F394136

General Info

Members Datasets Scaffolds Average Seq Length
298 170 298 294

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100038881|Ga0070707_1000388813
Length 337
Sequence MNSSKPRAKNQTEVTLGLIQMSAQEKPEANLAKAISRIRAAARGGAQIVSLQELFRSRYFCQSEDARNFKLAESIPGPTTEALGALAREHEIVIVASLFEKRSAGIYHNTAVVIDADGSVAGKYRKMHIPDDPLYYEKFYFTPGDLGFPSFQTRYARIGALVCWDQWFPEGARLAALSGAQILFYPTAIGWIPNEPRAVAQRQRNAWELIQRSHAVANGVFVAVVNRVGREGEIKFWGKSFVAGPFGEIIAQGNANREETLIAKCNLKKIEETRQSWPFLRDRRIDAYGPLQSRFIEDGAGSKKHGAKSPEQGVRTKESNSKLHAVVPVIHRRAKKS

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.68
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10010636 3300003911 Viruses 1752
2 Ga0058859_11289754 3300004798 Bacteria 1493
3 Ga0058860_11285480 3300004801 Bacteria 1114
4 Ga0065715_10107753 3300005293 Bacteria 2754
5 Ga0065707_10001036 3300005295 Bacteria 19737
6 Ga0065707_10002955 3300005295 Bacteria 5209
7 Ga0070676_10097083 3300005328 Bacteria 1815
8 Ga0070690_100039602 3300005330 Bacteria 2977
9 Ga0070670_100004197 3300005331 Bacteria 12062
10 Ga0070670_100173784 3300005331 Bacteria 1869
11 Ga0070677_10003260 3300005333 Bacteria 5227
12 Ga0068869_100056238 3300005334 Bacteria 2869
13 Ga0070666_10051799 3300005335 Bacteria 2765
14 Ga0070680_100118015 3300005336 Bacteria 2213
15 Ga0070682_100005252 3300005337 Bacteria 7207
16 Ga0070689_100297321 3300005340 Bacteria 1343
17 Ga0070691_10013754 3300005341 Bacteria 3712
18 Ga0070661_100132610 3300005344 Bacteria 1872
19 Ga0070668_100022031 3300005347 Bacteria 4816
20 Ga0070675_100186783 3300005354 Bacteria 1794
21 Ga0070671_100196009 3300005355 Bacteria 1712
22 Ga0070688_100323189 3300005365 Bacteria 1122
23 Ga0070667_100038760 3300005367 Bacteria 3995
24 Ga0070667_100189388 3300005367 Bacteria 1822
25 Ga0070694_100033430 3300005444 Bacteria 3384
26 Ga0070678_100191844 3300005456 Bacteria 1680
27 Ga0070662_100151045 3300005457 Bacteria 1808
28 Ga0070662_100212765 3300005457 Bacteria 1539
29 Ga0070681_10010313 3300005458 Bacteria 9223
30 Ga0070681_10109067 3300005458 Bacteria 2708
31 Ga0068867_100008717 3300005459 Bacteria 7160
32 Ga0070707_100038881 3300005468 Bacteria 4546
33 Ga0070698_100006246 3300005471 Bacteria 12961
34 Ga0070679_100018566 3300005530 Bacteria 6751
35 Ga0070697_100029583 3300005536 Bacteria 4393
36 Ga0070672_100021479 3300005543 Bacteria 4724
37 Ga0070686_100162596 3300005544 Bacteria 1573
38 Ga0070695_100240175 3300005545 Bacteria 1314
39 Ga0070695_100275963 3300005545 Bacteria 1233
40 Ga0070696_100037997 3300005546 Bacteria 3322
41 Ga0070696_100062038 3300005546 Bacteria 2616
42 Ga0070704_100283181 3300005549 Bacteria 1374
43 Ga0070664_100003517 3300005564 Bacteria 12648
44 Ga0068857_100037939 3300005577 Bacteria 4268
45 Ga0068854_100008477 3300005578 Bacteria 6610
46 Ga0068864_100105299 3300005618 Bacteria 2507
47 Ga0081455_10000510 3300005937 Bacteria 50312
48 Ga0081455_10049437 3300005937 Bacteria 3625
49 Ga0081538_10014872 3300005981 Bacteria 6063
50 Ga0081538_10021687 3300005981 Bacteria 4675
51 Ga0075432_10013589 3300006058 Bacteria 2767
52 Ga0068871_100152565 3300006358 Bacteria 1971
53 Ga0075428_100026143 3300006844 Bacteria 6464
54 Ga0075428_100035956 3300006844 Bacteria 5459
55 Ga0075428_100036292 3300006844 Bacteria 5430
56 Ga0075428_100139207 3300006844 Bacteria 2638
57 Ga0075428_100208029 3300006844 Bacteria 2115
58 Ga0075428_100231939 3300006844 Bacteria 1992
59 Ga0075430_100021896 3300006846 Bacteria 5431
60 Ga0075430_100044777 3300006846 Unclassified 3740
61 Ga0075431_100003507 3300006847 Bacteria 15197
62 Ga0075431_100040136 3300006847 Unclassified 4823
63 Ga0075431_100047182 3300006847 Bacteria 4441
64 Ga0075433_10003419 3300006852 Bacteria 12257
65 Ga0075433_10006368 3300006852 Bacteria 9333
66 Ga0075433_10084559 3300006852 Bacteria 2801
67 Ga0075434_100006282 3300006871 Bacteria 10885
68 Ga0075434_100012063 3300006871 Bacteria 8179
69 Ga0075434_100026082 3300006871 Bacteria 5723
70 Ga0075434_100063461 3300006871 Bacteria 3676
71 Ga0075434_100183734 3300006871 Bacteria 2112
72 Ga0075434_100292433 3300006871 Bacteria 1649
73 Ga0075429_100022002 3300006880 Bacteria 5530
74 Ga0075429_100040248 3300006880 Unclassified 4068
75 Ga0075436_100017225 3300006914 Unclassified 4944
76 Ga0075436_100017372 3300006914 Bacteria 4925
77 Ga0075435_100014278 3300007076 Bacteria 5931
78 Ga0075435_100060815 3300007076 Bacteria 3063
