F394132

General Info

Members Datasets Scaffolds Average Seq Length
298 193 596 169

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100454679|Ga0070706_1004546792
Length 187
Sequence VLSYRRGLRASSPEGVYPVTTAELLADALGRVRDVVHDVTKGLTPEQLARRPQPAANSICWLIWHLTRVQDDHVSEVAGTEQVWTAAGWADRFGLPFDKTATGWGHTADEVGAVRVESADLLTGYHDAVFEQSLRFVGTLTDADLDRIIDRRWDPPVTLGVRLISVIDDDAQHAGQAAYLRGLITRG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
110 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
113 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
114 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
115 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
116 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
120 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 2517572101 Frankia sp. DC12 Isolate Nodule
183 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
184 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
185 2687453737 Frankia sp. BMG5.36 Isolate Nodule
186 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
187 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
188 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
189 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
190 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
191 8002784119 Frankia sp. AgB1.9 Isolate Nodule
192 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
193 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.28
Metatranscriptomes 4.7
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 1.68
Rhizoplane 1.34
Rhizosphere 78.86
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100454679 3300005467 Bacteria 1192
2 LJQas_1019882 3300000549 Bacteria 781
3 Ga0070658_10020468 3300005327 Bacteria 5303
4 Ga0070658_10099273 3300005327 Bacteria 2406
5 Ga0070683_100939767 3300005329 Bacteria 830
6 Ga0070682_100570653 3300005337 Bacteria 889
7 Ga0070660_100001482 3300005339 Bacteria 16068
8 Ga0070687_100119170 3300005343 Bacteria 1507
9 Ga0070674_100601631 3300005356 Bacteria 929
10 Ga0070659_100006320 3300005366 Bacteria 8556
11 Ga0070708_100678453 3300005445 Bacteria 970
12 Ga0070678_100347639 3300005456 Bacteria 1274
13 Ga0070681_10289806 3300005458 Bacteria 1547
14 Ga0070681_10981612 3300005458 Bacteria 764
15 Ga0068867_100331392 3300005459 Bacteria 1264
16 Ga0070706_100029929 3300005467 Bacteria 5015
17 Ga0070706_100094149 3300005467 Bacteria 2780
18 Ga0070706_100101160 3300005467 Bacteria 2679
19 Ga0070707_100008243 3300005468 Bacteria 9669
20 Ga0070707_100012849 3300005468 Bacteria 7819
21 Ga0070707_100026902 3300005468 Bacteria 5467
22 Ga0070707_100069666 3300005468 Bacteria 3387
23 Ga0070698_100076472 3300005471 Bacteria 3349
24 Ga0070698_100228926 3300005471 Bacteria 1792
25 Ga0070699_100090086 3300005518 Bacteria 2681
26 Ga0070699_100425661 3300005518 Bacteria 1202
27 Ga0070699_100454802 3300005518 Bacteria 1161
28 Ga0070699_100546907 3300005518 Bacteria 1054
29 Ga0070679_100224595 3300005530 Bacteria 1838
