F394484

General Info

Members Datasets Scaffolds Average Seq Length
298 182 298 396

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0002735|Ga0496109_0002735_716_1993
Length 425
Sequence MSRPRTCFEITAKDPESRGRAGVITTAHGQVRTPAFVPLATKGTVKGLEPRDVRELGYDMVLGNTFHLMTTPGKELVREFGGLHKFMRWDGPIITDSGGFQVFSMGHGTIADEVKGRSAQSGAGRDGKTLGITEKGASFRSYLDGSKQFLSPEESMDVQAHLHSDIALVFDECTPFHVTKNYTDKSTERTHRWLERCLDWHAANGPDDQLVYGIVQGGVYEDLRTASARRIGESRCDGIAIGGSLGENKPQMYQVVDWATAVLPEDRPRHLLGIGDVDDLLRGVELGIDTFDCAMPTRLARHGVALVPEPDKRWRKDLTGSPFRHADEPIMEGCPCPTCREGFTRGYLAYLHRSKEQTGPRLLTLHNLAYTARLMADLRGALAEGRVGERIAELRAGDAPKVFFQPDGTPYPGAPPLGAETLAAA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 16.11
Rhizosphere 81.21
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000167 3300001977 Bacteria 8560
2 Ga0070683_100052890 3300005329 Bacteria 3763
3 Ga0070683_100122006 3300005329 Bacteria 2462
4 Ga0070677_10000004 3300005333 Bacteria 81101
5 Ga0070682_100003538 3300005337 Bacteria 8644
6 Ga0068868_100006368 3300005338 Bacteria 8349
7 Ga0068868_100034726 3300005338 Bacteria 3895
8 Ga0068868_100172146 3300005338 Bacteria 1793
9 Ga0070661_100083755 3300005344 Bacteria 2356
10 Ga0070669_100037424 3300005353 Bacteria 3520
11 Ga0070674_100000008 3300005356 Bacteria 143844
12 Ga0070659_100000030 3300005366 Bacteria 128662
13 Ga0070659_100113310 3300005366 Bacteria 2190
14 Ga0070659_100270601 3300005366 Bacteria 1411
15 Ga0070714_100000228 3300005435 Bacteria 44348
16 Ga0070714_100017001 3300005435 Bacteria 5885
17 Ga0070710_10000009 3300005437 Bacteria 165863
18 Ga0070701_10020586 3300005438 Bacteria 3135
19 Ga0070705_100003324 3300005440 Bacteria 7892
20 Ga0070685_10008302 3300005466 Bacteria 5331
21 Ga0070685_10024412 3300005466 Bacteria 3320
22 Ga0070679_100066773 3300005530 Bacteria 3586
23 Ga0070684_100001766 3300005535 Bacteria 15773
24 Ga0070684_100060447 3300005535 Bacteria 3314
25 Ga0070697_100127605 3300005536 Bacteria 2131
26 Ga0070664_100015011 3300005564 Bacteria 6323
27 Ga0070664_100137097 3300005564 Bacteria 2152
28 Ga0070664_100169424 3300005564 Bacteria 1937
29 Ga0068856_100026071 3300005614 Bacteria 5700
30 Ga0070702_100006498 3300005615 Bacteria 5540
31 Ga0068852_100079739 3300005616 Bacteria 2901
32 Ga0068859_100026595 3300005617 Bacteria 5802
33 Ga0068864_100000045 3300005618 Bacteria 154739
34 Ga0068866_10056196 3300005718 Bacteria 2024
35 Ga0068861_100024432 3300005719 Bacteria 4370
36 Ga0068870_10082224 3300005840 Bacteria 1783
37 Ga0068858_100000091 3300005842 Bacteria 93802
38 Ga0068858_100383029 3300005842 Bacteria 1350
39 Ga0081455_10063641 3300005937 Bacteria 3094
40 Ga0081538_10001885 3300005981 Bacteria 21119
41 Ga0081538_10097635 3300005981 Bacteria 1492
42 Ga0081540_1002568 3300005983 Bacteria 14732
43 Ga0081539_10003769 3300005985 Bacteria 17944
44 Ga0081539_10006119 3300005985 Bacteria 11731
45 Ga0081539_10009201 3300005985 Bacteria 8323
46 Ga0070717_10000013 3300006028 Bacteria 228046
47 Ga0070715_10038859 3300006163 Bacteria 1978
48 Ga0075431_100026586 3300006847 Bacteria 5937
49 Ga0075434_100052931 3300006871 Bacteria 4034
50 Ga0075436_100171822 3300006914 Bacteria 1530
51 Ga0097620_100026594 3300006931 Bacteria 5802
52 Ga0075435_100038300 3300007076 Bacteria 3822
53 Ga0105240_10060146 3300009093 Bacteria 4737
54 Ga0111539_10072012 3300009094 Bacteria 4077
55 Ga0105245_10014206 3300009098 Bacteria 6940
56 Ga0105245_10186812 3300009098 Bacteria 1983
57 Ga0114129_10169063 3300009147 Bacteria 2982
58 Ga0105243_10026794 3300009148 Bacteria 4414
59 Ga0105243_10307817 3300009148 Bacteria 1438
60 Ga0105248_10139918 3300009177 Bacteria 2730
61 Ga0105238_10000011 3300009551 Bacteria 261080
62 Ga0105249_10000068 3300009553 Bacteria 148594
63 Ga0105249_10199627 3300009553 Bacteria 1957
64 Ga0105239_10085557 3300010375 Bacteria 3475
65 Ga0105239_10141262 3300010375 Bacteria 2683
66 Ga0105239_10383364 3300010375 Bacteria 1589
67 Ga0157370_10016361 3300013104 Bacteria 7510
68 Ga0157374_10005737 3300013296 Bacteria 10475
69 Ga0157378_10132599 3300013297 Bacteria 2308
70 Ga0163162_10017994 3300013306 Bacteria 6917
71 Ga0157372_10007044 3300013307 Bacteria 11976
72 Ga0157372_10125859 3300013307 Bacteria 2946
73 Ga0157375_10140840 3300013308 Bacteria 2539
74 Ga0163163_10089506 3300014325 Bacteria 3090
75 Ga0163163_10137755 3300014325 Bacteria 2482
76 Ga0163163_10262623 3300014325 Bacteria 1778
77 Ga0157377_10009314 3300014745 Bacteria 4811