79 Ga0075435_100064258 3300007076 Bacteria 2982
80 Ga0075435_100075921 3300007076 Unclassified 2753
81 Ga0075435_100197229 3300007076 Bacteria 1705
82 Ga0075435_100215079 3300007076 Bacteria 1631
83 Ga0099794_10152101 3300007265 Bacteria 1175
84 Ga0111539_10083886 3300009094 Bacteria 3747
85 Ga0111539_10181361 3300009094 Bacteria 2459
86 Ga0111539_10501744 3300009094 Bacteria 1413
87 Ga0105247_10135377 3300009101 Bacteria 1609
88 Ga0114129_10029426 3300009147 Bacteria 7780
89 Ga0114129_10051698 3300009147 Bacteria 5768
90 Ga0114129_10061192 3300009147 Bacteria 5261
91 Ga0114129_10073107 3300009147 Bacteria 4777
92 Ga0114129_10081678 3300009147 Bacteria 4493
93 Ga0114129_10298359 3300009147 Bacteria 2149
94 Ga0114129_10719103 3300009147 Bacteria 1282
95 Ga0105243_10600500 3300009148 Bacteria 1059
96 Ga0105241_10055556 3300009174 Bacteria 3033
97 Ga0105242_10075212 3300009176 Bacteria 2811
98 Ga0105242_10168447 3300009176 Bacteria 1923
99 Ga0105249_10170426 3300009553 Bacteria 2110
100 Ga0105249_10330801 3300009553 Bacteria 1537
101 Ga0105249_10415517 3300009553 Unclassified 1378
102 Ga0105239_10094267 3300010375 Bacteria 3306
103 Ga0105246_10021279 3300011119 Bacteria 4172
104 Ga0157370_10279913 3300013104 Bacteria 1541
105 Ga0157374_10183557 3300013296 Bacteria 2045
106 Ga0157378_10037004 3300013297 Bacteria 4321
107 Ga0157378_10176330 3300013297 Bacteria 2008
108 Ga0157378_10614133 3300013297 Bacteria 1100
109 Ga0163162_10065134 3300013306 Bacteria 3690
110 Ga0163162_10098902 3300013306 Bacteria 3007
111 Ga0163162_10806536 3300013306 Bacteria 1056
112 Ga0157376_10030798 3300014969 Bacteria 4289
113 Ga0207697_10012920 3300025315 Bacteria 3491
114 Ga0207642_10167738 3300025899 Bacteria 1185
115 Ga0207680_10072340 3300025903 Bacteria 2140
116 Ga0207645_10007750 3300025907 Bacteria 7558
117 Ga0207684_10088021 3300025910 Bacteria 2646
118 Ga0207707_10012821 3300025912 Bacteria 7291
119 Ga0207707_10080152 3300025912 Bacteria 2850
120 Ga0207657_10145731 3300025919 Bacteria 1932
121 Ga0207649_10109737 3300025920 Bacteria 1841
122 Ga0207652_10063166 3300025921 Bacteria 3202
123 Ga0207646_10242595 3300025922 Bacteria 1628
124 Ga0207681_10158232 3300025923 Bacteria 1704
125 Ga0207681_10472722 3300025923 Bacteria 1023
126 Ga0207650_10001842 3300025925 Bacteria 14954
127 Ga0207659_10045698 3300025926 Bacteria 3089
128 Ga0207659_10104317 3300025926 Bacteria 2144
129 Ga0207644_10208416 3300025931 Bacteria 1544
130 Ga0207690_10094412 3300025932 Bacteria 2122
131 Ga0207706_10056390 3300025933 Bacteria 3464
132 Ga0207706_10130938 3300025933 Bacteria 2206
133 Ga0207709_10123533 3300025935 Bacteria 1752
134 Ga0207670_10350197 3300025936 Bacteria 1169
135 Ga0207679_10007973 3300025945 Bacteria 6735
136 Ga0207712_10295542 3300025961 Bacteria 1327
137 Ga0207668_10036773 3300025972 Bacteria 3271
138 Ga0207678_10010045 3300026067 Bacteria 8307
139 Ga0207676_10081472 3300026095 Bacteria 2630
140 Ga0207676_10230349 3300026095 Bacteria 1656
141 Ga0209982_1003271 3300027552 Bacteria 2296
142 Ga0209983_1008241 3300027665 Bacteria 2131
143 Ga0209588_1007502 3300027671 Bacteria 3211
144 Ga0209971_1001820 3300027682 Bacteria 5219
145 Ga0209966_1014530 3300027695 Bacteria 1470
146 Ga0209974_10000838 3300027876 Bacteria 10611
147 Ga0209974_10002190 3300027876 Bacteria 7121
148 Ga0207428_10271257 3300027907 Bacteria 1261
149 Ga0268266_10244963 3300028379 Bacteria 1656
150 Ga0268265_10152820 3300028380 Bacteria 1949
151 Ga0268264_10549349 3300028381 Bacteria 1133
152 Ga0265325_10068950 3300031241 Bacteria 1779
153 Ga0307408_100247206 3300031548 Bacteria 1469
154 Ga0307405_10194725 3300031731 Bacteria 1467
155 Ga0307410_10124857 3300031852 Bacteria 1883
156 Ga0307414_10044316 3300032004 Bacteria 3037
157 Ga0307411_10014945 3300032005 Bacteria 4339
158 Ga0307415_100187594 3300032126 Bacteria 1629
159 Ga0373926_0061492 3300035083 Bacteria 1370
160 Ga0373932_0027424 3300035112 Bacteria 1558
161 Ga0373946_0174530 3300035171 Bacteria 1016
162 Ga0373931_0188597 3300035691 Bacteria 1225
163 Ga0373947_0015752 3300035725 Bacteria 4343
164 Ga0373937_0155220 3300036401 Bacteria 2145
165 Ga0436363_0780212 3300039450 Bacteria 1082
166 Ga0451577_0327363 3300042876 Bacteria 1390
167 Ga0453683_0001640 3300044673 Bacteria 18763
168 Ga0453683_0119350 3300044673 Bacteria 1660
169 Ga0451576_0300475 3300045051 Unclassified 1679
170 Ga0495580_0006045 3300046472 Bacteria 9910
