F394294

General Info

Members Datasets Scaffolds Average Seq Length
298 174 596 340

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10011810|Ga0213872_100118103
Length 377
Sequence MLLCLISMIHMSTQAKSNLGYRAQSTSSRIVTEQTESALMTLSLSVSPLSLPLKHPFKIARGEETVAKTALVRVRYGDLEGLGEATPIERYGESVASIVAYFAQHPPALDDPYRLEDLLHDGIPPAARAGLDLALHDIIGKDLDMPLYALLGLDPSATPYTSFTIGIADPETTLRKLAEIGDHPVLKVKLGIGSAAEQIETIEAIRARYTGTIRIDANEGWDVESAIAILRELERLDIEFCEQPIPAGSPDGLRAIRERTSIGIVTDEDSIDARDLPRLYGCVDGVNVKLAKTGGIRGALAMIHTARALGMKVMLGCMVESAIAATAAAHLSPLVDWADVDGPFLTASDPFVGVTYDRGKLVLPDGPGLGVHEVVAA

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.09
Rhizosphere 80.54
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10011810 3300021361 Archaea 4127
2 JGI25406J46586_10004018 3300003203 Bacteria 6882
3 Ga0070683_100001562 3300005329 Bacteria 17691
4 Ga0070683_100179945 3300005329 Bacteria 2007
5 Ga0070680_100137221 3300005336 Bacteria 2049
6 Ga0070668_100304342 3300005347 Unclassified 1338
7 Ga0070714_100001456 3300005435 Bacteria 17256
8 Ga0070714_100032503 3300005435 Bacteria 4355
9 Ga0070714_100040632 3300005435 Bacteria 3920
10 Ga0070714_100126834 3300005435 Bacteria 2276
11 Ga0070714_100149952 3300005435 Bacteria 2100
12 Ga0070714_100159473 3300005435 Unclassified 2040
13 Ga0070714_100220013 3300005435 Bacteria 1745
14 Ga0070711_100060806 3300005439 Bacteria 2627
15 Ga0070700_100091465 3300005441 Bacteria 1986
16 Ga0070663_100172050 3300005455 Bacteria 1675
17 Ga0070662_100145808 3300005457 Bacteria 1839
18 Ga0070685_10081848 3300005466 Bacteria 1937
19 Ga0070679_100070646 3300005530 Archaea 3483
20 Ga0070684_100000711 3300005535 Bacteria 23042
21 Ga0070684_100031529 3300005535 Archaea 4513
22 Ga0070684_100045185 3300005535 Bacteria 3813
23 Ga0070665_100200002 3300005548 Bacteria 1999
24 Ga0068855_100000687 3300005563 Bacteria 41298
25 Ga0068855_100012617 3300005563 Bacteria 10198
26 Ga0068855_100015303 3300005563 Bacteria 9236
27 Ga0068855_100062272 3300005563 Bacteria 4355
28 Ga0068857_100000826 3300005577 Bacteria 23197
29 Ga0068854_100000002 3300005578 Bacteria 362695
30 Ga0068856_100038349 3300005614 Bacteria 4704
31 Ga0068856_100053734 3300005614 Archaea 3972
32 Ga0068861_100261057 3300005719 Unclassified 1483
33 Ga0081538_10005683 3300005981 Bacteria 11158
34 Ga0081538_10023943 3300005981 Bacteria 4369
35 Ga0081538_10070613 3300005981 Bacteria 1927
36 Ga0081539_10000185 3300005985 Bacteria 147755
37 Ga0081539_10008114 3300005985 Bacteria 9275
38 Ga0070717_10024434 3300006028 Bacteria 4799
39 Ga0070717_10029171 3300006028 Bacteria 4423
40 Ga0070712_100023605 3300006175 Bacteria 4065
41 Ga0070712_100170869 3300006175 Unclassified 1687
42 Ga0075434_100000288 3300006871 Bacteria 35846
43 Ga0068865_100131765 3300006881 Bacteria 1874
44 Ga0075436_100024884 3300006914 Bacteria 4117
45 Ga0075435_100006271 3300007076 Bacteria 8394
46 Ga0105240_10034020 3300009093 Bacteria 6579
47 Ga0105240_10073795 3300009093 Archaea 4213