78 Ga0157377_10126375 3300014745 Bacteria 1556
79 Ga0157379_10001717 3300014968 Bacteria 18137
80 Ga0157379_10003199 3300014968 Bacteria 13872
81 Ga0157376_10177076 3300014969 Bacteria 1946
82 Ga0213876_10031180 3300021384 Bacteria 2814
83 Ga0207426_1016005 3300025302 Bacteria 2706
84 Ga0207692_10000005 3300025898 Bacteria 370169
85 Ga0207642_10000122 3300025899 Bacteria 21318
86 Ga0207710_10060902 3300025900 Bacteria 1712
87 Ga0207688_10000574 3300025901 Bacteria 18050
88 Ga0207688_10033803 3300025901 Bacteria 2829
89 Ga0207680_10228785 3300025903 Bacteria 1277
90 Ga0207685_10025192 3300025905 Bacteria 2050
91 Ga0207643_10078996 3300025908 Bacteria 1904
92 Ga0207657_10054144 3300025919 Bacteria 3472
93 Ga0207652_10191342 3300025921 Bacteria 1840
94 Ga0207681_10034866 3300025923 Bacteria 3312
95 Ga0207650_10258790 3300025925 Bacteria 1411
96 Ga0207687_10099575 3300025927 Bacteria 2136
97 Ga0207664_10000060 3300025929 Bacteria 116764
98 Ga0207664_10002198 3300025929 Bacteria 12845
99 Ga0207690_10000094 3300025932 Bacteria 74114
100 Ga0207690_10043206 3300025932 Bacteria 2965
101 Ga0207706_10010294 3300025933 Bacteria 8551
102 Ga0207709_10090709 3300025935 Bacteria 1997
103 Ga0207669_10000004 3300025937 Bacteria 196828
104 Ga0207669_10201944 3300025937 Bacteria 1444
105 Ga0207704_10051510 3300025938 Bacteria 2490
106 Ga0207691_10071389 3300025940 Bacteria 3133
107 Ga0207661_10020801 3300025944 Bacteria 4910
108 Ga0207661_10028900 3300025944 Bacteria 4251
109 Ga0207661_10091090 3300025944 Bacteria 2540
110 Ga0207679_10009479 3300025945 Bacteria 6239
111 Ga0207712_10000007 3300025961 Bacteria 539589
112 Ga0207712_10032025 3300025961 Bacteria 3546
113 Ga0207668_10056215 3300025972 Bacteria 2740
114 Ga0207703_10000152 3300026035 Bacteria 79658
115 Ga0207703_10038120 3300026035 Bacteria 3833
116 Ga0207708_10001047 3300026075 Bacteria 20695
117 Ga0207708_10001594 3300026075 Bacteria 16904
118 Ga0207708_10010204 3300026075 Bacteria 6972
119 Ga0207708_10158961 3300026075 Bacteria 1784
120 Ga0207648_10076303 3300026089 Bacteria 2922
121 Ga0207676_10000016 3300026095 Bacteria 311561
122 Ga0207674_10107384 3300026116 Bacteria 2768
123 Ga0207675_100031309 3300026118 Bacteria 4956
124 Ga0207675_100089357 3300026118 Bacteria 2895
125 Ga0207675_100165730 3300026118 Bacteria 2110
126 Ga0207683_10031809 3300026121 Bacteria 4581
127 Ga0207698_10049958 3300026142 Bacteria 3187
128 Ga0268266_10014029 3300028379 Bacteria 6898
129 Ga0268264_10074161 3300028381 Bacteria 2890
130 Ga0265326_10000024 3300028558 Bacteria 112928
131 Ga0265319_1000015 3300028563 Bacteria 176382
132 Ga0265334_10000151 3300028573 Bacteria 42917
133 Ga0265336_10000622 3300028666 Bacteria 19519
134 Ga0265338_10024213 3300028800 Bacteria 6210
135 Ga0265324_10038893 3300029957 Bacteria 1649
136 Ga0265320_10011515 3300031240 Bacteria 5201
137 Ga0307405_10202657 3300031731 Bacteria 1442
138 Ga0307413_10178203 3300031824 Bacteria 1512
139 Ga0307410_10060703 3300031852 Bacteria 2585
140 Ga0307410_10097449 3300031852 Bacteria 2101
141 Ga0307407_10008266 3300031903 Bacteria 4766
142 Ga0307409_100171867 3300031995 Bacteria 1908
143 Ga0307416_100004052 3300032002 Bacteria 8756
144 Ga0307416_100088932 3300032002 Bacteria 2643
145 Ga0307416_100205153 3300032002 Bacteria 1874
146 Ga0307415_100076453 3300032126 Bacteria 2374
147 Ga0307415_100159640 3300032126 Bacteria 1746
148 Ga0395901_0003040 3300038443 Bacteria 16908
149 Ga0395901_0140354 3300038443 Bacteria 2540
150 Ga0395901_0208408 3300038443 Bacteria 2047
151 Ga0436365_1102419 3300039437 Bacteria 6206
152 Ga0436365_1135292 3300039437 Bacteria 3311
153 Ga0439458_0012232 3300042157 Bacteria 1924
154 Ga0466972_0040215 3300044658 Bacteria 2278
155 Ga0466965_0005709 3300044683 Bacteria 5612
156 Ga0466966_0057024 3300044684 Bacteria 2470
157 Ga0466966_0058671 3300044684 Bacteria 2432
158 Ga0466961_0001354 3300044693 Bacteria 15106
159 Ga0466961_0116837 3300044693 Bacteria 1676
160 Ga0466963_0003004 3300044694 Bacteria 9545
161 Ga0466963_0045376 3300044694 Bacteria 2895
162 Ga0466957_0013995 3300044842 Bacteria 4666
163 Ga0466957_0052706 3300044842 Bacteria 2478
164 Ga0466957_0161914 3300044842 Bacteria 1454
165 Ga0466960_0030467 3300044901 Bacteria 2483
166 Ga0466959_0006088 3300045049 Bacteria 8327
167 Ga0466959_0016350 3300045049 Bacteria 5420
168 Ga0466959_0148322 3300045049 Bacteria 1655
169 Ga0466958_0003716 3300045836 Bacteria 7970