171 Ga0495580_0252976 3300046472 Bacteria 1206
172 Ga0495630_0003728 3300046517 Bacteria 10624
173 Ga0495598_0027927 3300046537 Bacteria 1561
174 Ga0495633_0126637 3300046558 Bacteria 1182
175 Ga0495670_0185356 3300046691 Bacteria 1100
176 Ga0495674_0086784 3300047319 Bacteria 2679
177 Ga0496100_0270792 3300048903 Bacteria 1263
178 Ga0496104_0099395 3300048907 Bacteria 2786
179 Ga0496112_0004379 3300048915 Bacteria 11949
180 Ga0496112_0015191 3300048915 Bacteria 7176
181 Ga0496113_0251768 3300048916 Bacteria 1410
182 Ga0501031_0050876 3300049568 Unclassified 2698
183 Ga0501032_0082468 3300049569 Unclassified 2139
184 Ga0501032_0161769 3300049569 Bacteria 1470
185 Ga0501033_0006852 3300049570 Bacteria 8895
186 Ga0501033_0274034 3300049570 Bacteria 1192
187 Ga0501034_0089716 3300049571 Unclassified 3072
188 Ga0501036_0010211 3300049572 Bacteria 7740
189 Ga0501036_0096482 3300049572 Bacteria 2499
190 Ga0501037_0063744 3300049573 Unclassified 2686
191 Ga0501037_0096838 3300049573 Bacteria 2132
192 Ga0501038_0160295 3300049574 Bacteria 1828
193 Ga0501038_0260324 3300049574 Bacteria 1371
194 Ga0501039_0072580 3300049575 Bacteria 2674
195 Ga0501040_0000584 3300049576 Bacteria 22238
196 Ga0501040_0127972 3300049576 Unclassified 1784
197 Ga0501041_0007236 3300049577 Bacteria 6512
198 Ga0501041_0029768 3300049577 Bacteria 3294
199 Ga0501041_0111770 3300049577 Bacteria 1695
200 Ga0501042_0001497 3300049578 Bacteria 13801
201 Ga0501042_0035680 3300049578 Unclassified 3527
202 Ga0501042_0411389 3300049578 Bacteria 980
203 Ga0501043_0086804 3300049579 Bacteria 2458
204 Ga0501043_0174315 3300049579 Bacteria 1677
205 Ga0501046_0008239 3300049580 Bacteria 9101
206 Ga0501046_0076838 3300049580 Bacteria 2586
207 Ga0501047_0060389 3300049581 Unclassified 3659
208 Ga0501048_0006413 3300049582 Bacteria 8942
209 Ga0501048_0009679 3300049582 Bacteria 7231
210 Ga0501068_0250582 3300049584 Bacteria 1128
211 Ga0501071_0000624 3300049587 Bacteria 18360
212 Ga0501071_0063554 3300049587 Unclassified 2676
213 Ga0501071_0067631 3300049587 Bacteria 2599
214 Ga0501071_0094160 3300049587 Bacteria 2203
215 Ga0501071_0389127 3300049587 Bacteria 1064
216 Ga0501072_0002073 3300049588 Bacteria 14911
217 Ga0501072_0203156 3300049588 Bacteria 1580
218 Ga0501072_0451131 3300049588 Bacteria 1018
219 Ga0501073_0004506 3300049589 Bacteria 10467
220 Ga0501074_0018788 3300049590 Bacteria 5022
221 Ga0501074_0047643 3300049590 Unclassified 3097
222 Ga0501075_0013989 3300049591 Bacteria 5743
223 Ga0501075_0280657 3300049591 Unclassified 1269
224 Ga0501076_0001597 3300049592 Bacteria 15243
225 Ga0501076_0143658 3300049592 Unclassified 1939
226 Ga0501076_0144929 3300049592 Bacteria 1931
227 Ga0501077_0003445 3300049593 Bacteria 9497
228 Ga0501077_0003462 3300049593 Bacteria 9473
229 Ga0501077_0025496 3300049593 Unclassified 3755
230 Ga0501077_0072652 3300049593 Bacteria 2180
231 Ga0501077_0075010 3300049593 Bacteria 2142
232 Ga0501079_0005867 3300049741 Bacteria 9189
233 Ga0501080_0151829 3300049742 Unclassified 2140
234 Ga0501080_0167185 3300049742 Bacteria 2029
235 Ga0501080_0189215 3300049742 Bacteria 1892
236 Ga0501081_0004391 3300049743 Bacteria 9042
237 Ga0501081_0035492 3300049743 Bacteria 3394
238 Ga0501083_0003293 3300049744 Bacteria 11281
239 Ga0501083_0065664 3300049744 Bacteria 2417
240 Ga0501035_0095828 3300049822 Bacteria 2608
241 Ga0501044_0048706 3300049823 Unclassified 4376
242 Ga0501045_0000475 3300049824 Bacteria 24883
243 Ga0501045_0074176 3300049824 Bacteria 2506
244 Ga0501045_0098651 3300049824 Unclassified 2161
245 nmdc:mga05p37_104955_c1 3300050507 Bacteria 3477
246 nmdc:mga05p37_11376_c1 3300050507 Bacteria 10591
247 nmdc:mga05p37_312726_c1 3300050507 Bacteria 1861
248 nmdc:mga05p37_327125_c1 3300050507 Bacteria 1812
249 nmdc:mga05p37_575880_c1 3300050507 Bacteria 1276
250 nmdc:mga05p37_91894_c1 3300050507 Bacteria 3739
251 nmdc:mga05p37_95690_c1 3300050507 Unclassified 3659
252 nmdc:mga05p37_96019_c1 3300050507 Bacteria 3652
253 nmdc:mga05p37_98088_c1 3300050507 Bacteria 3610
254 nmdc:mga09592_110018_c1 3300050508 Unclassified 2364
255 nmdc:mga09592_28819_c1 3300050508 Bacteria 4616
256 nmdc:mga0qj67_103167_c1 3300050509 Bacteria 2300
257 nmdc:mga0qj67_142493_c1 3300050509 Bacteria 1943
258 nmdc:mga0qj67_146787_c1 3300050509 Unclassified 1913
259 nmdc:mga0qj67_69966_c1 3300050509 Bacteria 2799
260 nmdc:mga06r32_289961_c1 3300050510 Bacteria 1623