30 Ga0068855_100050603 3300005563 Unclassified 4895
31 Ga0068855_100132230 3300005563 Bacteria 2849
32 Ga0068857_100245820 3300005577 Bacteria 1639
33 Ga0068852_100307127 3300005616 Bacteria 1537
34 Ga0068852_101146984 3300005616 Bacteria 798
35 Ga0068859_101589946 3300005617 Bacteria 722
36 Ga0068866_10533229 3300005718 Bacteria 782
37 Ga0068870_10072176 3300005840 Bacteria 1886
38 Ga0068862_100000256 3300005844 Bacteria 59069
39 Ga0081455_10008190 3300005937 Bacteria 10901
40 Ga0081538_10001498 3300005981 Bacteria 23968
41 Ga0081539_10010856 3300005985 Bacteria 7316
42 Ga0081539_10017256 3300005985 Bacteria 5081
43 Ga0070717_10016737 3300006028 Bacteria 5691
44 Ga0075365_10022232 3300006038 Bacteria 3971
45 Ga0075365_10042901 3300006038 Bacteria 2959
46 Ga0075365_10091063 3300006038 Bacteria 2077
47 Ga0075365_10111321 3300006038 Bacteria 1881
48 Ga0075365_10114113 3300006038 Bacteria 1859
49 Ga0075365_10115016 3300006038 Bacteria 1851
50 Ga0075365_10282826 3300006038 Bacteria 1167
51 Ga0075365_10303920 3300006038 Bacteria 1123
52 Ga0075368_10017395 3300006042 Bacteria 2690
53 Ga0075363_100094573 3300006048 Bacteria 1648
54 Ga0075364_10024174 3300006051 Bacteria 3855
55 Ga0075364_10223820 3300006051 Bacteria 1277
56 Ga0075364_10427910 3300006051 Bacteria 904
57 Ga0075367_10049539 3300006178 Bacteria 2476
58 Ga0075367_10094884 3300006178 Bacteria 1819
59 Ga0075370_10066339 3300006353 Bacteria 2059
60 Ga0075370_10257498 3300006353 Bacteria 1035
61 Ga0075370_10449261 3300006353 Bacteria 775
62 Ga0075428_100131863 3300006844 Bacteria 2718
63 Ga0068865_100312292 3300006881 Bacteria 1262
64 Ga0097620_100000175 3300006931 Bacteria 62621
65 Ga0097620_100001021 3300006931 Bacteria 28677
66 Ga0097620_101589948 3300006931 Bacteria 722
67 Ga0099794_10027340 3300007265 Bacteria 2644
68 Ga0105243_12158483 3300009148 Bacteria 593
69 Ga0105249_10006856 3300009553 Bacteria 9934
70 Ga0105246_10408704 3300011119 Bacteria 1129
71 Ga0105246_11235919 3300011119 Bacteria 689
72 Ga0157369_10608941 3300013105 Bacteria 1127
73 Ga0157374_10356493 3300013296 Bacteria 1454
74 Ga0163162_10923022 3300013306 Bacteria 985
75 Ga0163163_10016630 3300014325 Bacteria 6839
76 Ga0163163_10368808 3300014325 Bacteria 1493
77 Ga0163163_11085248 3300014325 Bacteria 863
78 Ga0157380_10230289 3300014326 Bacteria 1664
79 Ga0182008_10239263 3300014497 Bacteria 933
80 Ga0157377_10409007 3300014745 Bacteria 926
81 Ga0157379_11307737 3300014968 Bacteria 700
82 Ga0197907_10029721 3300020069 Bacteria 1427
83 Ga0197907_10341387 3300020069 Bacteria 912
84 Ga0197907_10389905 3300020069 Bacteria 688
85 Ga0206356_10808146 3300020070 Bacteria 1046
86 Ga0206351_10512830 3300020077 Bacteria 721
87 Ga0206351_10843150 3300020077 Bacteria 1587
88 Ga0206350_11217055 3300020080 Bacteria 751
89 Ga0206353_10251510 3300020082 Bacteria 1639
90 Ga0206353_11308120 3300020082 Bacteria 1711
91 Ga0206353_11915976 3300020082 Bacteria 1691