170 Ga0466958_0124537 3300045836 Bacteria 1615
171 Ga0466967_0008361 3300045976 Bacteria 7573
172 Ga0466967_0021961 3300045976 Bacteria 5196
173 Ga0466967_0025317 3300045976 Bacteria 4891
174 Ga0466967_0026024 3300045976 Bacteria 4837
175 Ga0466967_0062719 3300045976 Bacteria 3300
176 Ga0466967_0096182 3300045976 Bacteria 2701
177 Ga0466967_0112085 3300045976 Bacteria 2508
178 Ga0466967_0130241 3300045976 Bacteria 2334
179 Ga0466967_0173342 3300045976 Bacteria 2031
180 Ga0466967_0185593 3300045976 Bacteria 1964
181 Ga0495603_0001695 3300046455 Bacteria 12959
182 Ga0495650_0000055 3300046471 Bacteria 308438
183 Ga0495628_0158422 3300046516 Bacteria 1721
184 Ga0495630_0000541 3300046517 Bacteria 27642
185 Ga0495630_0051778 3300046517 Bacteria 3073
186 Ga0495652_0219948 3300046529 Bacteria 1428
187 Ga0495656_0000483 3300046615 Bacteria 12964
188 Ga0495634_0000018 3300046642 Bacteria 121323
189 Ga0495624_0000008 3300046690 Bacteria 145035
190 Ga0496100_0000463 3300048903 Bacteria 19446
191 Ga0496100_0019689 3300048903 Bacteria 4032
192 Ga0496101_0001372 3300048904 Bacteria 14597
193 Ga0496101_0012031 3300048904 Bacteria 5765
194 Ga0496101_0133614 3300048904 Bacteria 1886
195 Ga0496102_0008834 3300048905 Bacteria 8644
196 Ga0496103_0100711 3300048906 Bacteria 1828
197 Ga0496104_0016956 3300048907 Bacteria 6625
198 Ga0496104_0021884 3300048907 Bacteria 5872
199 Ga0496104_0088965 3300048907 Bacteria 2950
200 Ga0496105_0014384 3300048908 Bacteria 6298
201 Ga0496105_0086528 3300048908 Bacteria 2590
202 Ga0496106_0017611 3300048909 Bacteria 5285
203 Ga0496106_0022410 3300048909 Bacteria 4691
204 Ga0496106_0121098 3300048909 Bacteria 2045
205 Ga0496106_0332841 3300048909 Bacteria 1219
206 Ga0496106_0390980 3300048909 Bacteria 1118
207 Ga0496107_0010901 3300048910 Bacteria 6323
208 Ga0496107_0121514 3300048910 Bacteria 1924
209 Ga0496108_0000502 3300048911 Bacteria 30918
210 Ga0496108_0000747 3300048911 Bacteria 25332
211 Ga0496108_0001172 3300048911 Bacteria 20452
212 Ga0496108_0038026 3300048911 Bacteria 4009
213 Ga0496108_0109964 3300048911 Bacteria 2356
214 Ga0496108_0151467 3300048911 Bacteria 2001
215 Ga0496109_0001311 3300048912 Bacteria 20538
216 Ga0496109_0002735 3300048912 Bacteria 14785
217 Ga0496109_0008677 3300048912 Bacteria 8651
218 Ga0496109_0029158 3300048912 Bacteria 4941
219 Ga0496109_0052250 3300048912 Bacteria 3724
220 Ga0496109_0052502 3300048912 Bacteria 3716
221 Ga0496109_0185011 3300048912 Bacteria 1957
222 Ga0496110_0001949 3300048913 Bacteria 15306
223 Ga0496110_0020943 3300048913 Bacteria 5525
224 Ga0496110_0209154 3300048913 Bacteria 1773
225 Ga0496110_0266800 3300048913 Bacteria 1558
226 Ga0496111_0027914 3300048914 Bacteria 3997
227 Ga0496112_0021308 3300048915 Bacteria 6162
228 Ga0496112_0061498 3300048915 Bacteria 3702
229 Ga0496112_0065189 3300048915 Bacteria 3594
230 Ga0496112_0069486 3300048915 Bacteria 3479
231 Ga0496113_0015774 3300048916 Bacteria 5204
232 Ga0496113_0086735 3300048916 Bacteria 2405
233 Ga0496113_0129764 3300048916 Bacteria 1977
234 Ga0496113_0223387 3300048916 Bacteria 1501
235 Ga0496114_0099301 3300048917 Bacteria 2483
236 Ga0496114_0366874 3300048917 Bacteria 1274
237 Ga0496115_0207042 3300048918 Bacteria 1620
238 Ga0496121_0002905 3300048924 Bacteria 25149
239 Ga0496121_0110891 3300048924 Bacteria 2093
240 Ga0501031_0041151 3300049568 Bacteria 3017
241 Ga0501032_0074642 3300049569 Bacteria 2259
242 Ga0501033_0087408 3300049570 Bacteria 2281
243 Ga0501034_0047908 3300049571 Bacteria 4313
244 Ga0501036_0059054 3300049572 Bacteria 3250
245 Ga0501037_0002288 3300049573 Bacteria 13821
246 Ga0501038_0021768 3300049574 Bacteria 5753
247 Ga0501039_0017664 3300049575 Bacteria 5472
248 Ga0501039_0018252 3300049575 Bacteria 5384
249 Ga0501039_0044956 3300049575 Bacteria 3411
250 Ga0501039_0068327 3300049575 Bacteria 2759
251 Ga0501040_0008462 3300049576 Bacteria 6684
252 Ga0501040_0114933 3300049576 Bacteria 1884
253 Ga0501041_0073298 3300049577 Bacteria 2104
254 Ga0501042_0017188 3300049578 Bacteria 4985
255 Ga0501042_0036751 3300049578 Bacteria 3475
256 Ga0501043_0021880 3300049579 Bacteria 5014
257 Ga0501046_0003186 3300049580 Bacteria 15124
258 Ga0501047_0095871 3300049581 Bacteria 2845
259 Ga0501067_0016596 3300049583 Bacteria 4069
260 Ga0501069_0014054 3300049585 Bacteria 4276
261 Ga0501069_0048789 3300049585 Bacteria 2352
262 Ga0501069_0062735 3300049585 Bacteria 2075