261 nmdc:mga06r32_317718_c1 3300050510 Bacteria 1543
262 nmdc:mga06r32_432844_c1 3300050510 Bacteria 1296
263 nmdc:mga06r32_47120_c1 3300050510 Bacteria 4116
264 nmdc:mga06r32_71933_c1 3300050510 Unclassified 3348
265 nmdc:mga08y16_155789_c1 3300050511 Bacteria 2374
266 nmdc:mga08y16_5310_c1 3300050511 Bacteria 13477
267 nmdc:mga0n895_109939_c1 3300050512 Bacteria 2772
268 nmdc:mga0n895_135056_c1 3300050512 Bacteria 2493
269 nmdc:mga0n895_14557_c1 3300050512 Bacteria 7149
270 nmdc:mga0n895_362392_c1 3300050512 Bacteria 1468
271 nmdc:mga0n895_3992_c1 3300050512 Bacteria 11995
272 nmdc:mga0n895_55287_c1 3300050512 Bacteria 3907
273 nmdc:mga0n895_679430_c1 3300050512 Bacteria 1027
274 nmdc:mga0n895_95412_c1 3300050512 Bacteria 2979
275 nmdc:mga0rr50_264944_c1 3300050513 Unclassified 1431
276 nmdc:mga0rr50_45194_c1 3300050513 Bacteria 3235
277 nmdc:mga0rr50_53693_c1 3300050513 Bacteria 2998
278 nmdc:mga0rr50_5994_c1 3300050513 Bacteria 2820
279 nmdc:mga08x19_13334_c1 3300050514 Bacteria 4966
280 nmdc:mga08x19_281233_c1 3300050514 Bacteria 1153
281 nmdc:mga08x19_332434_c1 3300050514 Bacteria 1059
282 nmdc:mga08x19_55813_c1 3300050514 Bacteria 2547
283 nmdc:mga0a205_124289_c1 3300050515 Bacteria 2480
284 nmdc:mga0a205_142089_c1 3300050515 Bacteria 2300
285 nmdc:mga0a205_20145_c1 3300050515 Bacteria 6293
286 nmdc:mga0a205_9219_c1 3300050515 Bacteria 9010
287 nmdc:mga0a205_9257_c1 3300050515 Bacteria 8996
288 Ga0501084_0000869 3300054114 Bacteria 23334
289 Ga0501084_0443177 3300054114 Bacteria 1098
290 Ga0590071_018255 3300059421 Bacteria 1650
291 Ga0590077_002339 3300059426 Bacteria 4086
292 Ga0501082_0007914 3300060353 Bacteria 9180
293 Ga0501082_0037575 3300060353 Unclassified 4174
294 Ga0501082_0169111 3300060353 Bacteria 1900
295 Ga0501082_0337005 3300060353 Bacteria 1314
296 Ga0530510_0000275 3300061734 Bacteria 32534
297 Ga0530510_0212426 3300061734 Bacteria 1437
298 Ga0530510_0260724 3300061734 Bacteria 1292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0780212 Ga0436363_0780212_212_1057 277
2 3300050510 nmdc:mga06r32_289961_c1 nmdc:mga06r32_289961_c1_699_1532 277
3 3300004798 Ga0058859_11289754 Ga0058859_112897542 278
4 3300004801 Ga0058860_11285480 Ga0058860_112854801 278
5 3300005365 Ga0070688_100323189 Ga0070688_1003231891 278
6 3300005544 Ga0070686_100162596 Ga0070686_1001625961 278
7 3300049577 Ga0501041_0111770 Ga0501041_0111770_619_1455 278
8 3300005536 Ga0070697_100029583 Ga0070697_1000295832 280
9 3300006914 Ga0075436_100017372 Ga0075436_1000173722 280
10 3300007076 Ga0075435_100060815 Ga0075435_1000608154 280
11 3300009094 Ga0111539_10083886 Ga0111539_100838863 280
12 3300009094 Ga0111539_10501744 Ga0111539_105017441 280
13 3300009553 Ga0105249_10415517 Ga0105249_104155172 280
14 3300044673 Ga0453683_0001640 Ga0453683_0001640_12816_13658 280
15 3300044673 Ga0453683_0119350 Ga0453683_0119350_160_1002 280
16 3300050507 nmdc:mga05p37_104955_c1 nmdc:mga05p37_104955_c1_1840_2682 280
17 3300050508 nmdc:mga09592_28819_c1 nmdc:mga09592_28819_c1_3187_4029 280
18 3300050509 nmdc:mga0qj67_69966_c1 nmdc:mga0qj67_69966_c1_797_1639 280
19 3300050510 nmdc:mga06r32_317718_c1 nmdc:mga06r32_317718_c1_550_1392 280
20 3300050512 nmdc:mga0n895_135056_c1 nmdc:mga0n895_135056_c1_488_1330 280
21 3300050513 nmdc:mga0rr50_45194_c1 nmdc:mga0rr50_45194_c1_2380_3222 280
22 3300006871 Ga0075434_100292433 Ga0075434_1002924332 281
23 3300049569 Ga0501032_0161769 Ga0501032_0161769_88_933 281
24 3300049570 Ga0501033_0274034 Ga0501033_0274034_167_1012 281
25 3300049572 Ga0501036_0010211 Ga0501036_0010211_6867_7712 281
26 3300049573 Ga0501037_0096838 Ga0501037_0096838_1092_1937 281
27 3300049574 Ga0501038_0260324 Ga0501038_0260324_18_863 281
28 3300049575 Ga0501039_0072580 Ga0501039_0072580_749_1594 281
29 3300049576 Ga0501040_0000584 Ga0501040_0000584_13563_14408 281
30 3300049577 Ga0501041_0029768 Ga0501041_0029768_357_1202 281
31 3300049578 Ga0501042_0001497 Ga0501042_0001497_11896_12741 281
32 3300049579 Ga0501043_0174315 Ga0501043_0174315_72_917 281
33 3300049580 Ga0501046_0008239 Ga0501046_0008239_8230_9075 281
34 3300049582 Ga0501048_0006413 Ga0501048_0006413_261_1106 281
35 3300049584 Ga0501068_0250582 Ga0501068_0250582_192_1037 281
36 3300049587 Ga0501071_0000624 Ga0501071_0000624_925_1770 281
37 3300049588 Ga0501072_0002073 Ga0501072_0002073_8378_9223 281
38 3300049590 Ga0501074_0018788 Ga0501074_0018788_3963_4808 281