92 Ga0154015_1240438 3300020610 Bacteria 671
93 Ga0213876_10088064 3300021384 Bacteria 1644
94 Ga0224712_10059680 3300022467 Bacteria 1515
95 Ga0224712_10163039 3300022467 Bacteria 995
96 Ga0224712_10348036 3300022467 Bacteria 700
97 Ga0207688_10265953 3300025901 Bacteria 1042
98 Ga0207688_10341576 3300025901 Bacteria 921
99 Ga0207647_10048046 3300025904 Bacteria 2651
100 Ga0207647_10114191 3300025904 Bacteria 1596
101 Ga0207645_10139226 3300025907 Bacteria 1581
102 Ga0207684_10020163 3300025910 Bacteria 5694
103 Ga0207684_10140509 3300025910 Bacteria 2076
104 Ga0207684_10187676 3300025910 Bacteria 1783
105 Ga0207684_10410726 3300025910 Bacteria 1164
106 Ga0207684_10540325 3300025910 Bacteria 997
107 Ga0207657_10020591 3300025919 Bacteria 6230
108 Ga0207652_10105970 3300025921 Bacteria 2488
109 Ga0207646_10001826 3300025922 Bacteria 25702
110 Ga0207646_10031069 3300025922 Bacteria 4837
111 Ga0207646_10156017 3300025922 Bacteria 2059
112 Ga0207650_10221010 3300025925 Bacteria 1524
113 Ga0207659_10249066 3300025926 Bacteria 1441
114 Ga0207687_10480654 3300025927 Bacteria 1034
115 Ga0207664_10175909 3300025929 Bacteria 1835
116 Ga0207690_10087149 3300025932 Bacteria 2196
117 Ga0207690_10111524 3300025932 Bacteria 1971
118 Ga0207706_10903586 3300025933 Bacteria 746
119 Ga0207669_10585133 3300025937 Bacteria 905
120 Ga0207669_11241377 3300025937 Bacteria 632
121 Ga0207704_10479448 3300025938 Bacteria 998
122 Ga0207691_10593356 3300025940 Bacteria 938
123 Ga0207661_10242505 3300025944 Bacteria 1600
124 Ga0207667_10101493 3300025949 Bacteria 2968
125 Ga0207667_10974401 3300025949 Bacteria 836
126 Ga0207712_10003481 3300025961 Bacteria 9934
127 Ga0207712_10950694 3300025961 Bacteria 761
128 Ga0207668_10126929 3300025972 Bacteria 1942
129 Ga0207677_10173288 3300026023 Bacteria 1690
130 Ga0207677_11011093 3300026023 Bacteria 754
131 Ga0207703_10006534 3300026035 Bacteria 9303
132 Ga0207678_10067917 3300026067 Bacteria 3059
133 Ga0207708_10301364 3300026075 Bacteria 1303
134 Ga0207641_10002519 3300026088 Bacteria 16880
135 Ga0207674_10097235 3300026116 Bacteria 2928
136 Ga0207674_11158326 3300026116 Bacteria 743
137 Ga0207675_100040876 3300026118 Bacteria 4331
138 Ga0207675_100445374 3300026118 Bacteria 1283
139 Ga0207683_10809365 3300026121 Bacteria 870
140 Ga0207698_10219897 3300026142 Bacteria 1715
141 Ga0209813_10071948 3300027866 Bacteria 1126
142 Ga0268265_10000019 3300028380 Bacteria 285487
143 Ga0268264_10000791 3300028381 Bacteria 34364
144 Ga0307408_100110924 3300031548 Bacteria 2107
145 Ga0307408_101083409 3300031548 Bacteria 742
146 Ga0307508_10491967 3300031616 Bacteria 821
147 Ga0307405_10150756 3300031731 Bacteria 1634
148 Ga0307413_10018624 3300031824 Bacteria 3649
149 Ga0307413_10160343 3300031824 Bacteria 1579
150 Ga0307410_10081398 3300031852 Bacteria 2274
151 Ga0326468_10005522 3300031889 Bacteria 1140
152 Ga0307406_10062253 3300031901 Bacteria 2413
153 Ga0307406_10086349 3300031901 Bacteria 2100