263 Ga0501071_0022151 3300049587 Bacteria 4428
264 Ga0501071_0027237 3300049587 Bacteria 4020
265 Ga0501072_0030314 3300049588 Bacteria 4230
266 Ga0501072_0050104 3300049588 Bacteria 3288
267 Ga0501072_0110000 3300049588 Bacteria 2193
268 Ga0501074_0034465 3300049590 Bacteria 3669
269 Ga0501076_0017798 3300049592 Bacteria 5403
270 Ga0501076_0115977 3300049592 Bacteria 2167
271 Ga0501079_0037154 3300049741 Bacteria 3753
272 Ga0501079_0065227 3300049741 Bacteria 2809
273 Ga0501079_0082233 3300049741 Bacteria 2491
274 Ga0501079_0139584 3300049741 Bacteria 1888
275 Ga0501080_0018289 3300049742 Bacteria 6486
276 Ga0501080_0024187 3300049742 Bacteria 5632
277 Ga0501080_0202297 3300049742 Bacteria 1823
278 Ga0501081_0040601 3300049743 Bacteria 3186
279 Ga0501035_0037621 3300049822 Bacteria 4381
280 Ga0501035_0066178 3300049822 Bacteria 3208
281 Ga0501044_0022832 3300049823 Bacteria 6664
282 Ga0501044_0179627 3300049823 Bacteria 2084
283 Ga0501045_0112648 3300049824 Bacteria 2017
284 nmdc:mga09592_17372_c1 3300050508 Bacteria 5894
285 nmdc:mga0qj67_18969_c1 3300050509 Bacteria 5248
286 nmdc:mga08y16_56208_c1 3300050511 Bacteria 4113
287 nmdc:mga08y16_84929_c1 3300050511 Bacteria 3299
288 nmdc:mga0n895_259446_c1 3300050512 Bacteria 1764
289 nmdc:mga08x19_150271_c1 3300050514 Bacteria 1577
290 nmdc:mga0a205_540_c1 3300050515 Bacteria 29856
291 Ga0495619_0009846 3300053085 Bacteria 6024
292 Ga0495619_0101174 3300053085 Bacteria 1962
293 Ga0500556_0000817 3300053104 Bacteria 17987
294 Ga0500616_0018328 3300053153 Bacteria 3960
295 Ga0501082_0002632 3300060353 Bacteria 15690
296 Ga0501082_0099977 3300060353 Bacteria 2508
297 Ga0466962_0041225 3300061719 Bacteria 2209
298 Ga0530510_0006663 3300061734 Bacteria 8055

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0052502 Ga0496109_0052502_2676_3704 329
2 3300048917 Ga0496114_0366874 Ga0496114_0366874_13_1041 329
3 3300048909 Ga0496106_0390980 Ga0496106_0390980_44_1099 338
4 3300046516 Ga0495628_0158422 Ga0495628_0158422_654_1679 341
5 3300050515 nmdc:mga0a205_540_c1 nmdc:mga0a205_540_c1_19564_20613 345
6 3300028558 Ga0265326_10000024 Ga0265326_10000024101 346
7 3300028573 Ga0265334_10000151 Ga0265334_1000015133 346
8 3300028666 Ga0265336_10000622 Ga0265336_1000062216 346
9 3300028800 Ga0265338_10024213 Ga0265338_100242133 346
10 3300029957 Ga0265324_10038893 Ga0265324_100388932 346
11 3300049581 Ga0501047_0095871 Ga0501047_0095871_1385_2446 348
12 3300049823 Ga0501044_0179627 Ga0501044_0179627_279_1340 348
13 3300048911 Ga0496108_0000502 Ga0496108_0000502_4674_5750 351
14 3300046517 Ga0495630_0000541 Ga0495630_0000541_6982_8043 353
15 3300014969 Ga0157376_10177076 Ga0157376_101770762 354
16 3300048906 Ga0496103_0100711 Ga0496103_0100711_480_1559 354
17 3300048912 Ga0496109_0029158 Ga0496109_0029158_3645_4889 354
18 3300006028 Ga0070717_10000013 Ga0070717_1000001349 357
19 3300046471 Ga0495650_0000055 Ga0495650_0000055_9604_10794 357
20 3300048911 Ga0496108_0151467 Ga0496108_0151467_697_1941 357
21 3300005353 Ga0070669_100037424 Ga0070669_1000374242 360
22 3300005435 Ga0070714_100017001 Ga0070714_1000170013 360
23 3300025923 Ga0207681_10034866 Ga0207681_100348662 360
24 3300039437 Ga0436365_1135292 Ga0436365_1135292_1014_2171 361
25 3300025929 Ga0207664_10002198 Ga0207664_1000219811 362
26 3300045976 Ga0466967_0062719 Ga0466967_0062719_1949_3091 363
27 3300025944 Ga0207661_10020801 Ga0207661_100208012 364
28 3300005564 Ga0070664_100137097 Ga0070664_1001370972 365
29 3300009098 Ga0105245_10186812 Ga0105245_101868122 365
30 3300025932 Ga0207690_10043206 Ga0207690_100432063 365
31 3300005366 Ga0070659_100000030 Ga0070659_10000003079 366
32 3300005981 Ga0081538_10097635 Ga0081538_100976351 366
33 3300025932 Ga0207690_10000094 Ga0207690_1000009462 366
34 3300046517 Ga0495630_0051778 Ga0495630_0051778_867_1979 370
35 3300048916 Ga0496113_0129764 Ga0496113_0129764_318_1529 370
36 3300005338 Ga0068868_100034726 Ga0068868_1000347262 371
37 3300025925 Ga0207650_10258790 Ga0207650_102587901 371
38 3300031852 Ga0307410_10060703 Ga0307410_100607032 371
39 3300031903 Ga0307407_10008266 Ga0307407_100082662 371
40 3300032002 Ga0307416_100004052 Ga0307416_1000040527 371
41 3300032126 Ga0307415_100159640 Ga0307415_1001596402 371
42 3300044842 Ga0466957_0052706 Ga0466957_0052706_1178_2386 376
43 3300046529 Ga0495652_0219948 Ga0495652_0219948_77_1282 376
44 3300048924 Ga0496121_0002905 Ga0496121_0002905_23309_24541 376