48 Ga0105245_10029785 3300009098 Bacteria 4825
49 Ga0105245_10049789 3300009098 Bacteria 3753
50 Ga0105245_10082593 3300009098 Bacteria 2939
51 Ga0105243_10214571 3300009148 Bacteria 1697
52 Ga0105237_10268854 3300009545 Bacteria 1708
53 Ga0105238_10172625 3300009551 Bacteria 2138
54 Ga0105249_10089928 3300009553 Unclassified 2870
55 Ga0105239_10005486 3300010375 Bacteria 14875
56 Ga0105239_10157790 3300010375 Bacteria 2534
57 Ga0157370_10329300 3300013104 Bacteria 1408
58 Ga0157374_10199572 3300013296 Bacteria 1958
59 Ga0157378_10296694 3300013297 Bacteria 1563
60 Ga0157372_10486342 3300013307 Bacteria 1439
61 Ga0157375_10436059 3300013308 Bacteria 1476
62 Ga0157376_10179550 3300014969 Archaea 1934
63 Ga0206356_10700607 3300020070 Bacteria 6240
64 Ga0213873_10003964 3300021358 Bacteria 2718
65 Ga0213872_10000633 3300021361 Bacteria 26613
66 Ga0213872_10021848 3300021361 Bacteria 2947
67 Ga0213876_10003316 3300021384 Bacteria 9232
68 Ga0213875_10000001 3300021388 Bacteria 2793540
69 Ga0213875_10002373 3300021388 Bacteria 11328
70 Ga0213875_10005190 3300021388 Bacteria 7046
71 Ga0213875_10060830 3300021388 Unclassified 1766
72 Ga0207692_10005803 3300025898 Bacteria 4972
73 Ga0207688_10004462 3300025901 Bacteria 7619
74 Ga0207707_10028130 3300025912 Bacteria 4914
75 Ga0207695_10156085 3300025913 Bacteria 2217
76 Ga0207695_10181514 3300025913 Bacteria 2025
77 Ga0207693_10024200 3300025915 Bacteria 4821
78 Ga0207693_10103238 3300025915 Unclassified 2236
79 Ga0207663_10055669 3300025916 Bacteria 2483
80 Ga0207660_10055623 3300025917 Bacteria 2829
81 Ga0207660_10149081 3300025917 Bacteria 1796
82 Ga0207657_10152942 3300025919 Bacteria 1878
83 Ga0207652_10060253 3300025921 Bacteria 3274
84 Ga0207652_10088848 3300025921 Archaea 2712
85 Ga0207652_10235983 3300025921 Bacteria 1648
86 Ga0207687_10048978 3300025927 Bacteria 2936
87 Ga0207664_10040074 3300025929 Bacteria 3639
88 Ga0207664_10071552 3300025929 Bacteria 2794
89 Ga0207664_10352343 3300025929 Bacteria 1303
90 Ga0207644_10193153 3300025931 Bacteria 1602
91 Ga0207706_10329381 3300025933 Bacteria 1329
92 Ga0207665_10019475 3300025939 Bacteria 4461
93 Ga0207661_10000356 3300025944 Bacteria 29425
94 Ga0207661_10091184 3300025944 Bacteria 2539
95 Ga0207667_10000161 3300025949 Bacteria 98927
96 Ga0207667_10001004 3300025949 Bacteria 36004
97 Ga0207667_10208760 3300025949 Bacteria 2002
98 Ga0207712_10253428 3300025961 Unclassified 1424
99 Ga0207668_10141659 3300025972 Unclassified 1850
100 Ga0207640_10000006 3300025981 Bacteria 313289
101 Ga0207640_10038965 3300025981 Bacteria 3004
102 Ga0207640_10215933 3300025981 Bacteria 1465
103 Ga0207677_10085068 3300026023 Bacteria 2282
104 Ga0207703_10159578 3300026035 Bacteria 1974
105 Ga0207639_10224085 3300026041 Bacteria 1626
106 Ga0207678_10040030 3300026067 Archaea 4065
107 Ga0207708_10045040 3300026075 Bacteria 3362
108 Ga0207702_10006581 3300026078 Bacteria 9987
109 Ga0207702_10042285 3300026078 Bacteria 3822