154 Ga0307407_10044472 3300031903 Bacteria 2503
155 Ga0307407_10106679 3300031903 Bacteria 1750
156 Ga0307407_10666205 3300031903 Bacteria 781
157 Ga0307412_10334197 3300031911 Bacteria 1210
158 Ga0307409_100082589 3300031995 Bacteria 2601
159 Ga0307416_101067075 3300032002 Bacteria 912
160 Ga0307414_10244953 3300032004 Bacteria 1486
161 Ga0307415_100072881 3300032126 Bacteria 2420
162 Ga0307415_100075645 3300032126 Bacteria 2384
163 Ga0307415_100221022 3300032126 Bacteria 1518
164 Ga0307415_100324354 3300032126 Bacteria 1285
165 Ga0307415_100440077 3300032126 Bacteria 1124
166 Ga0373938_0136152 3300034957 Bacteria 644
167 Ga0373954_0333125 3300035118 Bacteria 749
168 Ga0395899_0009315 3300037312 Bacteria 7541
169 Ga0395900_0422668 3300037418 Bacteria 1293
170 Ga0395898_0430977 3300037466 Bacteria 1256
171 Ga0436365_1174188 3300039437 Bacteria 8230
172 Ga0436365_1204706 3300039437 Bacteria 2259
173 Ga0451843_0766543 3300041509 Bacteria 1021
174 Ga0439450_001989 3300042008 Bacteria 3124
175 Ga0439455_0010444 3300042012 Bacteria 2042
176 Ga0439456_060013 3300042013 Bacteria 835
177 Ga0439463_001203 3300042016 Bacteria 6910
178 Ga0450913_001099 3300042117 Bacteria 1401
179 Ga0450902_009980 3300042137 Bacteria 1499
180 Ga0439444_0003934 3300042437 Bacteria 2126
181 Ga0439464_0003007 3300042439 Bacteria 4217
182 Ga0439460_0001811 3300042461 Bacteria 5085
183 Ga0450916_003480 3300042530 Bacteria 1728
184 Ga0439440_0011010 3300042993 Bacteria 1901
185 Ga0466969_0005094 3300044656 Bacteria 6989
186 Ga0466966_0032220 3300044684 Bacteria 3398
187 Ga0466966_0267255 3300044684 Bacteria 1029
188 Ga0466961_0006117 3300044693 Bacteria 7638
189 Ga0466961_0308270 3300044693 Bacteria 966
190 Ga0466963_0006863 3300044694 Bacteria 6772
191 Ga0466963_0234486 3300044694 Bacteria 1286
192 Ga0466964_0054106 3300044706 Bacteria 1654
193 Ga0466971_0015075 3300044719 Bacteria 3400
194 Ga0466971_0218546 3300044719 Bacteria 903
195 Ga0466970_0022393 3300044765 Bacteria 3298
196 Ga0466957_0616527 3300044842 Bacteria 761
197 Ga0466960_0244544 3300044901 Bacteria 995
198 Ga0466960_0293996 3300044901 Bacteria 913
199 Ga0466960_0297020 3300044901 Bacteria 909
200 Ga0466960_0361184 3300044901 Bacteria 830
201 Ga0466960_0630390 3300044901 Bacteria 638
202 Ga0466959_0052117 3300045049 Bacteria 2998
203 Ga0466958_0322743 3300045836 Bacteria 992
204 Ga0466967_0002873 3300045976 Bacteria 10954
205 Ga0466967_0006307 3300045976 Bacteria 8370
206 Ga0466967_0006624 3300045976 Bacteria 8233
207 Ga0466967_0009127 3300045976 Bacteria 7336
208 Ga0466967_0062199 3300045976 Bacteria 3313
209 Ga0466967_0959688 3300045976 Bacteria 851
210 Ga0466967_0970864 3300045976 Bacteria 846
211 Ga0466967_1729192 3300045976 Bacteria 623
212 Ga0495607_0018045 3300046501 Bacteria 4509
213 Ga0495608_0638096 3300046511 Bacteria 637
214 Ga0495640_0525010 3300046533 Bacteria 719
215 Ga0495645_0169802 3300046543 Bacteria 1502
216 Ga0495599_0203905 3300046678 Bacteria 1214