45 3300005435 Ga0070714_100000228 Ga0070714_1000002289 378
46 3300025929 Ga0207664_10000060 Ga0207664_100000609 378
47 3300046615 Ga0495656_0000483 Ga0495656_0000483_11409_12548 378
48 3300010375 Ga0105239_10141262 Ga0105239_101412622 379
49 3300044684 Ga0466966_0058671 Ga0466966_0058671_561_1748 379
50 3300048911 Ga0496108_0001172 Ga0496108_0001172_14124_15275 379
51 3300048912 Ga0496109_0001311 Ga0496109_0001311_14204_15355 379
52 3300005437 Ga0070710_10000009 Ga0070710_10000009120 380
53 3300025898 Ga0207692_10000005 Ga0207692_10000005207 380
54 3300050514 nmdc:mga08x19_150271_c1 nmdc:mga08x19_150271_c1_64_1272 382
55 3300005440 Ga0070705_100003324 Ga0070705_1000033244 383
56 3300026075 Ga0207708_10158961 Ga0207708_101589611 383
57 3300049588 Ga0501072_0050104 Ga0501072_0050104_91_1290 383
58 3300050508 nmdc:mga09592_17372_c1 nmdc:mga09592_17372_c1_2721_3932 383
59 3300049578 Ga0501042_0036751 Ga0501042_0036751_2243_3445 384
60 3300005536 Ga0070697_100127605 Ga0070697_1001276052 385
61 3300009093 Ga0105240_10060146 Ga0105240_100601462 385
62 3300044658 Ga0466972_0040215 Ga0466972_0040215_266_1480 385
63 3300044683 Ga0466965_0005709 Ga0466965_0005709_1227_2441 385
64 3300044693 Ga0466961_0116837 Ga0466961_0116837_380_1567 385
65 3300044694 Ga0466963_0003004 Ga0466963_0003004_6259_7446 385
66 3300045049 Ga0466959_0006088 Ga0466959_0006088_1815_3002 385
67 3300045836 Ga0466958_0003716 Ga0466958_0003716_512_1699 385
68 3300048911 Ga0496108_0038026 Ga0496108_0038026_1793_2971 385
69 3300021384 Ga0213876_10031180 Ga0213876_100311801 386
70 3300039437 Ga0436365_1102419 Ga0436365_1102419_4956_6164 386
71 3300048909 Ga0496106_0332841 Ga0496106_0332841_17_1201 386
72 3300025940 Ga0207691_10071389 Ga0207691_100713892 387
73 3300005530 Ga0070679_100066773 Ga0070679_1000667735 388
74 3300014325 Ga0163163_10262623 Ga0163163_102626233 388
75 3300025919 Ga0207657_10054144 Ga0207657_100541443 388
76 3300025921 Ga0207652_10191342 Ga0207652_101913422 388
77 3300038443 Ga0395901_0003040 Ga0395901_0003040_11676_12863 388
78 3300044684 Ga0466966_0057024 Ga0466966_0057024_177_1409 388
79 3300045049 Ga0466959_0016350 Ga0466959_0016350_3604_4821 388
80 3300045836 Ga0466958_0124537 Ga0466958_0124537_240_1463 388
81 3300045976 Ga0466967_0025317 Ga0466967_0025317_182_1417 388
82 3300048907 Ga0496104_0088965 Ga0496104_0088965_89_1276 388
83 3300048908 Ga0496105_0014384 Ga0496105_0014384_3010_4197 388
84 3300048912 Ga0496109_0052250 Ga0496109_0052250_920_2107 388
85 3300048915 Ga0496112_0061498 Ga0496112_0061498_237_1424 388
86 3300048915 Ga0496112_0069486 Ga0496112_0069486_733_1920 388
87 3300061719 Ga0466962_0041225 Ga0466962_0041225_147_1370 388
88 3300031824 Ga0307413_10178203 Ga0307413_101782032 389
89 3300038443 Ga0395901_0140354 Ga0395901_0140354_1129_2325 389
90 3300049585 Ga0501069_0062735 Ga0501069_0062735_541_1731 389
91 3300049741 Ga0501079_0082233 Ga0501079_0082233_546_1736 389
92 3300049742 Ga0501080_0024187 Ga0501080_0024187_3370_4560 389
93 3300050509 nmdc:mga0qj67_18969_c1 nmdc:mga0qj67_18969_c1_278_1468 389
94 3300009094 Ga0111539_10072012 Ga0111539_100720123 390
95 3300014968 Ga0157379_10003199 Ga0157379_100031999 390
96 3300044693 Ga0466961_0001354 Ga0466961_0001354_12703_13920 390
97 3300048924 Ga0496121_0110891 Ga0496121_0110891_453_1652 390
98 3300049575 Ga0501039_0068327 Ga0501039_0068327_1100_2299 390
99 3300050511 nmdc:mga08y16_56208_c1 nmdc:mga08y16_56208_c1_1001_2200 390
100 3300005337 Ga0070682_100003538 Ga0070682_1000035386 391
101 3300005338 Ga0068868_100006368 Ga0068868_1000063683 391
102 3300005344 Ga0070661_100083755 Ga0070661_1000837551 391
103 3300005466 Ga0070685_10008302 Ga0070685_100083023 391
104 3300005535 Ga0070684_100001766 Ga0070684_1000017666 391
105 3300005564 Ga0070664_100015011 Ga0070664_1000150115 391
106 3300005564 Ga0070664_100169424 Ga0070664_1001694241 391
107 3300005616 Ga0068852_100079739 Ga0068852_1000797394 391
108 3300005937 Ga0081455_10063641 Ga0081455_100636414 391
109 3300005983 Ga0081540_1002568 Ga0081540_10025682 391
110 3300005985 Ga0081539_10009201 Ga0081539_100092013 391
111 3300006847 Ga0075431_100026586 Ga0075431_1000265867 391
112 3300006871 Ga0075434_100052931 Ga0075434_1000529315 391
113 3300006914 Ga0075436_100171822 Ga0075436_1001718222 391
114 3300007076 Ga0075435_100038300 Ga0075435_1000383005 391
115 3300009098 Ga0105245_10014206 Ga0105245_100142067 391