110 Ga0207648_10092854 3300026089 Unclassified 2639
111 Ga0207648_10174723 3300026089 Bacteria 1899
112 Ga0207674_10001737 3300026116 Bacteria 27843
113 Ga0207675_100351045 3300026118 Unclassified 1446
114 Ga0207683_10069357 3300026121 Bacteria 3113
115 Ga0265356_1000005 3300028017 Bacteria 35950
116 Ga0265334_10019801 3300028573 Unclassified 2763
117 Ga0265338_10000238 3300028800 Bacteria 101800
118 Ga0265770_1001931 3300030878 Bacteria 2830
119 Ga0265760_10002332 3300031090 Bacteria 5543
120 Ga0265332_10027810 3300031238 Unclassified 2477
121 Ga0265325_10000256 3300031241 Bacteria 37890
122 Ga0265325_10007788 3300031241 Bacteria 6381
123 Ga0265339_10006600 3300031249 Bacteria 7595
124 Ga0265316_10009184 3300031344 Bacteria 9107
125 Ga0265316_10099345 3300031344 Bacteria 2214
126 Ga0265313_10000304 3300031595 Bacteria 53361
127 Ga0265342_10004153 3300031712 Bacteria 11527
128 Ga0307406_10050871 3300031901 Bacteria 2629
129 Ga0373944_0008984 3300035089 Unclassified 2703
130 Ga0373936_0017926 3300035113 Unclassified 2731
131 Ga0373956_0070180 3300035119 Bacteria 1598
132 Ga0373957_0038931 3300035120 Bacteria 1782
133 Ga0373943_0012560 3300035170 Unclassified 3817
134 Ga0373946_0014406 3300035171 Unclassified 2982
135 Ga0373955_0094449 3300035172 Bacteria 1709
136 Ga0373924_0013100 3300035410 Unclassified 3111
137 Ga0373935_0019626 3300035692 Unclassified 4122
138 Ga0373927_0102858 3300035695 Bacteria 1858
139 Ga0373947_0022201 3300035725 Unclassified 3677
140 Ga0373937_0101987 3300036401 Bacteria 2664
141 Ga0373937_0223726 3300036401 Bacteria 1772
142 Ga0373925_0002657 3300037068 Bacteria 14187
143 Ga0395899_0087485 3300037312 Bacteria 2261
144 Ga0395900_0052059 3300037418 Bacteria 4215
145 Ga0436364_0004537 3300037853 Bacteria 18831
146 Ga0436364_0021429 3300037853 Bacteria 9437
147 Ga0436364_0068820 3300037853 Bacteria 44278
148 Ga0436364_0081156 3300037853 Bacteria 2348
149 Ga0436364_0273345 3300037853 Bacteria 2794207
150 Ga0436364_0508542 3300037853 Bacteria 7383
151 Ga0436364_0556376 3300037853 Unclassified 1125
152 Ga0436364_0825226 3300037853 Bacteria 1590
153 Ga0436364_1185577 3300037853 Bacteria 27424
154 Ga0436364_1391753 3300037853 Bacteria 14572
155 Ga0395901_0061562 3300038443 Archaea 3905
156 Ga0436365_0496328 3300039437 Bacteria 1999
157 Ga0436360_0031136 3300039438 Bacteria 1333
158 Ga0436360_0285329 3300039438 Bacteria 5752
159 Ga0436360_0511791 3300039438 Bacteria 2872
160 Ga0436360_0535170 3300039438 Bacteria 16122
161 Ga0436360_0580328 3300039438 Bacteria 2177
162 Ga0436360_0751338 3300039438 Bacteria 15392
163 Ga0436360_1376479 3300039438 Bacteria 1164
164 Ga0436361_0153090 3300039447 Viruses 1764
165 Ga0436361_0194695 3300039447 Bacteria 62210
166 Ga0436361_0213845 3300039447 Bacteria 17348
167 Ga0436361_0297651 3300039447 Bacteria 2129
168 Ga0436361_0408973 3300039447 Bacteria 5231
169 Ga0436361_0684617 3300039447 Bacteria 2598
