109964 | 3300048911 | Bacteria | 2356 |
| 214 | Ga0496108_0151467 | 3300048911 | Bacteria | 2001 |
| 215 | Ga0496109_0001311 | 3300048912 | Bacteria | 20538 |
| 216 | Ga0496109_0002735 | 3300048912 | Bacteria | 14785 |
| 217 | Ga0496109_0008677 | 3300048912 | Bacteria | 8651 |
| 218 | Ga0496109_0029158 | 3300048912 | Bacteria | 4941 |
| 219 | Ga0496109_0052250 | 3300048912 | Bacteria | 3724 |
| 220 | Ga0496109_0052502 | 3300048912 | Bacteria | 3716 |
| 221 | Ga0496109_0185011 | 3300048912 | Bacteria | 1957 |
| 222 | Ga0496110_0001949 | 3300048913 | Bacteria | 15306 |
| 223 | Ga0496110_0020943 | 3300048913 | Bacteria | 5525 |
| 224 | Ga0496110_0209154 | 3300048913 | Bacteria | 1773 |
| 225 | Ga0496110_0266800 | 3300048913 | Bacteria | 1558 |
| 226 | Ga0496111_0027914 | 3300048914 | Bacteria | 3997 |
| 227 | Ga0496112_0021308 | 3300048915 | Bacteria | 6162 |
| 228 | Ga0496112_0061498 | 3300048915 | Bacteria | 3702 |
| 229 | Ga0496112_0065189 | 3300048915 | Bacteria | 3594 |
| 230 | Ga0496112_0069486 | 3300048915 | Bacteria | 3479 |
| 231 | Ga0496113_0015774 | 3300048916 | Bacteria | 5204 |
| 232 | Ga0496113_0086735 | 3300048916 | Bacteria | 2405 |
| 233 | Ga0496113_0129764 | 3300048916 | Bacteria | 1977 |
| 234 | Ga0496113_0223387 | 3300048916 | Bacteria | 1501 |
| 235 | Ga0496114_0099301 | 3300048917 | Bacteria | 2483 |
| 236 | Ga0496114_0366874 | 3300048917 | Bacteria | 1274 |
| 237 | Ga0496115_0207042 | 3300048918 | Bacteria | 1620 |
| 238 | Ga0496121_0002905 | 3300048924 | Bacteria | 25149 |
| 239 | Ga0496121_0110891 | 3300048924 | Bacteria | 2093 |
| 240 | Ga0501031_0041151 | 3300049568 | Bacteria | 3017 |
| 241 | Ga0501032_0074642 | 3300049569 | Bacteria | 2259 |
| 242 | Ga0501033_0087408 | 3300049570 | Bacteria | 2281 |
| 243 | Ga0501034_0047908 | 3300049571 | Bacteria | 4313 |
| 244 | Ga0501036_0059054 | 3300049572 | Bacteria | 3250 |
| 245 | Ga0501037_0002288 | 3300049573 | Bacteria | 13821 |
| 246 | Ga0501038_0021768 | 3300049574 | Bacteria | 5753 |
| 247 | Ga0501039_0017664 | 3300049575 | Bacteria | 5472 |
| 248 | Ga0501039_0018252 | 3300049575 | Bacteria | 5384 |
| 249 | Ga0501039_0044956 | 3300049575 | Bacteria | 3411 |
| 250 | Ga0501039_0068327 | 3300049575 | Bacteria | 2759 |
| 251 | Ga0501040_0008462 | 3300049576 | Bacteria | 6684 |
| 252 | Ga0501040_0114933 | 3300049576 | Bacteria | 1884 |
| 253 | Ga0501041_0073298 | 3300049577 | Bacteria | 2104 |
| 254 | Ga0501042_0017188 | 3300049578 | Bacteria | 4985 |
| 255 | Ga0501042_0036751 | 3300049578 | Bacteria | 3475 |
| 256 | Ga0501043_0021880 | 3300049579 | Bacteria | 5014 |
| 257 | Ga0501046_0003186 | 3300049580 | Bacteria | 15124 |
| 258 | Ga0501047_0095871 | 3300049581 | Bacteria | 2845 |
| 259 | Ga0501067_0016596 | 3300049583 | Bacteria | 4069 |
| 260 | Ga0501069_0014054 | 3300049585 | Bacteria | 4276 |
| 261 | Ga0501069_0048789 | 3300049585 | Bacteria | 2352 |
| 262 | Ga0501069_0062735 | 3300049585 | Bacteria | 2075 |
| 263 | Ga0501071_0022151 | 3300049587 | Bacteria | 4428 |
| 264 | Ga0501071_0027237 | 3300049587 | Bacteria | 4020 |
| 265 | Ga0501072_0030314 | 3300049588 | Bacteria | 4230 |
| 266 | Ga0501072_0050104 | 3300049588 | Bacteria | 3288 |
| 267 | Ga0501072_0110000 | 3300049588 | Bacteria | 2193 |
| 268 | Ga0501074_0034465 | 3300049590 | Bacteria | 3669 |
| 269 | Ga0501076_0017798 | 3300049592 | Bacteria | 5403 |
| 270 | Ga0501076_0115977 | 3300049592 | Bacteria | 2167 |
| 271 | Ga0501079_0037154 | 3300049741 | Bacteria | 3753 |
| 272 | Ga0501079_0065227 | 3300049741 | Bacteria | 2809 |
| 273 | Ga0501079_0082233 | 3300049741 | Bacteria | 2491 |
| 274 | Ga0501079_0139584 | 3300049741 | Bacteria | 1888 |