116 3300009177 Ga0105248_10139918 Ga0105248_101399183 391
117 3300010375 Ga0105239_10085557 Ga0105239_100855574 391
118 3300013296 Ga0157374_10005737 Ga0157374_100057373 391
119 3300013307 Ga0157372_10007044 Ga0157372_100070443 391
120 3300013308 Ga0157375_10140840 Ga0157375_101408401 391
121 3300014325 Ga0163163_10137755 Ga0163163_101377552 391
122 3300014745 Ga0157377_10009314 Ga0157377_100093144 391
123 3300025901 Ga0207688_10000574 Ga0207688_1000057417 391
124 3300025933 Ga0207706_10010294 Ga0207706_100102944 391
125 3300025945 Ga0207679_10009479 Ga0207679_100094793 391
126 3300025972 Ga0207668_10056215 Ga0207668_100562152 391
127 3300026075 Ga0207708_10001047 Ga0207708_1000104719 391
128 3300026121 Ga0207683_10031809 Ga0207683_100318092 391
129 3300026142 Ga0207698_10049958 Ga0207698_100499582 391
130 3300044901 Ga0466960_0030467 Ga0466960_0030467_601_1797 391
131 3300048903 Ga0496100_0000463 Ga0496100_0000463_13122_14339 391
132 3300048904 Ga0496101_0001372 Ga0496101_0001372_3684_4901 391
133 3300048904 Ga0496101_0133614 Ga0496101_0133614_439_1635 391
134 3300048905 Ga0496102_0008834 Ga0496102_0008834_1268_2464 391
135 3300048907 Ga0496104_0016956 Ga0496104_0016956_45_1265 391
136 3300048907 Ga0496104_0021884 Ga0496104_0021884_3798_4994 391
137 3300048908 Ga0496105_0086528 Ga0496105_0086528_279_1499 391
138 3300048909 Ga0496106_0017611 Ga0496106_0017611_1434_2630 391
139 3300048911 Ga0496108_0000747 Ga0496108_0000747_23254_24450 391
140 3300048912 Ga0496109_0008677 Ga0496109_0008677_6483_7679 391
141 3300048912 Ga0496109_0185011 Ga0496109_0185011_99_1295 391
142 3300048913 Ga0496110_0001949 Ga0496110_0001949_5084_6280 391
143 3300048913 Ga0496110_0266800 Ga0496110_0266800_182_1378 391
144 3300048914 Ga0496111_0027914 Ga0496111_0027914_1888_3084 391
145 3300048915 Ga0496112_0021308 Ga0496112_0021308_1694_2890 391
146 3300048915 Ga0496112_0065189 Ga0496112_0065189_1285_2505 391
147 3300048916 Ga0496113_0015774 Ga0496113_0015774_3967_5187 391
148 3300048916 Ga0496113_0086735 Ga0496113_0086735_820_2016 391
149 3300048916 Ga0496113_0223387 Ga0496113_0223387_194_1390 391
150 3300049572 Ga0501036_0059054 Ga0501036_0059054_261_1448 391
151 3300049575 Ga0501039_0044956 Ga0501039_0044956_33_1220 391
152 3300049576 Ga0501040_0114933 Ga0501040_0114933_143_1345 391
153 3300049578 Ga0501042_0017188 Ga0501042_0017188_2490_3692 391
154 3300049587 Ga0501071_0022151 Ga0501071_0022151_1021_2223 391
155 3300049587 Ga0501071_0027237 Ga0501071_0027237_2775_3962 391
156 3300049741 Ga0501079_0139584 Ga0501079_0139584_294_1496 391
157 3300049822 Ga0501035_0066178 Ga0501035_0066178_875_2062 391
158 3300050512 nmdc:mga0n895_259446_c1 nmdc:mga0n895_259446_c1_475_1695 391
159 3300005329 Ga0070683_100122006 Ga0070683_1001220062 392
160 3300005338 Ga0068868_100172146 Ga0068868_1001721462 392
161 3300005366 Ga0070659_100113310 Ga0070659_1001133102 392
162 3300005366 Ga0070659_100270601 Ga0070659_1002706012 392
163 3300005438 Ga0070701_10020586 Ga0070701_100205862 392
164 3300005466 Ga0070685_10024412 Ga0070685_100244122 392
165 3300005535 Ga0070684_100060447 Ga0070684_1000604472 392
166 3300005615 Ga0070702_100006498 Ga0070702_1000064984 392
167 3300005617 Ga0068859_100026595 Ga0068859_1000265954 392
168 3300005719 Ga0068861_100024432 Ga0068861_1000244324 392
169 3300005842 Ga0068858_100383029 Ga0068858_1003830291 392
170 3300005985 Ga0081539_10006119 Ga0081539_100061197 392
171 3300006163 Ga0070715_10038859 Ga0070715_100388592 392
172 3300006931 Ga0097620_100026594 Ga0097620_1000265945 392
173 3300009148 Ga0105243_10026794 Ga0105243_100267942 392
174 3300009148 Ga0105243_10307817 Ga0105243_103078171 392
175 3300009553 Ga0105249_10199627 Ga0105249_101996272 392
176 3300013297 Ga0157378_10132599 Ga0157378_101325992 392
177 3300013306 Ga0163162_10017994 Ga0163162_100179944 392
178 3300013307 Ga0157372_10125859 Ga0157372_101258592 392
179 3300014325 Ga0163163_10089506 Ga0163163_100895062 392
180 3300014745 Ga0157377_10126375 Ga0157377_101263752 392
181 3300025900 Ga0207710_10060902 Ga0207710_100609022 392
182 3300025903 Ga0207680_10228785 Ga0207680_102287851 392
183 3300025905 Ga0207685_10025192 Ga0207685_100251922 392
184 3300025908 Ga0207643_10078996 Ga0207643_100789962 392
185 3300025927 Ga0207687_10099575 Ga0207687_100995752 392
186 3300025938 Ga0207704_10051510 Ga0207704_100515102 392
187 3300025944 Ga0207661_10091090 Ga0207661_100910902 392