170 Ga0436361_0717272 3300039447 Bacteria 19726
171 Ga0436361_0850458 3300039447 Bacteria 1674
172 Ga0436361_0868648 3300039447 Bacteria 3429
173 Ga0436361_1096104 3300039447 Bacteria 6722
174 Ga0436361_1205442 3300039447 Unclassified 2555
175 Ga0436362_0171615 3300039453 Unclassified 1300
176 Ga0436362_0336791 3300039453 Bacteria 2327
177 Ga0436362_0623467 3300039453 Bacteria 2149
178 Ga0436362_1096386 3300039453 Bacteria 10692
179 Ga0451577_0000448 3300042876 Bacteria 72373
180 Ga0451577_0139442 3300042876 Bacteria 2178
181 Ga0453683_0000646 3300044673 Bacteria 37564
182 Ga0466966_0009956 3300044684 Bacteria 6301
183 Ga0466966_0194948 3300044684 Bacteria 1227
184 Ga0466963_0005817 3300044694 Bacteria 7255
185 Ga0466963_0010139 3300044694 Bacteria 5697
186 Ga0453684_0000696 3300044712 Bacteria 119520
187 Ga0453684_0072361 3300044712 Bacteria 4353
188 Ga0466968_0026908 3300044735 Bacteria 2364
189 Ga0466957_0006758 3300044842 Bacteria 6479
190 Ga0466960_0035229 3300044901 Bacteria 2337
191 Ga0451576_0370744 3300045051 Bacteria 1500
192 Ga0466958_0006158 3300045836 Bacteria 6505
193 Ga0466958_0017210 3300045836 Bacteria 4174
194 Ga0466958_0087510 3300045836 Bacteria 1923
195 Ga0466958_0102900 3300045836 Bacteria 1778
196 Ga0466967_0000609 3300045976 Bacteria 17840
197 Ga0466967_0009258 3300045976 Bacteria 7295
198 Ga0466967_0027726 3300045976 Bacteria 4715
199 Ga0466967_0047651 3300045976 Unclassified 3737
200 Ga0466967_0060985 3300045976 Bacteria 3345
201 Ga0466967_0070304 3300045976 Bacteria 3131
202 Ga0466967_0087117 3300045976 Bacteria 2830
203 Ga0495603_0081878 3300046455 Bacteria 1891
204 Ga0495629_0041007 3300046459 Unclassified 3257
205 Ga0495641_0020655 3300046461 Unclassified 3332
206 Ga0495651_0083166 3300046462 Bacteria 2414
207 Ga0495651_0108135 3300046462 Bacteria 2060
208 Ga0495582_0044565 3300046473 Unclassified 2443
209 Ga0495639_0007927 3300046475 Unclassified 4564
210 Ga0495662_0000596 3300046476 Bacteria 16685
211 Ga0495662_0118776 3300046476 Bacteria 1297
212 Ga0495594_0055554 3300046499 Unclassified 2183
213 Ga0495608_0001961 3300046511 Bacteria 14742
214 Ga0495630_0006113 3300046517 Bacteria 8535
215 Ga0495666_0030053 3300046526 Unclassified 2669
216 Ga0495652_0208639 3300046529 Bacteria 1477
217 Ga0495665_0004184 3300046531 Bacteria 7786
218 Ga0495665_0022875 3300046531 Unclassified 3357
219 Ga0495640_0042148 3300046533 Unclassified 3186
220 Ga0495640_0070348 3300046533 Bacteria 2351
221 Ga0495586_0053559 3300046535 Bacteria 2186
222 Ga0495587_0135115 3300046536 Bacteria 1409
223 Ga0495645_0293866 3300046543 Unclassified 1064
224 Ga0495634_0046037 3300046642 Unclassified 2945
225 Ga0495635_0011395 3300046663 Bacteria 6235
226 Ga0495657_0003532 3300046675 Bacteria 12748
227 Ga0495623_0018089 3300046679 Bacteria 4553
228 Ga0495647_0005178 3300046681 Unclassified 4271
229 Ga0495658_0002935 3300046683 Bacteria 8554
230 Ga0495613_0028984 3300046689 Unclassified 4116