217 Ga0495623_0448752 3300046679 Bacteria 687
218 Ga0495613_0214472 3300046689 Bacteria 1353
219 Ga0495604_0316810 3300047317 Bacteria 1043
220 Ga0495604_0768833 3300047317 Bacteria 608
221 Ga0495683_0001425 3300047323 Bacteria 15755
222 Ga0496100_0778250 3300048903 Bacteria 749
223 Ga0496109_0373574 3300048912 Bacteria 1347
224 Ga0496111_0361552 3300048914 Bacteria 1074
225 Ga0496111_0525659 3300048914 Bacteria 870
226 Ga0496117_0051387 3300048920 Bacteria 2914
227 Ga0496118_0003502 3300048921 Bacteria 19691
228 Ga0496119_0003572 3300048922 Bacteria 16055
229 Ga0496120_0056378 3300048923 Bacteria 2218
230 Ga0496121_0039180 3300048924 Bacteria 4182
231 Ga0496124_0111759 3300048927 Bacteria 2198
232 Ga0501034_0290581 3300049571 Bacteria 1573
233 Ga0501034_0913616 3300049571 Bacteria 765
234 Ga0501036_0013645 3300049572 Bacteria 6755
235 Ga0501037_0199971 3300049573 Bacteria 1412
236 Ga0501038_0024429 3300049574 Bacteria 5392
237 Ga0501038_1184076 3300049574 Bacteria 555
238 Ga0501039_0063178 3300049575 Bacteria 2869
239 Ga0501042_0148586 3300049578 Bacteria 1689
240 Ga0501043_0015645 3300049579 Bacteria 5946
241 Ga0501043_0304167 3300049579 Bacteria 1218
242 Ga0501047_0057343 3300049581 Bacteria 3766
243 Ga0501048_0012647 3300049582 Bacteria 6277
244 Ga0501067_0629925 3300049583 Bacteria 602
245 Ga0501069_0670585 3300049585 Bacteria 625
246 Ga0501070_0130345 3300049586 Bacteria 2077
247 Ga0501071_0135993 3300049587 Bacteria 1829
248 Ga0501072_0240542 3300049588 Bacteria 1442
249 Ga0501073_0078071 3300049589 Bacteria 2304
250 Ga0501074_0005353 3300049590 Bacteria 9226
251 Ga0501074_0153313 3300049590 Bacteria 1647
252 Ga0501076_0046523 3300049592 Bacteria 3428
253 Ga0501076_0271715 3300049592 Bacteria 1388
254 Ga0501080_0936322 3300049742 Bacteria 754
255 Ga0501081_0050832 3300049743 Bacteria 2856
256 Ga0501044_0066437 3300049823 Bacteria 3677
257 Ga0501044_0142739 3300049823 Bacteria 2382
258 Ga0501044_0378111 3300049823 Bacteria 1332
259 Ga0501045_0133660 3300049824 Bacteria 1844
260 nmdc:mga00v17_153393_c1 3300050491 Bacteria 1480
261 nmdc:mga00v17_290105_c1 3300050491 Bacteria 1062
262 nmdc:mga00v17_409201_c1 3300050491 Bacteria 881
263 nmdc:mga00v17_555696_c1 3300050491 Bacteria 742
264 nmdc:mga00v17_96804_c1 3300050491 Bacteria 1859
265 nmdc:mga0yw44_1004899_c1 3300050492 Bacteria 565
266 nmdc:mga0yw44_111217_c1 3300050492 Bacteria 1755
267 nmdc:mga0yw44_144112_c1 3300050492 Bacteria 1550
268 nmdc:mga0yw44_213787_c1 3300050492 Bacteria 1276
269 nmdc:mga0yw44_41710_c1 3300050492 Bacteria 2733
270 nmdc:mga0yw44_55358_c1 3300050492 Bacteria 2413
271 nmdc:mga0yw44_55804_c1 3300050492 Bacteria 2404
272 nmdc:mga0yw44_616439_c1 3300050492 Bacteria 737
273 nmdc:mga0yw44_74707_c1 3300050492 Bacteria 2112
274 nmdc:mga0yw44_842_c1 3300050492 Bacteria 11463
275 nmdc:mga06z11_57471_c1 3300050494 Bacteria 2015
276 nmdc:mga06z11_84232_c1 3300050494 Bacteria 1713
277 nmdc:mga06z11_88460_c1 3300050494 Bacteria 1677