188 3300025961 Ga0207712_10032025 Ga0207712_100320252 392
189 3300026035 Ga0207703_10038120 Ga0207703_100381201 392
190 3300026089 Ga0207648_10076303 Ga0207648_100763032 392
191 3300026116 Ga0207674_10107384 Ga0207674_101073842 392
192 3300026118 Ga0207675_100089357 Ga0207675_1000893572 392
193 3300026118 Ga0207675_100165730 Ga0207675_1001657302 392
194 3300028381 Ga0268264_10074161 Ga0268264_100741612 392
195 3300028563 Ga0265319_1000015 Ga0265319_100001561 392
196 3300031240 Ga0265320_10011515 Ga0265320_100115152 392
197 3300032002 Ga0307416_100088932 Ga0307416_1000889323 392
198 3300038443 Ga0395901_0208408 Ga0395901_0208408_702_1916 392
199 3300044694 Ga0466963_0045376 Ga0466963_0045376_162_1361 392
200 3300044842 Ga0466957_0013995 Ga0466957_0013995_2077_3276 392
201 3300045976 Ga0466967_0008361 Ga0466967_0008361_6176_7396 392
202 3300045976 Ga0466967_0026024 Ga0466967_0026024_537_1736 392
203 3300045976 Ga0466967_0096182 Ga0466967_0096182_405_1634 392
204 3300045976 Ga0466967_0112085 Ga0466967_0112085_1189_2388 392
205 3300045976 Ga0466967_0173342 Ga0466967_0173342_646_1857 392
206 3300045976 Ga0466967_0185593 Ga0466967_0185593_280_1500 392
207 3300048909 Ga0496106_0121098 Ga0496106_0121098_47_1246 392
208 3300048910 Ga0496107_0121514 Ga0496107_0121514_562_1761 392
209 3300048913 Ga0496110_0209154 Ga0496110_0209154_349_1548 392
210 3300048917 Ga0496114_0099301 Ga0496114_0099301_150_1349 392
211 3300049568 Ga0501031_0041151 Ga0501031_0041151_1733_2950 392
212 3300049569 Ga0501032_0074642 Ga0501032_0074642_97_1314 392
213 3300049570 Ga0501033_0087408 Ga0501033_0087408_838_2055 392
214 3300049571 Ga0501034_0047908 Ga0501034_0047908_2102_3319 392
215 3300049573 Ga0501037_0002288 Ga0501037_0002288_10116_11333 392
216 3300049574 Ga0501038_0021768 Ga0501038_0021768_616_1833 392
217 3300049575 Ga0501039_0018252 Ga0501039_0018252_2136_3353 392
218 3300049576 Ga0501040_0008462 Ga0501040_0008462_3700_4905 392
219 3300049577 Ga0501041_0073298 Ga0501041_0073298_186_1391 392
220 3300049579 Ga0501043_0021880 Ga0501043_0021880_1534_2751 392
221 3300049580 Ga0501046_0003186 Ga0501046_0003186_10893_12110 392
222 3300049583 Ga0501067_0016596 Ga0501067_0016596_1847_3064 392
223 3300049585 Ga0501069_0014054 Ga0501069_0014054_1630_2847 392
224 3300049585 Ga0501069_0048789 Ga0501069_0048789_231_1436 392
225 3300049588 Ga0501072_0030314 Ga0501072_0030314_2636_3841 392
226 3300049588 Ga0501072_0110000 Ga0501072_0110000_790_2007 392
227 3300049590 Ga0501074_0034465 Ga0501074_0034465_600_1817 392
228 3300049592 Ga0501076_0017798 Ga0501076_0017798_3843_5048 392
229 3300049741 Ga0501079_0037154 Ga0501079_0037154_1336_2553 392
230 3300049741 Ga0501079_0065227 Ga0501079_0065227_527_1732 392
231 3300049742 Ga0501080_0018289 Ga0501080_0018289_558_1775 392
232 3300049742 Ga0501080_0202297 Ga0501080_0202297_607_1812 392
233 3300049743 Ga0501081_0040601 Ga0501081_0040601_1816_3021 392
234 3300049822 Ga0501035_0037621 Ga0501035_0037621_1461_2678 392
235 3300049823 Ga0501044_0022832 Ga0501044_0022832_1122_2339 392
236 3300049824 Ga0501045_0112648 Ga0501045_0112648_694_1899 392
237 3300060353 Ga0501082_0002632 Ga0501082_0002632_12519_13736 392
238 3300060353 Ga0501082_0099977 Ga0501082_0099977_178_1383 392
239 3300061734 Ga0530510_0006663 Ga0530510_0006663_2311_3516 392
240 3300005985 Ga0081539_10003769 Ga0081539_1000376925 393
241 3300025935 Ga0207709_10090709 Ga0207709_100907091 393
242 3300025937 Ga0207669_10201944 Ga0207669_102019442 393
243 3300026075 Ga0207708_10001594 Ga0207708_1000159414 393
244 3300026118 Ga0207675_100031309 Ga0207675_1000313095 393
245 3300028379 Ga0268266_10014029 Ga0268266_100140294 393
246 3300032002 Ga0307416_100205153 Ga0307416_1002051532 393
247 3300032126 Ga0307415_100076453 Ga0307415_1000764533 393
248 3300042157 Ga0439458_0012232 Ga0439458_0012232_102_1310 393
249 3300044842 Ga0466957_0161914 Ga0466957_0161914_28_1254 393
250 3300045976 Ga0466967_0021961 Ga0466967_0021961_3417_4622 393
251 3300048903 Ga0496100_0019689 Ga0496100_0019689_662_1903 393
252 3300048904 Ga0496101_0012031 Ga0496101_0012031_667_1908 393
253 3300048909 Ga0496106_0022410 Ga0496106_0022410_1080_2321 393
254 3300048910 Ga0496107_0010901 Ga0496107_0010901_3750_4991 393
255 3300048918 Ga0496115_0207042 Ga0496115_0207042_179_1420 393
256 3300009147 Ga0114129_10169063 Ga0114129_101690633 394
257 3300031731 Ga0307405_10202657 Ga0307405_102026571 394