39 3300049591 Ga0501075_0013989 Ga0501075_0013989_133_978 281
40 3300049592 Ga0501076_0001597 Ga0501076_0001597_8304_9149 281
41 3300049593 Ga0501077_0003445 Ga0501077_0003445_155_1000 281
42 3300049741 Ga0501079_0005867 Ga0501079_0005867_819_1664 281
43 3300049742 Ga0501080_0167185 Ga0501080_0167185_970_1815 281
44 3300049743 Ga0501081_0004391 Ga0501081_0004391_137_982 281
45 3300049744 Ga0501083_0065664 Ga0501083_0065664_650_1495 281
46 3300049822 Ga0501035_0095828 Ga0501035_0095828_1511_2356 281
47 3300049824 Ga0501045_0000475 Ga0501045_0000475_6374_7219 281
48 3300054114 Ga0501084_0000869 Ga0501084_0000869_13881_14726 281
49 3300060353 Ga0501082_0007914 Ga0501082_0007914_7873_8718 281
50 3300061734 Ga0530510_0000275 Ga0530510_0000275_15998_16843 281
51 3300006058 Ga0075432_10013589 Ga0075432_100135892 282
52 3300006844 Ga0075428_100026143 Ga0075428_1000261434 282
53 3300006844 Ga0075428_100208029 Ga0075428_1002080292 282
54 3300006846 Ga0075430_100044777 Ga0075430_1000447773 282
55 3300006847 Ga0075431_100040136 Ga0075431_1000401364 282
56 3300006852 Ga0075433_10006368 Ga0075433_100063682 282
57 3300006871 Ga0075434_100063461 Ga0075434_1000634615 282
58 3300006880 Ga0075429_100040248 Ga0075429_1000402484 282
59 3300006914 Ga0075436_100017225 Ga0075436_1000172254 282
60 3300007076 Ga0075435_100075921 Ga0075435_1000759212 282
61 3300035083 Ga0373926_0061492 Ga0373926_0061492_17_865 282
62 3300035112 Ga0373932_0027424 Ga0373932_0027424_482_1330 282
63 3300035691 Ga0373931_0188597 Ga0373931_0188597_361_1209 282
64 3300049587 Ga0501071_0389127 Ga0501071_0389127_138_986 282
65 3300049593 Ga0501077_0025496 Ga0501077_0025496_222_1070 282
66 3300050507 nmdc:mga05p37_95690_c1 nmdc:mga05p37_95690_c1_2180_3028 282
67 3300050508 nmdc:mga09592_110018_c1 nmdc:mga09592_110018_c1_989_1837 282
68 3300050509 nmdc:mga0qj67_146787_c1 nmdc:mga0qj67_146787_c1_514_1362 282
69 3300050510 nmdc:mga06r32_71933_c1 nmdc:mga06r32_71933_c1_1533_2381 282
70 3300050512 nmdc:mga0n895_109939_c1 nmdc:mga0n895_109939_c1_1855_2703 282
71 3300050513 nmdc:mga0rr50_264944_c1 nmdc:mga0rr50_264944_c1_514_1362 282
72 3300050514 nmdc:mga08x19_55813_c1 nmdc:mga08x19_55813_c1_391_1239 282
73 3300054114 Ga0501084_0443177 Ga0501084_0443177_156_1004 282
74 3300009176 Ga0105242_10168447 Ga0105242_101684472 285
75 3300005546 Ga0070696_100037997 Ga0070696_1000379972 288
76 3300050509 nmdc:mga0qj67_142493_c1 nmdc:mga0qj67_142493_c1_985_1851 288
77 3300005295 Ga0065707_10002955 Ga0065707_100029554 289
78 3300031241 Ga0265325_10068950 Ga0265325_100689502 289
79 3300007076 Ga0075435_100215079 Ga0075435_1002150791 290
80 3300007265 Ga0099794_10152101 Ga0099794_101521011 290
81 3300027671 Ga0209588_1007502 Ga0209588_10075023 290
82 3300049592 Ga0501076_0144929 Ga0501076_0144929_765_1637 290
83 3300005618 Ga0068864_100105299 Ga0068864_1001052992 292
84 3300013297 Ga0157378_10614133 Ga0157378_106141331 292
85 3300026095 Ga0207676_10230349 Ga0207676_102303492 292
86 3300046517 Ga0495630_0003728 Ga0495630_0003728_457_1347 292
87 3300049743 Ga0501081_0035492 Ga0501081_0035492_1959_2849 292
88 3300005333 Ga0070677_10003260 Ga0070677_100032604 293
89 3300005340 Ga0070689_100297321 Ga0070689_1002973212 293
90 3300005367 Ga0070667_100189388 Ga0070667_1001893882 293
91 3300005545 Ga0070695_100275963 Ga0070695_1002759631 293
92 3300006844 Ga0075428_100035956 Ga0075428_1000359562 293
93 3300009147 Ga0114129_10298359 Ga0114129_102983592 293
94 3300009148 Ga0105243_10600500 Ga0105243_106005002 293
95 3300025936 Ga0207670_10350197 Ga0207670_103501972 293
96 3300028381 Ga0268264_10549349 Ga0268264_105493491 293
97 3300050507 nmdc:mga05p37_312726_c1 nmdc:mga05p37_312726_c1_117_1016 293
98 3300050510 nmdc:mga06r32_432844_c1 nmdc:mga06r32_432844_c1_19_918 293
99 3300005334 Ga0068869_100056238 Ga0068869_1000562385 294
100 3300005337 Ga0070682_100005252 Ga0070682_1000052526 294
101 3300005471 Ga0070698_100006246 Ga0070698_1000062469 294
102 3300009147 Ga0114129_10061192 Ga0114129_100611924 294
103 3300009553 Ga0105249_10330801 Ga0105249_103308012 294
104 3300013297 Ga0157378_10037004 Ga0157378_100370043 294
105 3300025910 Ga0207684_10088021 Ga0207684_100880212 294
106 3300025922 Ga0207646_10242595 Ga0207646_102425952 294
107 3300025935 Ga0207709_10123533 Ga0207709_101235332 294
108 3300025961 Ga0207712_10295542 Ga0207712_102955422 294
109 3300031548 Ga0307408_100247206 Ga0307408_1002472062 294