231 Ga0495624_0094992 3300046690 Unclassified 1838
232 Ga0495624_0102304 3300046690 Bacteria 1763
233 Ga0495600_0001970 3300046809 Bacteria 11542
234 Ga0495581_0014304 3300047315 Unclassified 4602
235 Ga0495581_0015833 3300047315 Unclassified 4380
236 Ga0495674_0033851 3300047319 Unclassified 4624
237 Ga0495674_0054712 3300047319 Unclassified 3503
238 Ga0495672_0041368 3300047320 Bacteria 2788
239 Ga0495676_0005123 3300047321 Bacteria 12014
240 Ga0495676_0018713 3300047321 Bacteria 6107
241 Ga0495684_0020660 3300047471 Bacteria 5073
242 Ga0495614_0013324 3300048089 Unclassified 3606
243 Ga0496100_0005434 3300048903 Bacteria 6863
244 Ga0496100_0151552 3300048903 Bacteria 1654
245 Ga0496101_0006773 3300048904 Bacteria 7389
246 Ga0496101_0010728 3300048904 Bacteria 6059
247 Ga0496101_0056639 3300048904 Bacteria 2834
248 Ga0496101_0147293 3300048904 Bacteria 1798
249 Ga0496102_0002804 3300048905 Bacteria 14856
250 Ga0496102_0097475 3300048905 Bacteria 2727
251 Ga0496103_0003117 3300048906 Bacteria 10193
252 Ga0496103_0107334 3300048906 Bacteria 1771
253 Ga0496104_0053483 3300048907 Bacteria 3815
254 Ga0496104_0517063 3300048907 Unclassified 1105
255 Ga0496105_0024873 3300048908 Bacteria 4867
256 Ga0496105_0042405 3300048908 Bacteria 3751
257 Ga0496106_0000267 3300048909 Bacteria 36822
258 Ga0496106_0003715 3300048909 Bacteria 11386
259 Ga0496106_0040939 3300048909 Bacteria 3471
260 Ga0496106_0265324 3300048909 Bacteria 1374
261 Ga0496107_0001407 3300048910 Bacteria 14842
262 Ga0496107_0039330 3300048910 Bacteria 3392
263 Ga0496107_0050776 3300048910 Bacteria 2990
264 Ga0496108_0029831 3300048911 Bacteria 4519
265 Ga0496108_0114035 3300048911 Bacteria 2313
266 Ga0496108_0187200 3300048911 Bacteria 1793
267 Ga0496109_0008506 3300048912 Bacteria 8725
268 Ga0496109_0010435 3300048912 Bacteria 7935
269 Ga0496109_0052060 3300048912 Bacteria 3731
270 Ga0496109_0216838 3300048912 Bacteria 1799
271 Ga0496110_0005951 3300048913 Bacteria 9599
272 Ga0496110_0027771 3300048913 Bacteria 4854
273 Ga0496111_0001778 3300048914 Bacteria 12642
274 Ga0496111_0011251 3300048914 Bacteria 6023
275 Ga0496111_0053152 3300048914 Bacteria 2926
276 Ga0496112_0102683 3300048915 Bacteria 2829
277 Ga0496113_0051521 3300048916 Bacteria 3072
278 Ga0496113_0188553 3300048916 Bacteria 1636
279 Ga0496113_0277479 3300048916 Bacteria 1340
280 Ga0496114_0015546 3300048917 Bacteria 6118
281 Ga0496115_0002681 3300048918 Bacteria 12765
282 Ga0496115_0003799 3300048918 Bacteria 10869
283 Ga0496115_0005919 3300048918 Bacteria 8919
284 Ga0496115_0014969 3300048918 Bacteria 5880
285 Ga0501067_0015576 3300049583 Bacteria 4208
286 Ga0501069_0008566 3300049585 Bacteria 5378
287 nmdc:mga0n895_39725_c1 3300050512 Bacteria 4568
288 nmdc:mga0n895_7173_c1 3300050512 Bacteria 9536
289 nmdc:mga0rr50_5103_c1 3300050513 Bacteria 7791
290 nmdc:mga08x19_19010_c1 3300050514 Bacteria 4212
291 nmdc:mga08x19_90964_c1 3300050514 Bacteria 2014
292 Ga0495601_0000624 3300053077 Bacteria 18886