258 3300031852 Ga0307410_10097449 Ga0307410_100974493 394
259 3300031995 Ga0307409_100171867 Ga0307409_1001718672 394
260 3300045049 Ga0466959_0148322 Ga0466959_0148322_226_1455 394
261 3300045976 Ga0466967_0130241 Ga0466967_0130241_490_1698 394
262 3300046455 Ga0495603_0001695 Ga0495603_0001695_870_2066 394
263 3300050511 nmdc:mga08y16_84929_c1 nmdc:mga08y16_84929_c1_2036_3226 394
264 3300010375 Ga0105239_10383364 Ga0105239_103833642 395
265 3300025302 Ga0207426_1016005 Ga0207426_10160054 395
266 3300049575 Ga0501039_0017664 Ga0501039_0017664_17_1300 395
267 3300049592 Ga0501076_0115977 Ga0501076_0115977_192_1475 395
268 3300048912 Ga0496109_0002735 Ga0496109_0002735_716_1993 397
269 3300005842 Ga0068858_100000091 Ga0068858_1000000913 398
270 3300026035 Ga0207703_10000152 Ga0207703_100001525 398
271 3300046642 Ga0495634_0000018 Ga0495634_0000018_41005_42210 398
272 3300053104 Ga0500556_0000817 Ga0500556_0000817_3419_4690 398
273 3300053153 Ga0500616_0018328 Ga0500616_0018328_828_2099 398
274 3300005618 Ga0068864_100000045 Ga0068864_100000045128 399
275 3300005718 Ga0068866_10056196 Ga0068866_100561962 399
276 3300005840 Ga0068870_10082224 Ga0068870_100822241 399
277 3300005981 Ga0081538_10001885 Ga0081538_100018856 399
278 3300025901 Ga0207688_10033803 Ga0207688_100338032 399
279 3300026075 Ga0207708_10010204 Ga0207708_100102045 399
280 3300026095 Ga0207676_10000016 Ga0207676_1000001636 399
281 3300048911 Ga0496108_0109964 Ga0496108_0109964_69_1268 399
282 3300053085 Ga0495619_0101174 Ga0495619_0101174_208_1410 399
283 3300005356 Ga0070674_100000008 Ga0070674_10000000831 400
284 3300025899 Ga0207642_10000122 Ga0207642_1000012217 400
285 3300025937 Ga0207669_10000004 Ga0207669_10000004177 400
286 3300001977 JGI24746J21847_1000167 JGI24746J21847_10001674 401
287 3300005329 Ga0070683_100052890 Ga0070683_1000528903 401
288 3300005333 Ga0070677_10000004 Ga0070677_1000000428 401
289 3300005614 Ga0068856_100026071 Ga0068856_1000260712 401
290 3300009551 Ga0105238_10000011 Ga0105238_10000011112 401
291 3300009553 Ga0105249_10000068 Ga0105249_10000068134 401
292 3300013104 Ga0157370_10016361 Ga0157370_100163612 401
293 3300014968 Ga0157379_10001717 Ga0157379_1000171710 401
294 3300025944 Ga0207661_10028900 Ga0207661_100289002 401
295 3300025961 Ga0207712_10000007 Ga0207712_10000007286 401
296 3300046690 Ga0495624_0000008 Ga0495624_0000008_63458_64687 401
297 3300048913 Ga0496110_0020943 Ga0496110_0020943_3650_4876 401
298 3300053085 Ga0495619_0009846 Ga0495619_0009846_2495_3721 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01702

TGT

Queuine tRNA-ribosyltransferase

14

398

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h7z-assembly1.cif.gz_A-2 trna-guanine transglycosylase y106f, c158v mutant in complex with guanine 0.9719 7 394
3bl3-assembly1.cif.gz_A-2 trna guanine transglycosylase v233g mutant apo structure 0.9712 6 394
4gcx-assembly1.cif.gz_A-2 trna-guanine transglycosylase y106f, c158v, v233g mutant in complex with preq1 0.9707 7 394
4ipp-assembly1.cif.gz_A-2 trna-guanine-transglycosylase (tgt) mutant v262d apo-structure 0.9704 7 394
3tll-assembly1.cif.gz_A-2 trna-guanine transglycosylase in complex with n-ethyl-lin-benzoguanine inhibitor 0.9703 7 394
ID Description Score Start End Superfamily
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9613 10 396 3.20.20.105
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9561 10 396 3.20.20.105
4jbrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.954 7 394 3.20.20.105
af_Q23623_1_366_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9478 9 400 3.20.20.105
af_Q23623_1_366_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9428 9 400 3.20.20.105
ID Description Score Start End GO Terms
AF-A0A7C1EJ17-F1-model_v4 tRNA-guanine transglycosylase (EC 2.4.2.-) 0.9875 9 105 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A660WIJ6-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt 0.9869 8 104 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A2H0P2F4-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt 0.9852 9 105 GO:0002099
GO:0005829
GO:0008616
GO:0016757
AF-A0A0S8JYH7-F1-model_v4 Queuine tRNA-ribosyltransferase 0.9827 8 99 GO:0005829
GO:0008479
GO:0101030
AF-A0A3B8QC82-F1-model_v4 tRNA guanosine(34) transglycosylase Tgt 0.9823 8 99 GO:0002099
GO:0005829
GO:0008616
GO:0016757

Feature Viewer

pLDDT pTM Quality
90.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map