| 275 | Ga0501080_0018289 | 3300049742 | Bacteria | 6486 |
| 276 | Ga0501080_0024187 | 3300049742 | Bacteria | 5632 |
| 277 | Ga0501080_0202297 | 3300049742 | Bacteria | 1823 |
| 278 | Ga0501081_0040601 | 3300049743 | Bacteria | 3186 |
| 279 | Ga0501035_0037621 | 3300049822 | Bacteria | 4381 |
| 280 | Ga0501035_0066178 | 3300049822 | Bacteria | 3208 |
| 281 | Ga0501044_0022832 | 3300049823 | Bacteria | 6664 |
| 282 | Ga0501044_0179627 | 3300049823 | Bacteria | 2084 |
| 283 | Ga0501045_0112648 | 3300049824 | Bacteria | 2017 |
| 284 | nmdc:mga09592_17372_c1 | 3300050508 | Bacteria | 5894 |
| 285 | nmdc:mga0qj67_18969_c1 | 3300050509 | Bacteria | 5248 |
| 286 | nmdc:mga08y16_56208_c1 | 3300050511 | Bacteria | 4113 |
| 287 | nmdc:mga08y16_84929_c1 | 3300050511 | Bacteria | 3299 |
| 288 | nmdc:mga0n895_259446_c1 | 3300050512 | Bacteria | 1764 |
| 289 | nmdc:mga08x19_150271_c1 | 3300050514 | Bacteria | 1577 |
| 290 | nmdc:mga0a205_540_c1 | 3300050515 | Bacteria | 29856 |
| 291 | Ga0495619_0009846 | 3300053085 | Bacteria | 6024 |
| 292 | Ga0495619_0101174 | 3300053085 | Bacteria | 1962 |
| 293 | Ga0500556_0000817 | 3300053104 | Bacteria | 17987 |
| 294 | Ga0500616_0018328 | 3300053153 | Bacteria | 3960 |
| 295 | Ga0501082_0002632 | 3300060353 | Bacteria | 15690 |
| 296 | Ga0501082_0099977 | 3300060353 | Bacteria | 2508 |
| 297 | Ga0466962_0041225 | 3300061719 | Bacteria | 2209 |
| 298 | Ga0530510_0006663 | 3300061734 | Bacteria | 8055 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0052502 | Ga0496109_0052502_2676_3704 | 329 |
| 2 | 3300048917 | Ga0496114_0366874 | Ga0496114_0366874_13_1041 | 329 |
| 3 | 3300048909 | Ga0496106_0390980 | Ga0496106_0390980_44_1099 | 338 |
| 4 | 3300046516 | Ga0495628_0158422 | Ga0495628_0158422_654_1679 | 341 |
| 5 | 3300050515 | nmdc:mga0a205_540_c1 | nmdc:mga0a205_540_c1_19564_20613 | 345 |
| 6 | 3300028558 | Ga0265326_10000024 | Ga0265326_10000024101 | 346 |
| 7 | 3300028573 | Ga0265334_10000151 | Ga0265334_1000015133 | 346 |
| 8 | 3300028666 | Ga0265336_10000622 | Ga0265336_1000062216 | 346 |
| 9 | 3300028800 | Ga0265338_10024213 | Ga0265338_100242133 | 346 |
| 10 | 3300029957 | Ga0265324_10038893 | Ga0265324_100388932 | 346 |
| 11 | 3300049581 | Ga0501047_0095871 | Ga0501047_0095871_1385_2446 | 348 |
| 12 | 3300049823 | Ga0501044_0179627 | Ga0501044_0179627_279_1340 | 348 |
| 13 | 3300048911 | Ga0496108_0000502 | Ga0496108_0000502_4674_5750 | 351 |
| 14 | 3300046517 | Ga0495630_0000541 | Ga0495630_0000541_6982_8043 | 353 |
| 15 | 3300014969 | Ga0157376_10177076 | Ga0157376_101770762 | 354 |
| 16 | 3300048906 | Ga0496103_0100711 | Ga0496103_0100711_480_1559 | 354 |
| 17 | 3300048912 | Ga0496109_0029158 | Ga0496109_0029158_3645_4889 | 354 |
| 18 | 3300006028 | Ga0070717_10000013 | Ga0070717_1000001349 | 357 |
| 19 | 3300046471 | Ga0495650_0000055 | Ga0495650_0000055_9604_10794 | 357 |
| 20 | 3300048911 | Ga0496108_0151467 | Ga0496108_0151467_697_1941 | 357 |
| 21 | 3300005353 | Ga0070669_100037424 | Ga0070669_1000374242 | 360 |
| 22 | 3300005435 | Ga0070714_100017001 | Ga0070714_1000170013 | 360 |
| 23 | 3300025923 | Ga0207681_10034866 | Ga0207681_100348662 | 360 |
| 24 | 3300039437 | Ga0436365_1135292 | Ga0436365_1135292_1014_2171 | 361 |
| 25 | 3300025929 | Ga0207664_10002198 | Ga0207664_1000219811 | 362 |
| 26 | 3300045976 | Ga0466967_0062719 | Ga0466967_0062719_1949_3091 | 363 |
| 27 | 3300025944 | Ga0207661_10020801 | Ga0207661_100208012 | 364 |
| 28 | 3300005564 | Ga0070664_100137097 | Ga0070664_1001370972 | 365 |
| 29 | 3300009098 | Ga0105245_10186812 | Ga0105245_101868122 | 365 |
| 30 | 3300025932 | Ga0207690_10043206 | Ga0207690_100432063 | 365 |