278 nmdc:mga07m45_152256_c1 3300050496 Bacteria 1341
279 nmdc:mga07m45_58929_c1 3300050496 Bacteria 2172
280 nmdc:mga08y16_1038877_c1 3300050511 Bacteria 797
281 Ga0500644_0119532 3300053088 Bacteria 1025
282 Ga0500616_0000317 3300053153 Bacteria 69238
283 Ga0501084_0328424 3300054114 Bacteria 1292
284 Ga0501082_0100660 3300060353 Bacteria 2500
285 Ga0501082_1673184 3300060353 Bacteria 555
286 Ga0466962_0272357 3300061719 Bacteria 834
287 2517760262 2517572101 Bacteria 6884336
288 2623498344 2622736605 Bacteria 4992138
289 2676200415 2675902999 Bacteria 9438463
290 2689957677 2687453737 Bacteria 11203906
291 2729908248 2728369276 Bacteria 5610032
292 2734972581 2734482000 Bacteria 5525167
293 2774844993 2773857921 Bacteria 9435764
294 2866554007 2866552031 Bacteria 5824618
295 2919716165 2919713450 Bacteria 7431245
296 8002791396 8002784119 Bacteria 9788632
297 8048137063 8048127548 Bacteria 11053136
298 8053953098 8053945823 Bacteria 8962862
299 Ga0070706_100454679
300 LJQas_1019882
301 Ga0070658_10020468
302 Ga0070658_10099273
303 Ga0070683_100939767
304 Ga0070682_100570653
305 Ga0070660_100001482
306 Ga0070687_100119170
307 Ga0070674_100601631
308 Ga0070659_100006320
309 Ga0070708_100678453
310 Ga0070678_100347639
311 Ga0070681_10289806
312 Ga0070681_10981612
313 Ga0068867_100331392
314 Ga0070706_100029929
315 Ga0070706_100094149
316 Ga0070706_100101160
317 Ga0070707_100008243
318 Ga0070707_100012849
319 Ga0070707_100026902
320 Ga0070707_100069666
321 Ga0070698_100076472
322 Ga0070698_100228926
323 Ga0070699_100090086
324 Ga0070699_100425661
325 Ga0070699_100454802
326 Ga0070699_100546907
327 Ga0070679_100224595
328 Ga0068855_100050603
329 Ga0068855_100132230
330 Ga0068857_100245820
331 Ga0068852_100307127
332 Ga0068852_101146984
333 Ga0068859_101589946
334 Ga0068866_10533229
335 Ga0068870_10072176
336 Ga0068862_100000256
337 Ga0081455_10008190
338 Ga0081538_10001498
339 Ga0081539_10010856
340 Ga0081539_10017256
341 Ga0070717_10016737
342 Ga0075365_10022232
343 Ga0075365_10042901
344 Ga0075365_10091063
345 Ga0075365_10111321
346 Ga0075365_10114113
347 Ga0075365_10115016
348 Ga0075365_10282826
349 Ga0075365_10303920
350 Ga0075368_10017395
351 Ga0075363_100094573
352 Ga0075364_10024174
353 Ga0075364_10223820
354 Ga0075364_10427910
355 Ga0075367_10049539
356 Ga0075367_10094884
357 Ga0075370_10066339
358 Ga0075370_10257498
359 Ga0075370_10449261
360 Ga0075428_100131863
361 Ga0068865_100312292
362 Ga0097620_100000175
363 Ga0097620_100001021
364 Ga0097620_101589948
365 Ga0099794_10027340
366 Ga0105243_12158483
367 Ga0105249_10006856
368 Ga0105246_10408704
369 Ga0105246_11235919
370 Ga0157369_10608941
371 Ga0157374_10356493
372 Ga0163162_10923022
373 Ga0163163_10016630
374 Ga0163163_10368808
375 Ga0163163_11085248
376 Ga0157380_10230289
377 Ga0182008_10239263
378 Ga0157377_10409007
379 Ga0157379_11307737
380 Ga0197907_10029721
381 Ga0197907_10341387
382 Ga0197907_10389905
383 Ga0206356_10808146
384 Ga0206351_10512830