110 3300031731 Ga0307405_10194725 Ga0307405_101947252 294
111 3300031852 Ga0307410_10124857 Ga0307410_101248572 294
112 3300032126 Ga0307415_100187594 Ga0307415_1001875941 294
113 3300036401 Ga0373937_0155220 Ga0373937_0155220_312_1196 294
114 3300049578 Ga0501042_0411389 Ga0501042_0411389_19_903 294
115 3300049587 Ga0501071_0067631 Ga0501071_0067631_122_1006 294
116 3300049588 Ga0501072_0203156 Ga0501072_0203156_150_1034 294
117 3300049593 Ga0501077_0075010 Ga0501077_0075010_482_1366 294
118 3300049742 Ga0501080_0189215 Ga0501080_0189215_45_929 294
119 3300060353 Ga0501082_0169111 Ga0501082_0169111_394_1278 294
120 3300028380 Ga0268265_10152820 Ga0268265_101528202 295
121 3300049591 Ga0501075_0280657 Ga0501075_0280657_361_1248 295
122 3300049593 Ga0501077_0072652 Ga0501077_0072652_138_1025 295
123 3300005293 Ga0065715_10107753 Ga0065715_101077534 296
124 3300005444 Ga0070694_100033430 Ga0070694_1000334302 296
125 3300005546 Ga0070696_100062038 Ga0070696_1000620382 296
126 3300005549 Ga0070704_100283181 Ga0070704_1002831812 296
127 3300005981 Ga0081538_10014872 Ga0081538_100148724 296
128 3300006844 Ga0075428_100139207 Ga0075428_1001392073 296
129 3300006852 Ga0075433_10003419 Ga0075433_1000341910 296
130 3300006871 Ga0075434_100026082 Ga0075434_1000260822 296
131 3300027907 Ga0207428_10271257 Ga0207428_102712572 296
132 3300042876 Ga0451577_0327363 Ga0451577_0327363_239_1129 296
133 3300046472 Ga0495580_0006045 Ga0495580_0006045_4110_5000 296
134 3300050512 nmdc:mga0n895_3992_c1 nmdc:mga0n895_3992_c1_742_1632 296
135 3300050512 nmdc:mga0n895_55287_c1 nmdc:mga0n895_55287_c1_765_1655 296
136 3300050513 nmdc:mga0rr50_53693_c1 nmdc:mga0rr50_53693_c1_1967_2857 296
137 3300050515 nmdc:mga0a205_9219_c1 nmdc:mga0a205_9219_c1_6161_7051 296
138 3300059421 Ga0590071_018255 Ga0590071_018255_672_1562 296
139 3300005354 Ga0070675_100186783 Ga0070675_1001867832 297
140 3300005457 Ga0070662_100212765 Ga0070662_1002127652 297
141 3300005937 Ga0081455_10049437 Ga0081455_100494372 297
142 3300025926 Ga0207659_10104317 Ga0207659_101043172 297
143 3300025933 Ga0207706_10056390 Ga0207706_100563904 297
144 3300049588 Ga0501072_0451131 Ga0501072_0451131_100_993 297
145 3300005295 Ga0065707_10001036 Ga0065707_1000103610 298
146 3300005328 Ga0070676_10097083 Ga0070676_100970832 298
147 3300005330 Ga0070690_100039602 Ga0070690_1000396023 298
148 3300005331 Ga0070670_100004197 Ga0070670_1000041973 298
149 3300005331 Ga0070670_100173784 Ga0070670_1001737842 298
150 3300005335 Ga0070666_10051799 Ga0070666_100517992 298
151 3300005336 Ga0070680_100118015 Ga0070680_1001180153 298
152 3300005341 Ga0070691_10013754 Ga0070691_100137544 298
153 3300005344 Ga0070661_100132610 Ga0070661_1001326102 298
154 3300005347 Ga0070668_100022031 Ga0070668_1000220312 298
155 3300005355 Ga0070671_100196009 Ga0070671_1001960092 298
156 3300005367 Ga0070667_100038760 Ga0070667_1000387602 298
157 3300005456 Ga0070678_100191844 Ga0070678_1001918442 298
158 3300005457 Ga0070662_100151045 Ga0070662_1001510452 298
159 3300005458 Ga0070681_10010313 Ga0070681_100103133 298
160 3300005458 Ga0070681_10109067 Ga0070681_101090674 298
161 3300005459 Ga0068867_100008717 Ga0068867_1000087173 298
162 3300005530 Ga0070679_100018566 Ga0070679_1000185664 298
163 3300005543 Ga0070672_100021479 Ga0070672_1000214793 298
164 3300005545 Ga0070695_100240175 Ga0070695_1002401752 298
165 3300005564 Ga0070664_100003517 Ga0070664_1000035179 298
166 3300005577 Ga0068857_100037939 Ga0068857_1000379396 298
167 3300005578 Ga0068854_100008477 Ga0068854_1000084772 298
168 3300005981 Ga0081538_10021687 Ga0081538_100216873 298
169 3300006358 Ga0068871_100152565 Ga0068871_1001525652 298
170 3300006844 Ga0075428_100036292 Ga0075428_1000362925 298
171 3300006844 Ga0075428_100231939 Ga0075428_1002319392 298
172 3300006846 Ga0075430_100021896 Ga0075430_1000218965 298
173 3300006847 Ga0075431_100003507 Ga0075431_10000350713 298
174 3300006847 Ga0075431_100047182 Ga0075431_1000471822 298
175 3300006852 Ga0075433_10084559 Ga0075433_100845593 298
176 3300006871 Ga0075434_100006282 Ga0075434_1000062826 298
177 3300006871 Ga0075434_100012063 Ga0075434_1000120634 298
178 3300006871 Ga0075434_100183734 Ga0075434_1001837342 298
179 3300006880 Ga0075429_100022002 Ga0075429_1000220024 298
180 3300007076 Ga0075435_100014278 Ga0075435_1000142784 298
181 3300007076 Ga0075435_100064258 Ga0075435_1000642582 298