| 31 | 3300005366 | Ga0070659_100000030 | Ga0070659_10000003079 | 366 |
| 32 | 3300005981 | Ga0081538_10097635 | Ga0081538_100976351 | 366 |
| 33 | 3300025932 | Ga0207690_10000094 | Ga0207690_1000009462 | 366 |
| 34 | 3300046517 | Ga0495630_0051778 | Ga0495630_0051778_867_1979 | 370 |
| 35 | 3300048916 | Ga0496113_0129764 | Ga0496113_0129764_318_1529 | 370 |
| 36 | 3300005338 | Ga0068868_100034726 | Ga0068868_1000347262 | 371 |
| 37 | 3300025925 | Ga0207650_10258790 | Ga0207650_102587901 | 371 |
| 38 | 3300031852 | Ga0307410_10060703 | Ga0307410_100607032 | 371 |
| 39 | 3300031903 | Ga0307407_10008266 | Ga0307407_100082662 | 371 |
| 40 | 3300032002 | Ga0307416_100004052 | Ga0307416_1000040527 | 371 |
| 41 | 3300032126 | Ga0307415_100159640 | Ga0307415_1001596402 | 371 |
| 42 | 3300044842 | Ga0466957_0052706 | Ga0466957_0052706_1178_2386 | 376 |
| 43 | 3300046529 | Ga0495652_0219948 | Ga0495652_0219948_77_1282 | 376 |
| 44 | 3300048924 | Ga0496121_0002905 | Ga0496121_0002905_23309_24541 | 376 |
| 45 | 3300005435 | Ga0070714_100000228 | Ga0070714_1000002289 | 378 |
| 46 | 3300025929 | Ga0207664_10000060 | Ga0207664_100000609 | 378 |
| 47 | 3300046615 | Ga0495656_0000483 | Ga0495656_0000483_11409_12548 | 378 |
| 48 | 3300010375 | Ga0105239_10141262 | Ga0105239_101412622 | 379 |
| 49 | 3300044684 | Ga0466966_0058671 | Ga0466966_0058671_561_1748 | 379 |
| 50 | 3300048911 | Ga0496108_0001172 | Ga0496108_0001172_14124_15275 | 379 |
| 51 | 3300048912 | Ga0496109_0001311 | Ga0496109_0001311_14204_15355 | 379 |
| 52 | 3300005437 | Ga0070710_10000009 | Ga0070710_10000009120 | 380 |
| 53 | 3300025898 | Ga0207692_10000005 | Ga0207692_10000005207 | 380 |
| 54 | 3300050514 | nmdc:mga08x19_150271_c1 | nmdc:mga08x19_150271_c1_64_1272 | 382 |
| 55 | 3300005440 | Ga0070705_100003324 | Ga0070705_1000033244 | 383 |
| 56 | 3300026075 | Ga0207708_10158961 | Ga0207708_101589611 | 383 |
| 57 | 3300049588 | Ga0501072_0050104 | Ga0501072_0050104_91_1290 | 383 |
| 58 | 3300050508 | nmdc:mga09592_17372_c1 | nmdc:mga09592_17372_c1_2721_3932 | 383 |
| 59 | 3300049578 | Ga0501042_0036751 | Ga0501042_0036751_2243_3445 | 384 |
| 60 | 3300005536 | Ga0070697_100127605 | Ga0070697_1001276052 | 385 |
| 61 | 3300009093 | Ga0105240_10060146 | Ga0105240_100601462 | 385 |
| 62 | 3300044658 | Ga0466972_0040215 | Ga0466972_0040215_266_1480 | 385 |
| 63 | 3300044683 | Ga0466965_0005709 | Ga0466965_0005709_1227_2441 | 385 |
| 64 | 3300044693 | Ga0466961_0116837 | Ga0466961_0116837_380_1567 | 385 |
| 65 | 3300044694 | Ga0466963_0003004 | Ga0466963_0003004_6259_7446 | 385 |
| 66 | 3300045049 | Ga0466959_0006088 | Ga0466959_0006088_1815_3002 | 385 |
| 67 | 3300045836 | Ga0466958_0003716 | Ga0466958_0003716_512_1699 | 385 |
| 68 | 3300048911 | Ga0496108_0038026 | Ga0496108_0038026_1793_2971 | 385 |
| 69 | 3300021384 | Ga0213876_10031180 | Ga0213876_100311801 | 386 |
| 70 | 3300039437 | Ga0436365_1102419 | Ga0436365_1102419_4956_6164 | 386 |
| 71 | 3300048909 | Ga0496106_0332841 | Ga0496106_0332841_17_1201 | 386 |
| 72 | 3300025940 | Ga0207691_10071389 | Ga0207691_100713892 | 387 |
| 73 | 3300005530 | Ga0070679_100066773 | Ga0070679_1000667735 | 388 |
| 74 | 3300014325 | Ga0163163_10262623 | Ga0163163_102626233 | 388 |
| 75 | 3300025919 | Ga0207657_10054144 | Ga0207657_100541443 | 388 |
| 76 | 3300025921 | Ga0207652_10191342 | Ga0207652_101913422 | 388 |
| 77 | 3300038443 | Ga0395901_0003040 | Ga0395901_0003040_11676_12863 | 388 |
| 78 | 3300044684 | Ga0466966_0057024 | Ga0466966_0057024_177_1409 | 388 |
| 79 | 3300045049 | Ga0466959_0016350 | Ga0466959_0016350_3604_4821 | 388 |