385 Ga0206351_10843150
386 Ga0206350_11217055
387 Ga0206353_10251510
388 Ga0206353_11308120
389 Ga0206353_11915976
390 Ga0154015_1240438
391 Ga0213876_10088064
392 Ga0224712_10059680
393 Ga0224712_10163039
394 Ga0224712_10348036
395 Ga0207688_10265953
396 Ga0207688_10341576
397 Ga0207647_10048046
398 Ga0207647_10114191
399 Ga0207645_10139226
400 Ga0207684_10020163
401 Ga0207684_10140509
402 Ga0207684_10187676
403 Ga0207684_10410726
404 Ga0207684_10540325
405 Ga0207657_10020591
406 Ga0207652_10105970
407 Ga0207646_10001826
408 Ga0207646_10031069
409 Ga0207646_10156017
410 Ga0207650_10221010
411 Ga0207659_10249066
412 Ga0207687_10480654
413 Ga0207664_10175909
414 Ga0207690_10087149
415 Ga0207690_10111524
416 Ga0207706_10903586
417 Ga0207669_10585133
418 Ga0207669_11241377
419 Ga0207704_10479448
420 Ga0207691_10593356
421 Ga0207661_10242505
422 Ga0207667_10101493
423 Ga0207667_10974401
424 Ga0207712_10003481
425 Ga0207712_10950694
426 Ga0207668_10126929
427 Ga0207677_10173288
428 Ga0207677_11011093
429 Ga0207703_10006534
430 Ga0207678_10067917
431 Ga0207708_10301364
432 Ga0207641_10002519
433 Ga0207674_10097235
434 Ga0207674_11158326
435 Ga0207675_100040876
436 Ga0207675_100445374
437 Ga0207683_10809365
438 Ga0207698_10219897
439 Ga0209813_10071948
440 Ga0268265_10000019
441 Ga0268264_10000791
442 Ga0307408_100110924
443 Ga0307408_101083409
444 Ga0307508_10491967
445 Ga0307405_10150756
446 Ga0307413_10018624
447 Ga0307413_10160343
448 Ga0307410_10081398
449 Ga0326468_10005522
450 Ga0307406_10062253
451 Ga0307406_10086349
452 Ga0307407_10044472
453 Ga0307407_10106679
454 Ga0307407_10666205
455 Ga0307412_10334197
456 Ga0307409_100082589
457 Ga0307416_101067075
458 Ga0307414_10244953
459 Ga0307415_100072881
460 Ga0307415_100075645
461 Ga0307415_100221022
462 Ga0307415_100324354
463 Ga0307415_100440077
464 Ga0373938_0136152
465 Ga0373954_0333125
466 Ga0395899_0009315
467 Ga0395900_0422668
468 Ga0395898_0430977
469 Ga0436365_1174188
470 Ga0436365_1204706
471 Ga0451843_0766543
472 Ga0439450_001989
473 Ga0439455_0010444
474 Ga0439456_060013
475 Ga0439463_001203
476 Ga0450913_001099
477 Ga0450902_009980
478 Ga0439444_0003934
479 Ga0439464_0003007
480 Ga0439460_0001811
481 Ga0450916_003480
482 Ga0439440_0011010
483 Ga0466969_0005094
484 Ga0466966_0032220
485 Ga0466966_0267255
486 Ga0466961_0006117
487 Ga0466961_0308270
488 Ga0466963_0006863
489 Ga0466963_0234486
490 Ga0466964_0054106
491 Ga0466971_0015075
492 Ga0466971_0218546
493 Ga0466970_0022393
494 Ga0466957_0616527
495 Ga0466960_0244544
496 Ga0466960_0293996
497 Ga0466960_0297020
498 Ga0466960_0361184
499 Ga0466960_0630390
500 Ga0466959_0052117
501 Ga0466958_0322743
502 Ga0466967_0002873
503 Ga0466967_0006307
504 Ga0466967_0006624
505 Ga0466967_0009127
506 Ga0466967_0062199
507 Ga0466967_0959688
508 Ga0466967_0970864
509 Ga0466967_1729192
510 Ga0495607_0018045
511 Ga0495608_0638096
512 Ga0495640_0525010
513 Ga0495645_0169802
514 Ga0495599_0203905
515 Ga0495623_0448752