182 3300007076 Ga0075435_100197229 Ga0075435_1001972292 298
183 3300009094 Ga0111539_10181361 Ga0111539_101813612 298
184 3300009101 Ga0105247_10135377 Ga0105247_101353772 298
185 3300009147 Ga0114129_10029426 Ga0114129_100294262 298
186 3300009147 Ga0114129_10073107 Ga0114129_100731072 298
187 3300009147 Ga0114129_10719103 Ga0114129_107191032 298
188 3300009174 Ga0105241_10055556 Ga0105241_100555562 298
189 3300009176 Ga0105242_10075212 Ga0105242_100752122 298
190 3300009553 Ga0105249_10170426 Ga0105249_101704262 298
191 3300010375 Ga0105239_10094267 Ga0105239_100942672 298
192 3300011119 Ga0105246_10021279 Ga0105246_100212794 298
193 3300013104 Ga0157370_10279913 Ga0157370_102799132 298
194 3300013296 Ga0157374_10183557 Ga0157374_101835572 298
195 3300013297 Ga0157378_10176330 Ga0157378_101763302 298
196 3300013306 Ga0163162_10065134 Ga0163162_100651344 298
197 3300013306 Ga0163162_10098902 Ga0163162_100989022 298
198 3300013306 Ga0163162_10806536 Ga0163162_108065362 298
199 3300014969 Ga0157376_10030798 Ga0157376_100307983 298
200 3300025315 Ga0207697_10012920 Ga0207697_100129202 298
201 3300025899 Ga0207642_10167738 Ga0207642_101677381 298
202 3300025903 Ga0207680_10072340 Ga0207680_100723402 298
203 3300025907 Ga0207645_10007750 Ga0207645_100077507 298
204 3300025912 Ga0207707_10012821 Ga0207707_100128215 298
205 3300025912 Ga0207707_10080152 Ga0207707_100801523 298
206 3300025919 Ga0207657_10145731 Ga0207657_101457312 298
207 3300025920 Ga0207649_10109737 Ga0207649_101097372 298
208 3300025921 Ga0207652_10063166 Ga0207652_100631663 298
209 3300025923 Ga0207681_10158232 Ga0207681_101582322 298
210 3300025923 Ga0207681_10472722 Ga0207681_104727221 298
211 3300025925 Ga0207650_10001842 Ga0207650_100018424 298
212 3300025926 Ga0207659_10045698 Ga0207659_100456982 298
213 3300025931 Ga0207644_10208416 Ga0207644_102084162 298
214 3300025932 Ga0207690_10094412 Ga0207690_100944123 298
215 3300025933 Ga0207706_10130938 Ga0207706_101309382 298
216 3300025945 Ga0207679_10007973 Ga0207679_100079738 298
217 3300025972 Ga0207668_10036773 Ga0207668_100367734 298
218 3300026067 Ga0207678_10010045 Ga0207678_100100454 298
219 3300026095 Ga0207676_10081472 Ga0207676_100814722 298
220 3300027552 Ga0209982_1003271 Ga0209982_10032712 298
221 3300027665 Ga0209983_1008241 Ga0209983_10082413 298
222 3300027682 Ga0209971_1001820 Ga0209971_10018205 298
223 3300027695 Ga0209966_1014530 Ga0209966_10145302 298
224 3300027876 Ga0209974_10000838 Ga0209974_100008382 298
225 3300027876 Ga0209974_10002190 Ga0209974_100021905 298
226 3300028379 Ga0268266_10244963 Ga0268266_102449632 298
227 3300032005 Ga0307411_10014945 Ga0307411_100149455 298
228 3300035171 Ga0373946_0174530 Ga0373946_0174530_70_966 298
229 3300035725 Ga0373947_0015752 Ga0373947_0015752_1199_2095 298
230 3300045051 Ga0451576_0300475 Ga0451576_0300475_397_1293 298
231 3300046472 Ga0495580_0252976 Ga0495580_0252976_271_1167 298
232 3300046537 Ga0495598_0027927 Ga0495598_0027927_405_1301 298
233 3300046558 Ga0495633_0126637 Ga0495633_0126637_176_1072 298
234 3300046691 Ga0495670_0185356 Ga0495670_0185356_131_1027 298
235 3300047319 Ga0495674_0086784 Ga0495674_0086784_446_1342 298
236 3300048903 Ga0496100_0270792 Ga0496100_0270792_333_1229 298
237 3300048907 Ga0496104_0099395 Ga0496104_0099395_693_1589 298
238 3300048915 Ga0496112_0004379 Ga0496112_0004379_8543_9439 298
239 3300048915 Ga0496112_0015191 Ga0496112_0015191_2125_3021 298
240 3300048916 Ga0496113_0251768 Ga0496113_0251768_474_1370 298
241 3300049568 Ga0501031_0050876 Ga0501031_0050876_913_1809 298
242 3300049569 Ga0501032_0082468 Ga0501032_0082468_1047_1943 298
243 3300049570 Ga0501033_0006852 Ga0501033_0006852_2003_2899 298
244 3300049571 Ga0501034_0089716 Ga0501034_0089716_1366_2262 298
245 3300049572 Ga0501036_0096482 Ga0501036_0096482_460_1356 298
246 3300049573 Ga0501037_0063744 Ga0501037_0063744_1228_2124 298
247 3300049574 Ga0501038_0160295 Ga0501038_0160295_734_1630 298
248 3300049576 Ga0501040_0127972 Ga0501040_0127972_712_1608 298
249 3300049577 Ga0501041_0007236 Ga0501041_0007236_563_1459 298
250 3300049578 Ga0501042_0035680 Ga0501042_0035680_1765_2661 298
251 3300049579 Ga0501043_0086804 Ga0501043_0086804_1545_2441 298
252 3300049580 Ga0501046_0076838 Ga0501046_0076838_190_1107 298
253 3300049581 Ga0501047_0060389 Ga0501047_0060389_1538_2434 298