293 Ga0495601_0174781 3300053077 Bacteria 1404
294 Ga0495612_0014519 3300053078 Bacteria 3167
295 Ga0495612_0040300 3300053078 Unclassified 1902
296 Ga0495619_0005985 3300053085 Bacteria 7700
297 Ga0466962_0030056 3300061719 Bacteria 2601
298 Ga0466962_0041451 3300061719 Bacteria 2203
299 Ga0213872_10011810
300 JGI25406J46586_10004018
301 Ga0070683_100001562
302 Ga0070683_100179945
303 Ga0070680_100137221
304 Ga0070668_100304342
305 Ga0070714_100001456
306 Ga0070714_100032503
307 Ga0070714_100040632
308 Ga0070714_100126834
309 Ga0070714_100149952
310 Ga0070714_100159473
311 Ga0070714_100220013
312 Ga0070711_100060806
313 Ga0070700_100091465
314 Ga0070663_100172050
315 Ga0070662_100145808
316 Ga0070685_10081848
317 Ga0070679_100070646
318 Ga0070684_100000711
319 Ga0070684_100031529
320 Ga0070684_100045185
321 Ga0070665_100200002
322 Ga0068855_100000687
323 Ga0068855_100012617
324 Ga0068855_100015303
325 Ga0068855_100062272
326 Ga0068857_100000826
327 Ga0068854_100000002
328 Ga0068856_100038349
329 Ga0068856_100053734
330 Ga0068861_100261057
331 Ga0081538_10005683
332 Ga0081538_10023943
333 Ga0081538_10070613
334 Ga0081539_10000185
335 Ga0081539_10008114
336 Ga0070717_10024434
337 Ga0070717_10029171
338 Ga0070712_100023605
339 Ga0070712_100170869
340 Ga0075434_100000288
341 Ga0068865_100131765
342 Ga0075436_100024884
343 Ga0075435_100006271
344 Ga0105240_10034020
345 Ga0105240_10073795
346 Ga0105245_10029785
347 Ga0105245_10049789
348 Ga0105245_10082593
349 Ga0105243_10214571
350 Ga0105237_10268854
351 Ga0105238_10172625
352 Ga0105249_10089928
353 Ga0105239_10005486
354 Ga0105239_10157790
355 Ga0157370_10329300
356 Ga0157374_10199572
357 Ga0157378_10296694
358 Ga0157372_10486342
359 Ga0157375_10436059
360 Ga0157376_10179550
361 Ga0206356_10700607
362 Ga0213873_10003964
363 Ga0213872_10000633
364 Ga0213872_10021848
365 Ga0213876_10003316
366 Ga0213875_10000001
367 Ga0213875_10002373
368 Ga0213875_10005190
369 Ga0213875_10060830
370 Ga0207692_10005803
371 Ga0207688_10004462
372 Ga0207707_10028130
373 Ga0207695_10156085
374 Ga0207695_10181514
375 Ga0207693_10024200
376 Ga0207693_10103238
377 Ga0207663_10055669
378 Ga0207660_10055623
379 Ga0207660_10149081
380 Ga0207657_10152942
381 Ga0207652_10060253
382 Ga0207652_10088848
383 Ga0207652_10235983
384 Ga0207687_10048978
385 Ga0207664_10040074
386 Ga0207664_10071552
387 Ga0207664_10352343
388 Ga0207644_10193153
389 Ga0207706_10329381
390 Ga0207665_10019475
391 Ga0207661_10000356
392 Ga0207661_10091184
393 Ga0207667_10000161
394 Ga0207667_10001004
395 Ga0207667_10208760
396 Ga0207712_10253428
397 Ga0207668_10141659
398 Ga0207640_10000006
399 Ga0207640_10038965
400 Ga0207640_10215933
401 Ga0207677_10085068
402 Ga0207703_10159578
403 Ga0207639_10224085
404 Ga0207678_10040030
405 Ga0207708_10045040
406 Ga0207702_10006581
407 Ga0207702_10042285
408 Ga0207648_10092854
409 Ga0207648_10174723
410 Ga0207674_10001737
411 Ga0207675_100351045