| 80 | 3300045836 | Ga0466958_0124537 | Ga0466958_0124537_240_1463 | 388 |
| 81 | 3300045976 | Ga0466967_0025317 | Ga0466967_0025317_182_1417 | 388 |
| 82 | 3300048907 | Ga0496104_0088965 | Ga0496104_0088965_89_1276 | 388 |
| 83 | 3300048908 | Ga0496105_0014384 | Ga0496105_0014384_3010_4197 | 388 |
| 84 | 3300048912 | Ga0496109_0052250 | Ga0496109_0052250_920_2107 | 388 |
| 85 | 3300048915 | Ga0496112_0061498 | Ga0496112_0061498_237_1424 | 388 |
| 86 | 3300048915 | Ga0496112_0069486 | Ga0496112_0069486_733_1920 | 388 |
| 87 | 3300061719 | Ga0466962_0041225 | Ga0466962_0041225_147_1370 | 388 |
| 88 | 3300031824 | Ga0307413_10178203 | Ga0307413_101782032 | 389 |
| 89 | 3300038443 | Ga0395901_0140354 | Ga0395901_0140354_1129_2325 | 389 |
| 90 | 3300049585 | Ga0501069_0062735 | Ga0501069_0062735_541_1731 | 389 |
| 91 | 3300049741 | Ga0501079_0082233 | Ga0501079_0082233_546_1736 | 389 |
| 92 | 3300049742 | Ga0501080_0024187 | Ga0501080_0024187_3370_4560 | 389 |
| 93 | 3300050509 | nmdc:mga0qj67_18969_c1 | nmdc:mga0qj67_18969_c1_278_1468 | 389 |
| 94 | 3300009094 | Ga0111539_10072012 | Ga0111539_100720123 | 390 |
| 95 | 3300014968 | Ga0157379_10003199 | Ga0157379_100031999 | 390 |
| 96 | 3300044693 | Ga0466961_0001354 | Ga0466961_0001354_12703_13920 | 390 |
| 97 | 3300048924 | Ga0496121_0110891 | Ga0496121_0110891_453_1652 | 390 |
| 98 | 3300049575 | Ga0501039_0068327 | Ga0501039_0068327_1100_2299 | 390 |
| 99 | 3300050511 | nmdc:mga08y16_56208_c1 | nmdc:mga08y16_56208_c1_1001_2200 | 390 |
| 100 | 3300005337 | Ga0070682_100003538 | Ga0070682_1000035386 | 391 |
| 101 | 3300005338 | Ga0068868_100006368 | Ga0068868_1000063683 | 391 |
| 102 | 3300005344 | Ga0070661_100083755 | Ga0070661_1000837551 | 391 |
| 103 | 3300005466 | Ga0070685_10008302 | Ga0070685_100083023 | 391 |
| 104 | 3300005535 | Ga0070684_100001766 | Ga0070684_1000017666 | 391 |
| 105 | 3300005564 | Ga0070664_100015011 | Ga0070664_1000150115 | 391 |
| 106 | 3300005564 | Ga0070664_100169424 | Ga0070664_1001694241 | 391 |
| 107 | 3300005616 | Ga0068852_100079739 | Ga0068852_1000797394 | 391 |
| 108 | 3300005937 | Ga0081455_10063641 | Ga0081455_100636414 | 391 |
| 109 | 3300005983 | Ga0081540_1002568 | Ga0081540_10025682 | 391 |
| 110 | 3300005985 | Ga0081539_10009201 | Ga0081539_100092013 | 391 |
| 111 | 3300006847 | Ga0075431_100026586 | Ga0075431_1000265867 | 391 |
| 112 | 3300006871 | Ga0075434_100052931 | Ga0075434_1000529315 | 391 |
| 113 | 3300006914 | Ga0075436_100171822 | Ga0075436_1001718222 | 391 |
| 114 | 3300007076 | Ga0075435_100038300 | Ga0075435_1000383005 | 391 |
| 115 | 3300009098 | Ga0105245_10014206 | Ga0105245_100142067 | 391 |
| 116 | 3300009177 | Ga0105248_10139918 | Ga0105248_101399183 | 391 |
| 117 | 3300010375 | Ga0105239_10085557 | Ga0105239_100855574 | 391 |
| 118 | 3300013296 | Ga0157374_10005737 | Ga0157374_100057373 | 391 |
| 119 | 3300013307 | Ga0157372_10007044 | Ga0157372_100070443 | 391 |
| 120 | 3300013308 | Ga0157375_10140840 | Ga0157375_101408401 | 391 |
| 121 | 3300014325 | Ga0163163_10137755 | Ga0163163_101377552 | 391 |
| 122 | 3300014745 | Ga0157377_10009314 | Ga0157377_100093144 | 391 |
| 123 | 3300025901 | Ga0207688_10000574 | Ga0207688_1000057417 | 391 |
| 124 | 3300025933 | Ga0207706_10010294 | Ga0207706_100102944 | 391 |
| 125 | 3300025945 | Ga0207679_10009479 | Ga0207679_100094793 | 391 |
| 126 | 3300025972 | Ga0207668_10056215 | Ga0207668_100562152 | 391 |
| 127 | 3300026075 | Ga0207708_10001047 | Ga0207708_1000104719 | 391 |
| 128 | 3300026121 | Ga0207683_10031809 | Ga0207683_100318092 | 391 |
| 129 | 3300026142 | Ga0207698_10049958 | Ga0207698_100499582 | 391 |