254 3300049582 Ga0501048_0009679 Ga0501048_0009679_5055_5951 298
255 3300049587 Ga0501071_0063554 Ga0501071_0063554_1218_2114 298
256 3300049587 Ga0501071_0094160 Ga0501071_0094160_794_1690 298
257 3300049589 Ga0501073_0004506 Ga0501073_0004506_8673_9569 298
258 3300049590 Ga0501074_0047643 Ga0501074_0047643_1639_2535 298
259 3300049592 Ga0501076_0143658 Ga0501076_0143658_867_1763 298
260 3300049593 Ga0501077_0003462 Ga0501077_0003462_980_1876 298
261 3300049742 Ga0501080_0151829 Ga0501080_0151829_563_1459 298
262 3300049744 Ga0501083_0003293 Ga0501083_0003293_8417_9313 298
263 3300049823 Ga0501044_0048706 Ga0501044_0048706_2035_2931 298
264 3300049824 Ga0501045_0074176 Ga0501045_0074176_547_1443 298
265 3300049824 Ga0501045_0098651 Ga0501045_0098651_48_944 298
266 3300050507 nmdc:mga05p37_327125_c1 nmdc:mga05p37_327125_c1_24_920 298
267 3300050507 nmdc:mga05p37_575880_c1 nmdc:mga05p37_575880_c1_162_1061 298
268 3300050507 nmdc:mga05p37_96019_c1 nmdc:mga05p37_96019_c1_2401_3297 298
269 3300050507 nmdc:mga05p37_98088_c1 nmdc:mga05p37_98088_c1_149_1045 298
270 3300050509 nmdc:mga0qj67_103167_c1 nmdc:mga0qj67_103167_c1_993_1889 298
271 3300050510 nmdc:mga06r32_47120_c1 nmdc:mga06r32_47120_c1_2715_3611 298
272 3300050511 nmdc:mga08y16_155789_c1 nmdc:mga08y16_155789_c1_84_980 298
273 3300050511 nmdc:mga08y16_5310_c1 nmdc:mga08y16_5310_c1_11964_12860 298
274 3300050512 nmdc:mga0n895_14557_c1 nmdc:mga0n895_14557_c1_5555_6451 298
275 3300050512 nmdc:mga0n895_362392_c1 nmdc:mga0n895_362392_c1_410_1306 298
276 3300050512 nmdc:mga0n895_679430_c1 nmdc:mga0n895_679430_c1_44_940 298
277 3300050512 nmdc:mga0n895_95412_c1 nmdc:mga0n895_95412_c1_1240_2136 298
278 3300050513 nmdc:mga0rr50_5994_c1 nmdc:mga0rr50_5994_c1_509_1405 298
279 3300050514 nmdc:mga08x19_13334_c1 nmdc:mga08x19_13334_c1_1161_2057 298
280 3300050514 nmdc:mga08x19_332434_c1 nmdc:mga08x19_332434_c1_135_1031 298
281 3300050515 nmdc:mga0a205_142089_c1 nmdc:mga0a205_142089_c1_499_1395 298
282 3300050515 nmdc:mga0a205_20145_c1 nmdc:mga0a205_20145_c1_744_1640 298
283 3300050515 nmdc:mga0a205_9257_c1 nmdc:mga0a205_9257_c1_4998_5894 298
284 3300059426 Ga0590077_002339 Ga0590077_002339_1596_2492 298
285 3300060353 Ga0501082_0037575 Ga0501082_0037575_1734_2630 298
286 3300060353 Ga0501082_0337005 Ga0501082_0337005_379_1275 298
287 3300061734 Ga0530510_0212426 Ga0530510_0212426_406_1302 298
288 3300061734 Ga0530510_0260724 Ga0530510_0260724_177_1073 298
289 3300009147 Ga0114129_10051698 Ga0114129_100516985 299
290 3300050507 nmdc:mga05p37_11376_c1 nmdc:mga05p37_11376_c1_1789_2730 299
291 3300005468 Ga0070707_100038881 Ga0070707_1000388813 302
292 3300032004 Ga0307414_10044316 Ga0307414_100443163 302
293 3300003911 JGI25405J52794_10010636 JGI25405J52794_100106362 304
294 3300005937 Ga0081455_10000510 Ga0081455_1000051039 304
295 3300009147 Ga0114129_10081678 Ga0114129_100816781 304
296 3300050507 nmdc:mga05p37_91894_c1 nmdc:mga05p37_91894_c1_1783_2769 304
297 3300050514 nmdc:mga08x19_281233_c1 nmdc:mga08x19_281233_c1_147_1133 304
298 3300050515 nmdc:mga0a205_124289_c1 nmdc:mga0a205_124289_c1_16_1002 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

15

275

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9134 14 293
7ovg-assembly1.cif.gz_B the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide 0.9084 15 273
3iw3-assembly1.cif.gz_B crystal structure of hyperthermophilic nitrilase 0.9048 16 272
5h8k-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant 0.9004 14 293
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.8996 14 293
ID Description Score Start End Superfamily
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9134 14 293 3.60.110.10
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8897 15 293 3.60.110.10
1j31B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8817 16 284 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8772 14 293 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8764 14 293 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A3D3QZU2-F1-model_v4 deleted 0.99 16 101
AF-A0A5S3QQQ3-F1-model_v4 deleted 0.9886 16 121
AF-A0A2N1XU79-F1-model_v4 deleted 0.9731 16 114
AF-A0A7J4VEW5-F1-model_v4 Acyltransferase 0.967 11 114 GO:0016746
GO:0033388
GO:0050126
AF-A0A7J4VEW5-F1-model_v4 Acyltransferase 0.9489 11 114 GO:0016746
GO:0033388
GO:0050126

Feature Viewer

pLDDT pTM Quality
85.99 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map