516 Ga0495613_0214472
517 Ga0495604_0316810
518 Ga0495604_0768833
519 Ga0495683_0001425
520 Ga0496100_0778250
521 Ga0496109_0373574
522 Ga0496111_0361552
523 Ga0496111_0525659
524 Ga0496117_0051387
525 Ga0496118_0003502
526 Ga0496119_0003572
527 Ga0496120_0056378
528 Ga0496121_0039180
529 Ga0496124_0111759
530 Ga0501034_0290581
531 Ga0501034_0913616
532 Ga0501036_0013645
533 Ga0501037_0199971
534 Ga0501038_0024429
535 Ga0501038_1184076
536 Ga0501039_0063178
537 Ga0501042_0148586
538 Ga0501043_0015645
539 Ga0501043_0304167
540 Ga0501047_0057343
541 Ga0501048_0012647
542 Ga0501067_0629925
543 Ga0501069_0670585
544 Ga0501070_0130345
545 Ga0501071_0135993
546 Ga0501072_0240542
547 Ga0501073_0078071
548 Ga0501074_0005353
549 Ga0501074_0153313
550 Ga0501076_0046523
551 Ga0501076_0271715
552 Ga0501080_0936322
553 Ga0501081_0050832
554 Ga0501044_0066437
555 Ga0501044_0142739
556 Ga0501044_0378111
557 Ga0501045_0133660
558 nmdc:mga00v17_153393_c1
559 nmdc:mga00v17_290105_c1
560 nmdc:mga00v17_409201_c1
561 nmdc:mga00v17_555696_c1
562 nmdc:mga00v17_96804_c1
563 nmdc:mga0yw44_1004899_c1
564 nmdc:mga0yw44_111217_c1
565 nmdc:mga0yw44_144112_c1
566 nmdc:mga0yw44_213787_c1
567 nmdc:mga0yw44_41710_c1
568 nmdc:mga0yw44_55358_c1
569 nmdc:mga0yw44_55804_c1
570 nmdc:mga0yw44_616439_c1
571 nmdc:mga0yw44_74707_c1
572 nmdc:mga0yw44_842_c1
573 nmdc:mga06z11_57471_c1
574 nmdc:mga06z11_84232_c1
575 nmdc:mga06z11_88460_c1
576 nmdc:mga07m45_152256_c1
577 nmdc:mga07m45_58929_c1
578 nmdc:mga08y16_1038877_c1
579 Ga0500644_0119532
580 Ga0500616_0000317
581 Ga0501084_0328424
582 Ga0501082_0100660
583 Ga0501082_1673184
584 Ga0466962_0272357
585 2517760262
586 2623498344
587 2676200415
588 2689957677
589 2729908248
590 2734972581
591 2774844993
592 2866554007
593 2919716165
594 8002791396
595 8048137063
596 8053953098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

28

177

0.86

PF04978

DUF664

Protein of unknown function (DUF664)

24

186

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.9879 3 165
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9853 3 165
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.9529 3 165
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.9395 1 169
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9394 3 165
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9883 3 166 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9535 3 166 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9426 1 169 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9372 1 169 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7474 3 159 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A640ULB5-F1-model_v4 deleted 0.9947 3 166
AF-K1DV65-F1-model_v4 Chorismate synthase 0.9941 15 167
AF-A0A1C4QEN6-F1-model_v4 DinB-like domain-containing protein 0.994 1 164
AF-A0A837D8Q8-F1-model_v4 Chorismate synthase 0.9935 5 169
AF-A4FE09-F1-model_v4 DUF664 domain-containing protein 0.9933 46 168

Map