| 130 | 3300044901 | Ga0466960_0030467 | Ga0466960_0030467_601_1797 | 391 |
| 131 | 3300048903 | Ga0496100_0000463 | Ga0496100_0000463_13122_14339 | 391 |
| 132 | 3300048904 | Ga0496101_0001372 | Ga0496101_0001372_3684_4901 | 391 |
| 133 | 3300048904 | Ga0496101_0133614 | Ga0496101_0133614_439_1635 | 391 |
| 134 | 3300048905 | Ga0496102_0008834 | Ga0496102_0008834_1268_2464 | 391 |
| 135 | 3300048907 | Ga0496104_0016956 | Ga0496104_0016956_45_1265 | 391 |
| 136 | 3300048907 | Ga0496104_0021884 | Ga0496104_0021884_3798_4994 | 391 |
| 137 | 3300048908 | Ga0496105_0086528 | Ga0496105_0086528_279_1499 | 391 |
| 138 | 3300048909 | Ga0496106_0017611 | Ga0496106_0017611_1434_2630 | 391 |
| 139 | 3300048911 | Ga0496108_0000747 | Ga0496108_0000747_23254_24450 | 391 |
| 140 | 3300048912 | Ga0496109_0008677 | Ga0496109_0008677_6483_7679 | 391 |
| 141 | 3300048912 | Ga0496109_0185011 | Ga0496109_0185011_99_1295 | 391 |
| 142 | 3300048913 | Ga0496110_0001949 | Ga0496110_0001949_5084_6280 | 391 |
| 143 | 3300048913 | Ga0496110_0266800 | Ga0496110_0266800_182_1378 | 391 |
| 144 | 3300048914 | Ga0496111_0027914 | Ga0496111_0027914_1888_3084 | 391 |
| 145 | 3300048915 | Ga0496112_0021308 | Ga0496112_0021308_1694_2890 | 391 |
| 146 | 3300048915 | Ga0496112_0065189 | Ga0496112_0065189_1285_2505 | 391 |
| 147 | 3300048916 | Ga0496113_0015774 | Ga0496113_0015774_3967_5187 | 391 |
| 148 | 3300048916 | Ga0496113_0086735 | Ga0496113_0086735_820_2016 | 391 |
| 149 | 3300048916 | Ga0496113_0223387 | Ga0496113_0223387_194_1390 | 391 |
| 150 | 3300049572 | Ga0501036_0059054 | Ga0501036_0059054_261_1448 | 391 |
| 151 | 3300049575 | Ga0501039_0044956 | Ga0501039_0044956_33_1220 | 391 |
| 152 | 3300049576 | Ga0501040_0114933 | Ga0501040_0114933_143_1345 | 391 |
| 153 | 3300049578 | Ga0501042_0017188 | Ga0501042_0017188_2490_3692 | 391 |
| 154 | 3300049587 | Ga0501071_0022151 | Ga0501071_0022151_1021_2223 | 391 |
| 155 | 3300049587 | Ga0501071_0027237 | Ga0501071_0027237_2775_3962 | 391 |
| 156 | 3300049741 | Ga0501079_0139584 | Ga0501079_0139584_294_1496 | 391 |
| 157 | 3300049822 | Ga0501035_0066178 | Ga0501035_0066178_875_2062 | 391 |
| 158 | 3300050512 | nmdc:mga0n895_259446_c1 | nmdc:mga0n895_259446_c1_475_1695 | 391 |
| 159 | 3300005329 | Ga0070683_100122006 | Ga0070683_1001220062 | 392 |
| 160 | 3300005338 | Ga0068868_100172146 | Ga0068868_1001721462 | 392 |
| 161 | 3300005366 | Ga0070659_100113310 | Ga0070659_1001133102 | 392 |
| 162 | 3300005366 | Ga0070659_100270601 | Ga0070659_1002706012 | 392 |
| 163 | 3300005438 | Ga0070701_10020586 | Ga0070701_100205862 | 392 |
| 164 | 3300005466 | Ga0070685_10024412 | Ga0070685_100244122 | 392 |
| 165 | 3300005535 | Ga0070684_100060447 | Ga0070684_1000604472 | 392 |
| 166 | 3300005615 | Ga0070702_100006498 | Ga0070702_1000064984 | 392 |
| 167 | 3300005617 | Ga0068859_100026595 | Ga0068859_1000265954 | 392 |
| 168 | 3300005719 | Ga0068861_100024432 | Ga0068861_1000244324 | 392 |
| 169 | 3300005842 | Ga0068858_100383029 | Ga0068858_1003830291 | 392 |
| 170 | 3300005985 | Ga0081539_10006119 | Ga0081539_100061197 | 392 |
| 171 | 3300006163 | Ga0070715_10038859 | Ga0070715_100388592 | 392 |
| 172 | 3300006931 | Ga0097620_100026594 | Ga0097620_1000265945 | 392 |
| 173 | 3300009148 | Ga0105243_10026794 | Ga0105243_100267942 | 392 |
| 174 | 3300009148 | Ga0105243_10307817 | Ga0105243_103078171 | 392 |
| 175 | 3300009553 | Ga0105249_10199627 | Ga0105249_101996272 | 392 |
| 176 | 3300013297 | Ga0157378_10132599 | Ga0157378_101325992 | 392 |
| 177 | 3300013306 | Ga0163162_10017994 | Ga0163162_100179944 | 392 |
| 178 | 3300013307 | Ga0157372_10125859 | Ga0157372_101258592 | 392 |