412 Ga0207683_10069357
413 Ga0265356_1000005
414 Ga0265334_10019801
415 Ga0265338_10000238
416 Ga0265770_1001931
417 Ga0265760_10002332
418 Ga0265332_10027810
419 Ga0265325_10000256
420 Ga0265325_10007788
421 Ga0265339_10006600
422 Ga0265316_10009184
423 Ga0265316_10099345
424 Ga0265313_10000304
425 Ga0265342_10004153
426 Ga0307406_10050871
427 Ga0373944_0008984
428 Ga0373936_0017926
429 Ga0373956_0070180
430 Ga0373957_0038931
431 Ga0373943_0012560
432 Ga0373946_0014406
433 Ga0373955_0094449
434 Ga0373924_0013100
435 Ga0373935_0019626
436 Ga0373927_0102858
437 Ga0373947_0022201
438 Ga0373937_0101987
439 Ga0373937_0223726
440 Ga0373925_0002657
441 Ga0395899_0087485
442 Ga0395900_0052059
443 Ga0436364_0004537
444 Ga0436364_0021429
445 Ga0436364_0068820
446 Ga0436364_0081156
447 Ga0436364_0273345
448 Ga0436364_0508542
449 Ga0436364_0556376
450 Ga0436364_0825226
451 Ga0436364_1185577
452 Ga0436364_1391753
453 Ga0395901_0061562
454 Ga0436365_0496328
455 Ga0436360_0031136
456 Ga0436360_0285329
457 Ga0436360_0511791
458 Ga0436360_0535170
459 Ga0436360_0580328
460 Ga0436360_0751338
461 Ga0436360_1376479
462 Ga0436361_0153090
463 Ga0436361_0194695
464 Ga0436361_0213845
465 Ga0436361_0297651
466 Ga0436361_0408973
467 Ga0436361_0684617
468 Ga0436361_0717272
469 Ga0436361_0850458
470 Ga0436361_0868648
471 Ga0436361_1096104
472 Ga0436361_1205442
473 Ga0436362_0171615
474 Ga0436362_0336791
475 Ga0436362_0623467
476 Ga0436362_1096386
477 Ga0451577_0000448
478 Ga0451577_0139442
479 Ga0453683_0000646
480 Ga0466966_0009956
481 Ga0466966_0194948
482 Ga0466963_0005817
483 Ga0466963_0010139
484 Ga0453684_0000696
485 Ga0453684_0072361
486 Ga0466968_0026908
487 Ga0466957_0006758
488 Ga0466960_0035229
489 Ga0451576_0370744
490 Ga0466958_0006158
491 Ga0466958_0017210
492 Ga0466958_0087510
493 Ga0466958_0102900
494 Ga0466967_0000609
495 Ga0466967_0009258
496 Ga0466967_0027726
497 Ga0466967_0047651
498 Ga0466967_0060985
499 Ga0466967_0070304
500 Ga0466967_0087117
501 Ga0495603_0081878
502 Ga0495629_0041007
503 Ga0495641_0020655
504 Ga0495651_0083166
505 Ga0495651_0108135
506 Ga0495582_0044565
507 Ga0495639_0007927
508 Ga0495662_0000596
509 Ga0495662_0118776
510 Ga0495594_0055554
511 Ga0495608_0001961
512 Ga0495630_0006113
513 Ga0495666_0030053
514 Ga0495652_0208639
515 Ga0495665_0004184
516 Ga0495665_0022875
517 Ga0495640_0042148
518 Ga0495640_0070348
519 Ga0495586_0053559
520 Ga0495587_0135115
521 Ga0495645_0293866
522 Ga0495634_0046037
523 Ga0495635_0011395
524 Ga0495657_0003532
525 Ga0495623_0018089
526 Ga0495647_0005178
527 Ga0495658_0002935
528 Ga0495613_0028984
529 Ga0495624_0094992
530 Ga0495624_0102304
531 Ga0495600_0001970
532 Ga0495581_0014304
533 Ga0495581_0015833
534 Ga0495674_0033851
535 Ga0495674_0054712
536 Ga0495672_0041368
537 Ga0495676_0005123
538 Ga0495676_0018713
539 Ga0495684_0020660
540 Ga0495614_0013324
541 Ga0496100_0005434
542 Ga0496100_0151552
543 Ga0496101_0006773
544 Ga0496101_0010728