| 179 | 3300014325 | Ga0163163_10089506 | Ga0163163_100895062 | 392 |
| 180 | 3300014745 | Ga0157377_10126375 | Ga0157377_101263752 | 392 |
| 181 | 3300025900 | Ga0207710_10060902 | Ga0207710_100609022 | 392 |
| 182 | 3300025903 | Ga0207680_10228785 | Ga0207680_102287851 | 392 |
| 183 | 3300025905 | Ga0207685_10025192 | Ga0207685_100251922 | 392 |
| 184 | 3300025908 | Ga0207643_10078996 | Ga0207643_100789962 | 392 |
| 185 | 3300025927 | Ga0207687_10099575 | Ga0207687_100995752 | 392 |
| 186 | 3300025938 | Ga0207704_10051510 | Ga0207704_100515102 | 392 |
| 187 | 3300025944 | Ga0207661_10091090 | Ga0207661_100910902 | 392 |
| 188 | 3300025961 | Ga0207712_10032025 | Ga0207712_100320252 | 392 |
| 189 | 3300026035 | Ga0207703_10038120 | Ga0207703_100381201 | 392 |
| 190 | 3300026089 | Ga0207648_10076303 | Ga0207648_100763032 | 392 |
| 191 | 3300026116 | Ga0207674_10107384 | Ga0207674_101073842 | 392 |
| 192 | 3300026118 | Ga0207675_100089357 | Ga0207675_1000893572 | 392 |
| 193 | 3300026118 | Ga0207675_100165730 | Ga0207675_1001657302 | 392 |
| 194 | 3300028381 | Ga0268264_10074161 | Ga0268264_100741612 | 392 |
| 195 | 3300028563 | Ga0265319_1000015 | Ga0265319_100001561 | 392 |
| 196 | 3300031240 | Ga0265320_10011515 | Ga0265320_100115152 | 392 |
| 197 | 3300032002 | Ga0307416_100088932 | Ga0307416_1000889323 | 392 |
| 198 | 3300038443 | Ga0395901_0208408 | Ga0395901_0208408_702_1916 | 392 |
| 199 | 3300044694 | Ga0466963_0045376 | Ga0466963_0045376_162_1361 | 392 |
| 200 | 3300044842 | Ga0466957_0013995 | Ga0466957_0013995_2077_3276 | 392 |
| 201 | 3300045976 | Ga0466967_0008361 | Ga0466967_0008361_6176_7396 | 392 |
| 202 | 3300045976 | Ga0466967_0026024 | Ga0466967_0026024_537_1736 | 392 |
| 203 | 3300045976 | Ga0466967_0096182 | Ga0466967_0096182_405_1634 | 392 |
| 204 | 3300045976 | Ga0466967_0112085 | Ga0466967_0112085_1189_2388 | 392 |
| 205 | 3300045976 | Ga0466967_0173342 | Ga0466967_0173342_646_1857 | 392 |
| 206 | 3300045976 | Ga0466967_0185593 | Ga0466967_0185593_280_1500 | 392 |
| 207 | 3300048909 | Ga0496106_0121098 | Ga0496106_0121098_47_1246 | 392 |
| 208 | 3300048910 | Ga0496107_0121514 | Ga0496107_0121514_562_1761 | 392 |
| 209 | 3300048913 | Ga0496110_0209154 | Ga0496110_0209154_349_1548 | 392 |
| 210 | 3300048917 | Ga0496114_0099301 | Ga0496114_0099301_150_1349 | 392 |
| 211 | 3300049568 | Ga0501031_0041151 | Ga0501031_0041151_1733_2950 | 392 |
| 212 | 3300049569 | Ga0501032_0074642 | Ga0501032_0074642_97_1314 | 392 |
| 213 | 3300049570 | Ga0501033_0087408 | Ga0501033_0087408_838_2055 | 392 |
| 214 | 3300049571 | Ga0501034_0047908 | Ga0501034_0047908_2102_3319 | 392 |
| 215 | 3300049573 | Ga0501037_0002288 | Ga0501037_0002288_10116_11333 | 392 |
| 216 | 3300049574 | Ga0501038_0021768 | Ga0501038_0021768_616_1833 | 392 |
| 217 | 3300049575 | Ga0501039_0018252 | Ga0501039_0018252_2136_3353 | 392 |
| 218 | 3300049576 | Ga0501040_0008462 | Ga0501040_0008462_3700_4905 | 392 |
| 219 | 3300049577 | Ga0501041_0073298 | Ga0501041_0073298_186_1391 | 392 |
| 220 | 3300049579 | Ga0501043_0021880 | Ga0501043_0021880_1534_2751 | 392 |
| 221 | 3300049580 | Ga0501046_0003186 | Ga0501046_0003186_10893_12110 | 392 |
| 222 | 3300049583 | Ga0501067_0016596 | Ga0501067_0016596_1847_3064 | 392 |
| 223 | 3300049585 | Ga0501069_0014054 | Ga0501069_0014054_1630_2847 | 392 |
| 224 | 3300049585 | Ga0501069_0048789 | Ga0501069_0048789_231_1436 | 392 |
| 225 | 3300049588 | Ga0501072_0030314 | Ga0501072_0030314_2636_3841 | 392 |
| 226 | 3300049588 | Ga0501072_0110000 | Ga0501072_0110000_790_2007 | 392 |
| 227 | 3300049590 | Ga0501074_0034465 | Ga0501074_0034465_600_1817 | 392 |
| 228 | 3300049592 | Ga0501076_0017798 | Ga0501076_0017798_3843_5048 | 392 |
| 229 | 3300049741 | Ga0501079_0037154 | Ga0501079_0037154_1336_2553 | 392 |
| 230 | 3300049741 | Ga0501079_0065227 | Ga0501079_0065227_527_1732 | 392 |
| 231 | 3300049742 | Ga0501080_0018289 | Ga0501080_0018289_558_1775 | 392 |
| 232 | 3300049742 | Ga0501080_0202297 | Ga0501080_0202297_607_1812 | 392 |
| 233 | 3300049743 | Ga0501081_0040601 | Ga0501081_0040601_1816_3021 | 392 |
| 234 | 3300049822 | Ga0501035_0037621 | Ga0501035_0037621_1461_2678 | 392 |
| 235 | 3300049823 | Ga0501044_0022832 | Ga0501044_0022832_1122_2339 | 392 |
| 236 | 3300049824 | Ga0501045_0112648 | Ga0501045_0112648_694_1899 | 392 |
| 237 | 3300060353 | Ga0501082_0002632 | Ga0501082_0002632_12519_13736 | 392 |
| 238 | 3300060353 | Ga0501082_0099977 | Ga0501082_0099977_178_1383 | 392 |
| 239 | 3300061734 | Ga0530510_0006663 | Ga0530510_0006663_2311_3516 | 392 |
| 240 | 3300005985 | Ga0081539_10003769 | Ga0081539_1000376925 | 393 |
| 241 | 3300025935 | Ga0207709_10090709 | Ga0207709_100907091 | 393 |
| 242 | 3300025937 | Ga0207669_10201944 | Ga0207669_102019442 | 393 |
| 243 | 3300026075 | Ga0207708_10001594 | Ga0207708_1000159414 | 393 |
| 244 | 3300026118 | Ga0207675_100031309 | Ga0207675_1000313095 | 393 |
| 245 | 3300028379 | Ga0268266_10014029 | Ga0268266_100140294 | 393 |
| 246 | 3300032002 | Ga0307416_100205153 | Ga0307416_1002051532 | 393 |
| 247 | 3300032126 | Ga0307415_100076453 | Ga0307415_1000764533 | 393 |
| 248 | 3300042157 | Ga0439458_0012232 | Ga0439458_0012232_102_1310 | 393 |
| 249 | 3300044842 | Ga0466957_0161914 | Ga0466957_0161914_28_1254 | 393 |
| 250 | 3300045976 | Ga0466967_0021961 | Ga0466967_0021961_3417_4622 | 393 |
| 251 | 3300048903 | Ga0496100_0019689 | Ga0496100_0019689_662_1903 | 393 |
| 252 | 3300048904 | Ga0496101_0012031 | Ga0496101_0012031_667_1908 | 393 |
| 253 | 3300048909 | Ga0496106_0022410 | Ga0496106_0022410_1080_2321 | 393 |
| 254 | 3300048910 | Ga0496107_0010901 | Ga0496107_0010901_3750_4991 | 393 |
| 255 | 3300048918 | Ga0496115_0207042 | Ga0496115_0207042_179_1420 | 393 |
| 256 | 3300009147 | Ga0114129_10169063 | Ga0114129_101690633 | 394 |
| 257 | 3300031731 | Ga0307405_10202657 | Ga0307405_102026571 | 394 |
| 258 | 3300031852 | Ga0307410_10097449 | Ga0307410_100974493 | 394 |
| 259 | 3300031995 | Ga0307409_100171867 | Ga0307409_1001718672 | 394 |
| 260 | 3300045049 | Ga0466959_0148322 | Ga0466959_0148322_226_1455 | 394 |
| 261 | 3300045976 | Ga0466967_0130241 | Ga0466967_0130241_490_1698 | 394 |
| 262 | 3300046455 | Ga0495603_0001695 | Ga0495603_0001695_870_2066 | 394 |
| 263 | 3300050511 | nmdc:mga08y16_84929_c1 | nmdc:mga08y16_84929_c1_2036_3226 | 394 |
| 264 | 3300010375 | Ga0105239_10383364 | Ga0105239_103833642 | 395 |
| 265 | 3300025302 | Ga0207426_1016005 | Ga0207426_10160054 | 395 |
| 266 | 3300049575 | Ga0501039_0017664 | Ga0501039_0017664_17_1300 | 395 |
| 267 | 3300049592 | Ga0501076_0115977 | Ga0501076_0115977_192_1475 | 395 |
| 268 | 3300048912 | Ga0496109_0002735 | Ga0496109_0002735_716_1993 | 397 |
| 269 | 3300005842 | Ga0068858_100000091 | Ga0068858_1000000913 | 398 |
| 270 | 3300026035 | Ga0207703_10000152 | Ga0207703_100001525 | 398 |
| 271 | 3300046642 | Ga0495634_0000018 | Ga0495634_0000018_41005_42210 | 398 |
| 272 | 3300053104 | Ga0500556_0000817 | Ga0500556_0000817_3419_4690 | 398 |
| 273 | 3300053153 | Ga0500616_0018328 | Ga0500616_0018328_828_2099 | 398 |
| 274 | 3300005618 | Ga0068864_100000045 | Ga0068864_100000045128 | 399 |
| 275 | 3300005718 | Ga0068866_10056196 | Ga0068866_100561962 | 399 |
| 276 | 3300005840 | Ga0068870_10082224 | Ga0068870_100822241 | 399 |