545 Ga0496101_0056639
546 Ga0496101_0147293
547 Ga0496102_0002804
548 Ga0496102_0097475
549 Ga0496103_0003117
550 Ga0496103_0107334
551 Ga0496104_0053483
552 Ga0496104_0517063
553 Ga0496105_0024873
554 Ga0496105_0042405
555 Ga0496106_0000267
556 Ga0496106_0003715
557 Ga0496106_0040939
558 Ga0496106_0265324
559 Ga0496107_0001407
560 Ga0496107_0039330
561 Ga0496107_0050776
562 Ga0496108_0029831
563 Ga0496108_0114035
564 Ga0496108_0187200
565 Ga0496109_0008506
566 Ga0496109_0010435
567 Ga0496109_0052060
568 Ga0496109_0216838
569 Ga0496110_0005951
570 Ga0496110_0027771
571 Ga0496111_0001778
572 Ga0496111_0011251
573 Ga0496111_0053152
574 Ga0496112_0102683
575 Ga0496113_0051521
576 Ga0496113_0188553
577 Ga0496113_0277479
578 Ga0496114_0015546
579 Ga0496115_0002681
580 Ga0496115_0003799
581 Ga0496115_0005919
582 Ga0496115_0014969
583 Ga0501067_0015576
584 Ga0501069_0008566
585 nmdc:mga0n895_39725_c1
586 nmdc:mga0n895_7173_c1
587 nmdc:mga0rr50_5103_c1
588 nmdc:mga08x19_19010_c1
589 nmdc:mga08x19_90964_c1
590 Ga0495601_0000624
591 Ga0495601_0174781
592 Ga0495612_0014519
593 Ga0495612_0040300
594 Ga0495619_0005985
595 Ga0466962_0030056
596 Ga0466962_0041451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

171

373

0.89

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

43

152

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q45-assembly3.cif.gz_C crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val 0.9412 3 332
3dgb-assembly1.cif.gz_A crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone 0.9387 2 332
3ijq-assembly1.cif.gz_A structure of dipeptide epimerase from bacteroides thetaiotaomicron complexed with l-ala-d-glu; productive substrate binding. 0.9377 1 331
3r1z-assembly1.cif.gz_A crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : complex with l-ala-l-glu and l-ala-d-glu 0.9361 1 329
2zad-assembly1.cif.gz_A crystal structure of muconate cycloisomerase from thermotoga maritima msb8 0.9325 3 325
ID Description Score Start End Superfamily
af_I1K3D5_202_436_3.20.20.120 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9399 113 331 3.20.20.120
3q45A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9342 103 334 3.20.20.120
4gfiC02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.925 108 327 3.20.20.120
3jvaC02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9242 104 330 3.20.20.120
3ijlB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.924 105 331 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A838JRW3-F1-model_v4 Dipeptide epimerase (EC 5.1.1.-) 0.9974 8 332 GO:0009063
GO:0016855
GO:0046872
AF-A0A838JRW3-F1-model_v4 Dipeptide epimerase (EC 5.1.1.-) 0.9913 8 332 GO:0009063
GO:0016855
GO:0046872
AF-A0A522MYK3-F1-model_v4 Enolase C-terminal domain-containing protein 0.989 222 332 GO:0016854
AF-A0A535GIY0-F1-model_v4 Dipeptide epimerase 0.9829 227 334 GO:0016854
AF-A0A535GIY0-F1-model_v4 Dipeptide epimerase 0.974 227 334 GO:0016854

Map