| 277 | 3300005981 | Ga0081538_10001885 | Ga0081538_100018856 | 399 |
| 278 | 3300025901 | Ga0207688_10033803 | Ga0207688_100338032 | 399 |
| 279 | 3300026075 | Ga0207708_10010204 | Ga0207708_100102045 | 399 |
| 280 | 3300026095 | Ga0207676_10000016 | Ga0207676_1000001636 | 399 |
| 281 | 3300048911 | Ga0496108_0109964 | Ga0496108_0109964_69_1268 | 399 |
| 282 | 3300053085 | Ga0495619_0101174 | Ga0495619_0101174_208_1410 | 399 |
| 283 | 3300005356 | Ga0070674_100000008 | Ga0070674_10000000831 | 400 |
| 284 | 3300025899 | Ga0207642_10000122 | Ga0207642_1000012217 | 400 |
| 285 | 3300025937 | Ga0207669_10000004 | Ga0207669_10000004177 | 400 |
| 286 | 3300001977 | JGI24746J21847_1000167 | JGI24746J21847_10001674 | 401 |
| 287 | 3300005329 | Ga0070683_100052890 | Ga0070683_1000528903 | 401 |
| 288 | 3300005333 | Ga0070677_10000004 | Ga0070677_1000000428 | 401 |
| 289 | 3300005614 | Ga0068856_100026071 | Ga0068856_1000260712 | 401 |
| 290 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011112 | 401 |
| 291 | 3300009553 | Ga0105249_10000068 | Ga0105249_10000068134 | 401 |
| 292 | 3300013104 | Ga0157370_10016361 | Ga0157370_100163612 | 401 |
| 293 | 3300014968 | Ga0157379_10001717 | Ga0157379_1000171710 | 401 |
| 294 | 3300025944 | Ga0207661_10028900 | Ga0207661_100289002 | 401 |
| 295 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007286 | 401 |
| 296 | 3300046690 | Ga0495624_0000008 | Ga0495624_0000008_63458_64687 | 401 |
| 297 | 3300048913 | Ga0496110_0020943 | Ga0496110_0020943_3650_4876 | 401 |
| 298 | 3300053085 | Ga0495619_0009846 | Ga0495619_0009846_2495_3721 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h7z-assembly1.cif.gz_A-2 | trna-guanine transglycosylase y106f, c158v mutant in complex with guanine | 0.9719 | 7 | 394 |
| 3bl3-assembly1.cif.gz_A-2 | trna guanine transglycosylase v233g mutant apo structure | 0.9712 | 6 | 394 |
| 4gcx-assembly1.cif.gz_A-2 | trna-guanine transglycosylase y106f, c158v, v233g mutant in complex with preq1 | 0.9707 | 7 | 394 |
| 4ipp-assembly1.cif.gz_A-2 | trna-guanine-transglycosylase (tgt) mutant v262d apo-structure | 0.9704 | 7 | 394 |
| 3tll-assembly1.cif.gz_A-2 | trna-guanine transglycosylase in complex with n-ethyl-lin-benzoguanine inhibitor | 0.9703 | 7 | 394 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ashB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like | 0.9613 | 10 | 396 | 3.20.20.105 |
| 2ashB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like | 0.9561 | 10 | 396 | 3.20.20.105 |
| 4jbrA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like | 0.954 | 7 | 394 | 3.20.20.105 |
| af_Q23623_1_366_3.20.20.105 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like | 0.9478 | 9 | 400 | 3.20.20.105 |
| af_Q23623_1_366_3.20.20.105 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like | 0.9428 | 9 | 400 | 3.20.20.105 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C1EJ17-F1-model_v4 | tRNA-guanine transglycosylase (EC 2.4.2.-) | 0.9875 | 9 | 105 |
GO:0002099
GO:0005829 GO:0008616 GO:0016757 |
| AF-A0A660WIJ6-F1-model_v4 | tRNA guanosine(34) transglycosylase Tgt | 0.9869 | 8 | 104 |
GO:0002099
GO:0005829 GO:0008616 GO:0016757 |
| AF-A0A2H0P2F4-F1-model_v4 | tRNA guanosine(34) transglycosylase Tgt | 0.9852 | 9 | 105 |
GO:0002099
GO:0005829 GO:0008616 GO:0016757 |
| AF-A0A0S8JYH7-F1-model_v4 | Queuine tRNA-ribosyltransferase | 0.9827 | 8 | 99 |
GO:0005829
GO:0008479 GO:0101030 |
| AF-A0A3B8QC82-F1-model_v4 | tRNA guanosine(34) transglycosylase Tgt | 0.9823 | 8 | 99 |
GO:0002099
GO:0005829 GO:0008616 GO:0016757 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar