F393910

General Info

Members Datasets Scaffolds Average Seq Length
297 258 223 338

Family's Representative Sequence

Representative Sequence 3300049523|Ga0501300_001002|Ga0501300_001002_2976_4229
Length 417
Sequence MEPRFAPTAILEGMGNYRLLRDNFLQEDREPVHGGREERDVLRHGETPLQDWPIEHCCPSSSEIIGARISPHLPSEDLTMRRYEIRNAGGLDGLVIADRPERPLGRGEVRVRIRAASLNYRDLMVAKGMFPGGLPENLVPLSDGAGEVVETGPDVTRVAVGDRVMPIFKQSWIGGVIEPADNATTLGGAIDGVLAEGGVFDQNGLVHLPAGLSYAEGATLPCAAVTAWSAVQSARPVTAGDTVLVLGTGGVATFALQFARAAGARVIVTSSSDEKLERAKALGASDGVNYRTHADWGDKVRALTGGRGVDLVVETGGGGTIVQSIAATRLAGAISLVGVITQGLFDPLLIMRANLTVKGIGVGSRKDFEAMNRAIVVNDIRPVIDRTFAFEEAAEAFRYLEGGEHFGKIVITVGEDH

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
5 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
6 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
7 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
8 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
9 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
10 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
11 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
12 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
13 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
14 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
15 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
16 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
17 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
18 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
19 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
20 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
21 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
22 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
23 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
24 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
25 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
26 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
27 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
28 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
29 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
30 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
31 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
32 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
33 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
34 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
35 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
36 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
37 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
38 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
39 2919085039 Luteibacter sp. 1214 Isolate Unclassified
40 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
41 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
42 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
43 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
44 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
45 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
46 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
47 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
48 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
49 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
50 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
51 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
52 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
53 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
54 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
55 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
56 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
57 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
58 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
59 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
60 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
61 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
62 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
63 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
64 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
65 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
66 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
67 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
68 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
69 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
70 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
71 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
72 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
73 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
76 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
77 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
78 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
79 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
80 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
81 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
88 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
92 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
93 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
127 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
155 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
200 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
201 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
202 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
219 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
224 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
225 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
226 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
256 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
257 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
258 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.08
Metatranscriptomes 0
Isolates 24.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.13
Nodule 15.82
Rhizoplane 0.67
Rhizosphere 56.9
Stem 0
Stem Tuber 0
Unclassified 13.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1016126 3300002705 Bacteria 1465
2 JGI25157J39369_1001142 3300002741 Bacteria 11536
3 JGI25159J45721_1001078 3300002987 Bacteria 11655
4 JGI25165J46597_1000021 3300003214 Bacteria 359288
5 rootH1_10244500 3300003323 Bacteria 4331
6 JGI25160J50197_1000023 3300003354 Bacteria 200692
7 JGI25161J50226_1000012 3300003374 Bacteria 200668
8 Ga0055542_1000473 3300003762 Bacteria 37513
9 Ga0055529_1003586 3300003763 Bacteria 2533
10 Ga0058692_1004754 3300003856 Bacteria 3978
11 Ga0055543_1000009 3300004625 Bacteria 200706
12 Ga0065165_1000064 3300005262 Bacteria 175153
13 Ga0070658_10044259 3300005327 Bacteria 3597
14 Ga0070666_10000249 3300005335 Bacteria 35973
15 Ga0070680_100354205 3300005336 Bacteria 1248
16 Ga0070667_100005675 3300005367 Bacteria 10425
17 Ga0070667_100090097 3300005367 Bacteria 2636
18 Ga0070713_100021079 3300005436 Bacteria 5006
19 Ga0070705_100083457 3300005440 Bacteria 1969
20 Ga0070678_100105801 3300005456 Bacteria 2191
21 Ga0068867_100066441 3300005459 Unclassified 2686
22 Ga0070706_100045068 3300005467 Bacteria 4074
23 Ga0070698_100293360 3300005471 Bacteria 1557
24 Ga0070679_100453760 3300005530 Bacteria 1227
25 Ga0068853_100264639 3300005539 Bacteria 1582
26 Ga0070665_100470589 3300005548 Bacteria 1267
27 Ga0070704_100007299 3300005549 Bacteria 6575
28 Ga0068855_100140855 3300005563 Bacteria 2749
29 Ga0068857_100226891 3300005577 Bacteria 1707
30 Ga0068858_100000587 3300005842 Bacteria 38232
31 Ga0068858_100019203 3300005842 Bacteria 6393
32 Ga0081455_10003566 3300005937 Bacteria 17857
33 Ga0075365_10051540 3300006038 Bacteria 2718
34 Ga0070712_100000665 3300006175 Bacteria 20318
35 Ga0070712_100338535 3300006175 Bacteria 1228
36 Ga0075362_10012821 3300006177 Bacteria 3339
37 Ga0075367_10078296 3300006178 Bacteria 1996
38 Ga0075369_10024594 3300006186 Bacteria 2497
39 Ga0075370_10057088 3300006353 Bacteria 2218
40 Ga0075428_100528248 3300006844 Bacteria 1262
41 Ga0075430_100040744 3300006846 Bacteria 3931
42 Ga0075431_100190829 3300006847 Bacteria 2099
43 Ga0075429_100001425 3300006880 Bacteria 19617
44 Ga0111539_10069073 3300009094 Bacteria 4172
45 Ga0111539_10094424 3300009094 Bacteria 3514
46 Ga0105245_10000461 3300009098 Bacteria 37259
47 Ga0114129_10004648 3300009147 Bacteria 19380
48 Ga0105241_10041731 3300009174 Bacteria 3468
49 Ga0105241_10117452 3300009174 Bacteria 2138
50 Ga0105248_10089261 3300009177 Bacteria 3470
51 Ga0105238_10156954 3300009551 Bacteria 2250
52 Ga0105249_10249379 3300009553 Bacteria 1759
53 Ga0105239_10016394 3300010375 Bacteria 8196
54 Ga0105239_10158009 3300010375 Bacteria 2532
55 Ga0105239_10435975 3300010375 Bacteria 1485
56 Ga0105239_10490174 3300010375 Bacteria 1397
57 Ga0157374_10578447 3300013296 Bacteria 1132
58 Ga0163162_10122626 3300013306 Bacteria 2704
59 Ga0182008_10007150 3300014497 Bacteria 6181
60 Ga0157379_10015853 3300014968 Bacteria 6623
61 Ga0182007_10045740 3300015262 Bacteria 1450
62 Ga0182005_1000034 3300015265 Bacteria 180998
63 Ga0213875_10031798 3300021388 Bacteria 2495
64 Ga0224572_1014533 3300024225 Bacteria 1504
65 Ga0209436_106850 3300025208 Bacteria 2445
66 Ga0209026_1000041 3300025250 Bacteria 275745
67 Ga0209148_1000317 3300025254 Bacteria 67724
68 Ga0209759_1000168 3300025256 Bacteria 111106
69 Ga0209233_1000065 3300025261 Bacteria 387195
70 Ga0209455_1000152 3300025272 Bacteria 125942
71 Ga0209130_1000048 3300025284 Bacteria 233357
72 Ga0209758_1011784 3300025297 Bacteria 5008
73 Ga0209256_1037403 3300025299 Bacteria 1264
74 Ga0207426_1000136 3300025302 Bacteria 201401
75 Ga0207680_10000678 3300025903 Bacteria 16104
76 Ga0207647_10006873 3300025904 Bacteria 8249
77 Ga0207645_10041029 3300025907 Bacteria 2964
78 Ga0207705_10016617 3300025909 Bacteria 5270
79 Ga0207684_10038024 3300025910 Bacteria 4084
80 Ga0207654_10218397 3300025911 Bacteria 1263
81 Ga0207693_10126153 3300025915 Bacteria 2012
82 Ga0207663_10186480 3300025916 Bacteria 1486
83 Ga0207687_10001043 3300025927 Bacteria 18838
84 Ga0207700_10015709 3300025928 Bacteria 5006
85 Ga0207711_10056440 3300025941 Bacteria 3375
86 Ga0207658_10143318 3300025986 Bacteria 1937
87 Ga0207703_10002022 3300026035 Bacteria 17905
88 Ga0207703_10103801 3300026035 Bacteria 2414
89 Ga0209371_1003105 3300027312 Bacteria 8470
90 Ga0209371_1003931 3300027312 Bacteria 6820
91 Ga0268264_10383245 3300028381 Bacteria 1347
92 Ga0265334_10045422 3300028573 Bacteria 1701
93 Ga0265338_10013782 3300028800 Bacteria 9085
94 Ga0265338_10024992 3300028800 Bacteria 6081
95 Ga0265338_10046834 3300028800 Bacteria 3957
96 Ga0268256_1002793 3300030500 Bacteria 8470
97 Ga0268256_1004762 3300030500 Bacteria 5521
98 Ga0316180_1166144 3300030736 Bacteria 1728
99 Ga0265325_10083166 3300031241 Bacteria 1588
100 Ga0265339_10037866 3300031249 Bacteria 2693
101 Ga0265327_10019700 3300031251 Bacteria 4137
102 Ga0307513_10019828 3300031456 Bacteria 7993
103 Ga0307509_10000005 3300031507 Bacteria 435959
104 Ga0307408_100013406 3300031548 Bacteria 5440
105 Ga0307408_100118897 3300031548 Bacteria 2044
106 Ga0307508_10000405 3300031616 Bacteria 51700
107 Ga0265314_10006917 3300031711 Bacteria 9933
108 Ga0265314_10087950 3300031711 Bacteria 2030
109 Ga0307406_10024692 3300031901 Bacteria 3592
110 Ga0307409_100036613 3300031995 Bacteria 3609
111 Ga0307416_100022146 3300032002 Bacteria 4580
112 Ga0307416_100036824 3300032002 Bacteria 3758
113 Ga0307415_100309757 3300032126 Unclassified 1312
114 Ga0307510_10158180 3300033180 Unclassified 1869
115 Ga0373954_0041540 3300035118 Bacteria 2145
116 Ga0373935_0094953 3300035692 Bacteria 1958
117 Ga0373927_0148264 3300035695 Bacteria 1536
118 Ga0373925_0126851 3300037068 Bacteria 1986
119 Ga0395899_0114035 3300037312 Bacteria 1941
120 Ga0436364_0619920 3300037853 Bacteria 1863
121 Ga0436365_0494725 3300039437 Bacteria 6084
122 Ga0439431_0009805 3300041997 Bacteria 2167
123 Ga0466969_0001162 3300044656 Bacteria 14168
124 Ga0466961_0006979 3300044693 Bacteria 7183
125 Ga0466968_0002475 3300044735 Bacteria 6786
126 Ga0466959_0001415 3300045049 Bacteria 14672
127 Ga0495638_0054151 3300046460 Bacteria 2495
128 Ga0495650_0025294 3300046471 Bacteria 2786
129 Ga0495607_0000080 3300046501 Bacteria 97217
130 Ga0495607_0008965 3300046501 Bacteria 6809
131 Ga0495610_0020451 3300046512 Bacteria 3675
132 Ga0495610_0050695 3300046512 Bacteria 2025
133 Ga0495632_0000016 3300046519 Bacteria 232022
134 Ga0495632_0124533 3300046519 Bacteria 1202
135 Ga0495643_0022574 3300046522 Bacteria 3589
136 Ga0495643_0060003 3300046522 Bacteria 2020
137 Ga0495667_0070795 3300046559 Bacteria 2275
138 Ga0495625_0038037 3300046660 Bacteria 3524
139 Ga0495625_0052538 3300046660 Bacteria 2918
140 Ga0495635_0138114 3300046663 Bacteria 1661
141 Ga0495649_0119885 3300046694 Bacteria 1392
142 Ga0495684_0049481 3300047471 Bacteria 3211
143 Ga0496101_0102285 3300048904 Bacteria 2146
144 Ga0496119_0013895 3300048922 Bacteria 6354
145 Ga0496119_0014278 3300048922 Bacteria 6235
146 Ga0496119_0047903 3300048922 Bacteria 2655
147 Ga0496120_0004369 3300048923 Bacteria 11926
148 Ga0496120_0063774 3300048923 Bacteria 2048
149 Ga0496121_0014286 3300048924 Bacteria 8443
150 Ga0496124_0028493 3300048927 Bacteria 4995
151 Ga0496125_0156923 3300048928 Bacteria 1553
152 Ga0496126_0073502 3300048929 Unclassified 3039
153 Ga0501290_000630 3300049513 Bacteria 5283
154 Ga0501292_000024 3300049515 Bacteria 43042
155 Ga0501294_001397 3300049517 Bacteria 2446
156 Ga0501300_001002 3300049523 Bacteria 4309
157 Ga0501034_0247108 3300049571 Bacteria 1729
158 Ga0501042_0062157 3300049578 Bacteria 2668
159 Ga0501067_0003875 3300049583 Bacteria 8256
160 Ga0501070_0297664 3300049586 Bacteria 1315
161 Ga0501071_0039589 3300049587 Bacteria 3372
162 Ga0501072_0009299 3300049588 Bacteria 7471
163 Ga0501072_0134337 3300049588 Bacteria 1973
164 Ga0501075_0001358 3300049591 Bacteria 15913
165 Ga0501077_0001418 3300049593 Bacteria 14396
166 Ga0501223_000076 3300049663 Bacteria 29950
167 Ga0501223_000261 3300049663 Bacteria 13355
168 Ga0501223_001356 3300049663 Bacteria 5663
169 Ga0501224_000020 3300049664 Bacteria 74346
170 Ga0501224_009655 3300049664 Bacteria 1413
171 Ga0501233_000035 3300049668 Bacteria 17872
172 Ga0501235_000602 3300049669 Bacteria 7246
173 Ga0501257_000038 3300049686 Bacteria 37260
174 Ga0501257_000061 3300049686 Bacteria 30058
175 Ga0501259_001211 3300049688 Bacteria 4298
176 Ga0501225_0000009 3300049705 Bacteria 90065
177 Ga0501225_0001025 3300049705 Bacteria 8757
178 Ga0501225_0028816 3300049705 Bacteria 1525
179 Ga0501234_000668 3300049707 Bacteria 5303
180 Ga0501245_000341 3300049708 Bacteria 5577
181 Ga0501079_0098140 3300049741 Bacteria 2271
182 Ga0501080_0121459 3300049742 Bacteria 2420
183 Ga0501083_0144711 3300049744 Bacteria 1556
184 Ga0501280_000349 3300049776 Bacteria 11520
185 Ga0501281_00245 3300049777 Bacteria 5870
186 Ga0501282_000011 3300049778 Bacteria 31088
187 Ga0501283_000964 3300049779 Bacteria 3813
188 Ga0501044_0000174 3300049823 Bacteria 79875
189 Ga0501045_0119957 3300049824 Bacteria 1952
190 Ga0501226_000044 3300049853 Bacteria 56354
191 nmdc:mga06z11_20347_c1 3300050494 Bacteria 3066
192 nmdc:mga07m45_21428_c1 3300050496 Bacteria 3519
193 nmdc:mga05p37_20477_c1 3300050507 Bacteria 8002
194 nmdc:mga09592_51771_c1 3300050508 Bacteria 3465
195 nmdc:mga0qj67_1594_c1 3300050509 Bacteria 15958
196 nmdc:mga06r32_47223_c1 3300050510 Bacteria 4112
197 nmdc:mga08y16_113674_c1 3300050511 Bacteria 2818
198 nmdc:mga08y16_32018_c1 3300050511 Bacteria 5530
199 nmdc:mga0sz30_1281_c1 3300050516 Bacteria 8958
200 Ga0495601_0135951 3300053077 Bacteria 1602
201 Ga0495601_0169685 3300053077 Bacteria 1426
202 Ga0495595_0039533 3300053084 Bacteria 2152
203 Ga0495619_0011158 3300053085 Bacteria 5652
204 Ga0500651_0054807 3300053093 Unclassified 2498
205 Ga0500592_000026 3300053116 Bacteria 49457
206 Ga0500595_011096 3300053119 Bacteria 3545
207 Ga0500595_056171 3300053119 Bacteria 1203
208 Ga0500652_000015 3300053131 Bacteria 131012
209 Ga0500568_0046061 3300053139 Bacteria 1733
210 Ga0500616_0018353 3300053153 Unclassified 3957
211 Ga0500620_000201 3300053155 Bacteria 11882
212 Ga0500620_029952 3300053155 Bacteria 1714
213 Ga0500622_0000523 3300053156 Bacteria 35657
214 Ga0500622_0008696 3300053156 Bacteria 5663
215 Ga0500627_0000095 3300053158 Bacteria 29627
216 Ga0500636_0141690 3300053177 Bacteria 1330
217 Ga0500637_0004096 3300053178 Bacteria 6859
218 Ga0500611_004430 3300053727 Bacteria 1894
219 Ga0501084_0030469 3300054114 Bacteria 4512
220 Ga0501082_0000015 3300060353 Bacteria 116737
221 Ga0501082_0172714 3300060353 Bacteria 1879
222 Ga0530510_0051985 3300061734 Bacteria 2961
223 Ga0530510_0181639 3300061734 Unclassified 1560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0114035 Ga0395899_0114035_713_1726 299
2 3300037853 Ga0436364_0619920 Ga0436364_0619920_933_1844 303
3 3300005937 Ga0081455_10003566 Ga0081455_1000356611 312
4 3300009094 Ga0111539_10069073 Ga0111539_100690732 314
5 3300050511 nmdc:mga08y16_32018_c1 nmdc:mga08y16_32018_c1_3877_4881 314
6 3300046471 Ga0495650_0025294 Ga0495650_0025294_1572_2588 319
7 3300005336 Ga0070680_100354205 Ga0070680_1003542051 320
8 3300048922 Ga0496119_0013895 Ga0496119_0013895_4378_5463 323
9 3300048923 Ga0496120_0004369 Ga0496120_0004369_1849_2934 323
10 3300053119 Ga0500595_056171 Ga0500595_056171_66_1082 323
11 3300028573 Ga0265334_10045422 Ga0265334_100454222 324
12 3300005471 Ga0070698_100293360 Ga0070698_1002933602 326
13 3300010375 Ga0105239_10016394 Ga0105239_100163946 326
14 3300013296 Ga0157374_10578447 Ga0157374_105784471 326
15 3300014497 Ga0182008_10007150 Ga0182008_100071505 326
16 3300015262 Ga0182007_10045740 Ga0182007_100457402 326
17 3300028800 Ga0265338_10024992 Ga0265338_100249923 326
18 3300031251 Ga0265327_10019700 Ga0265327_100197002 326
19 3300046501 Ga0495607_0008965 Ga0495607_0008965_4640_5668 327
20 3300049587 Ga0501071_0039589 Ga0501071_0039589_563_1573 328
21 3300049588 Ga0501072_0009299 Ga0501072_0009299_5717_6727 328
22 3300049741 Ga0501079_0098140 Ga0501079_0098140_604_1614 328
23 3300049744 Ga0501083_0144711 Ga0501083_0144711_457_1467 328
24 3300049824 Ga0501045_0119957 Ga0501045_0119957_104_1114 328
25 3300054114 Ga0501084_0030469 Ga0501084_0030469_3452_4462 328
26 3300060353 Ga0501082_0172714 Ga0501082_0172714_31_1041 328
27 3300061734 Ga0530510_0051985 Ga0530510_0051985_52_1062 328
28 3300005440 Ga0070705_100083457 Ga0070705_1000834572 330
29 3300005467 Ga0070706_100045068 Ga0070706_1000450683 330
30 3300025910 Ga0207684_10038024 Ga0207684_100380243 330
31 iso_pu_bacteria 2791355123 2792752509 330
32 iso_pu_bacteria 2874168670 2874169553 330
33 iso_pu_bacteria 2919085039 2919087805 330
34 iso_pu_bacteria 2924733363 2924739069 330
35 3300005327 Ga0070658_10044259 Ga0070658_100442594 331
36 3300025909 Ga0207705_10016617 Ga0207705_100166172 331
37 3300046512 Ga0495610_0020451 Ga0495610_0020451_2614_3633 331
38 3300046522 Ga0495643_0022574 Ga0495643_0022574_1422_2537 331
39 3300048924 Ga0496121_0014286 Ga0496121_0014286_2196_3311 331
40 3300048927 Ga0496124_0028493 Ga0496124_0028493_890_2005 331
41 3300053139 Ga0500568_0046061 Ga0500568_0046061_60_1175 331
42 3300053156 Ga0500622_0000523 Ga0500622_0000523_29073_30188 331
43 iso_pu_bacteria 2511231025 2511382985 331
44 3300003214 JGI25165J46597_1000021 JGI25165J46597_1000021133 332
45 3300005539 Ga0068853_100264639 Ga0068853_1002646391 332
46 3300005842 Ga0068858_100000587 Ga0068858_10000058727 332
47 3300009098 Ga0105245_10000461 Ga0105245_1000046119 332
48 3300013306 Ga0163162_10122626 Ga0163162_101226261 332
49 3300025261 Ga0209233_1000065 Ga0209233_1000065134 332
50 3300025927 Ga0207687_10001043 Ga0207687_1000104310 332
51 3300026035 Ga0207703_10002022 Ga0207703_100020229 332
52 3300031616 Ga0307508_10000405 Ga0307508_1000040528 332
53 iso_pu_bacteria 2576861424 2578337551 332
54 iso_pu_bacteria 2579778775 2580933684 332
55 iso_pu_bacteria 2585428059 2587738821 332
56 iso_pu_bacteria 2619619294 2621275394 332
57 iso_pu_bacteria 2643221676 2644424792 332
58 iso_pu_bacteria 2857465823 2857471426 332
59 iso_pu_bacteria 2857591370 2857592392 332
60 iso_pu_bacteria 2865002811 2865008740 332
61 iso_pu_bacteria 2881636855 2881637105 332
62 iso_pu_bacteria 2919425241 2919431180 332
63 iso_pu_bacteria 2971511577 2971512163 332
64 iso_pu_bacteria 2980176882 2980177254 332
65 3300031241 Ga0265325_10083166 Ga0265325_100831662 333
66 3300031249 Ga0265339_10037866 Ga0265339_100378663 333
67 3300049686 Ga0501257_000061 Ga0501257_000061_4229_5236 333
68 iso_pu_bacteria 2523231067 2523468926 333
69 3300005367 Ga0070667_100005675 Ga0070667_1000056758 334
70 3300005436 Ga0070713_100021079 Ga0070713_1000210796 334
71 3300005459 Ga0068867_100066441 Ga0068867_1000664412 334
72 3300005577 Ga0068857_100226891 Ga0068857_1002268912 334
73 3300006844 Ga0075428_100528248 Ga0075428_1005282481 334
74 3300006846 Ga0075430_100040744 Ga0075430_1000407442 334
75 3300006847 Ga0075431_100190829 Ga0075431_1001908292 334
76 3300006880 Ga0075429_100001425 Ga0075429_10000142517 334
77 3300009094 Ga0111539_10094424 Ga0111539_100944242 334
78 3300009147 Ga0114129_10004648 Ga0114129_1000464810 334
79 3300009551 Ga0105238_10156954 Ga0105238_101569542 334
80 3300010375 Ga0105239_10435975 Ga0105239_104359751 334
81 3300015265 Ga0182005_1000034 Ga0182005_100003464 334
82 3300021388 Ga0213875_10031798 Ga0213875_100317982 334
83 3300025928 Ga0207700_10015709 Ga0207700_100157096 334
84 3300028800 Ga0265338_10013782 Ga0265338_100137826 334
85 3300031711 Ga0265314_10087950 Ga0265314_100879502 334
86 3300032002 Ga0307416_100022146 Ga0307416_1000221462 334
87 3300035118 Ga0373954_0041540 Ga0373954_0041540_985_1995 334
88 3300035695 Ga0373927_0148264 Ga0373927_0148264_13_1023 334
89 3300046501 Ga0495607_0000080 Ga0495607_0000080_73133_74137 334
90 3300050507 nmdc:mga05p37_20477_c1 nmdc:mga05p37_20477_c1_4469_5473 334
91 3300050508 nmdc:mga09592_51771_c1 nmdc:mga09592_51771_c1_1934_2938 334
92 3300050509 nmdc:mga0qj67_1594_c1 nmdc:mga0qj67_1594_c1_12425_13429 334
93 3300050510 nmdc:mga06r32_47223_c1 nmdc:mga06r32_47223_c1_2063_3067 334
94 3300050511 nmdc:mga08y16_113674_c1 nmdc:mga08y16_113674_c1_694_1698 334
95 3300053153 Ga0500616_0018353 Ga0500616_0018353_56_1060 334
96 3300053156 Ga0500622_0008696 Ga0500622_0008696_166_1206 334
97 iso_pu_bacteria 2508501123 2509113323 334
98 iso_pu_bacteria 2512875016 2512933302 334
99 iso_pu_bacteria 2599185301 2599937225 334
100 iso_pu_bacteria 2841734538 2841736113 334
101 iso_pu_bacteria 2842357229 2842362977 334
102 iso_pu_bacteria 2852387548 2852389197 334
103 iso_pu_bacteria 2856364286 2856366461 334
104 iso_pu_bacteria 2869285874 2869288128 334
105 iso_pu_bacteria 2871429161 2871430014 334
106 iso_pu_bacteria 2874123672 2874130334 334
107 iso_pu_bacteria 2874139085 2874146418 334
108 iso_pu_bacteria 2874146452 2874151761 334
109 iso_pu_bacteria 2874155637 2874159393 334
110 iso_pu_bacteria 2874168670 2874176576 334
111 iso_pu_bacteria 2876363079 2876364445 334
112 iso_pu_bacteria 2876413966 2876417812 334
113 iso_pu_bacteria 2878738818 2878741466 334
114 iso_pu_bacteria 2878745973 2878749639 334
115 iso_pu_bacteria 2903448605 2903455030 334
116 iso_pu_bacteria 2903492973 2903493868 334
117 iso_pu_bacteria 2903521522 2903523430 334
118 iso_pu_bacteria 2903528002 2903529198 334
119 iso_pu_bacteria 2906308376 2906310677 334
120 iso_pu_bacteria 2906321335 2906324740 334
121 iso_pu_bacteria 2924718760 2924719653 334
122 iso_pu_bacteria 2924776078 2924779148 334
123 iso_pu_bacteria 2937813078 2937817504 334
124 iso_pu_bacteria 2937822353 2937827511 334
125 iso_pu_bacteria 2937848649 2937849426 334
126 iso_pu_bacteria 2937877337 2937883199 334
127 iso_pu_bacteria 2937972304 2937979187 334
128 iso_pu_bacteria 2958034702 2958041044 334
129 iso_pu_bacteria 2958041894 2958057538 334
130 iso_pu_bacteria 2958084443 2958090365 334
131 iso_pu_bacteria 2958130278 2958132530 334
132 iso_pu_bacteria 2958144490 2958145141 334
133 iso_pu_bacteria 2958179912 2958182344 334
134 iso_pu_bacteria 2961077736 2961080189 334
135 iso_pu_bacteria 2963644680 2963645902 334
136 iso_pu_bacteria 2968016561 2968022638 334
137 iso_pu_bacteria 2968083720 2968089412 334
138 iso_pu_bacteria 2970469710 2970475222 334
139 iso_pu_bacteria 2970593180 2970599955 334
140 iso_pu_bacteria 2977843712 2977847791 334
141 iso_pu_bacteria 2977922695 2977923704 334
142 iso_pu_bacteria 2996348954 2996353351 334
143 iso_pu_bacteria 3000135777 3000141631 334
144 iso_pu_bacteria 3004211236 3004212955 334
145 iso_pu_bacteria 3004218560 3004220634 334
146 iso_pu_bacteria 3004275668 3004280033 334
147 iso_pu_bacteria 3004334049 3004336544 334
148 iso_pu_bacteria 637000159 637076383 334
149 iso_pu_bacteria 8004387939 8004389915 334
150 iso_pu_bacteria 8004714634 8004718312 334
151 3300003323 rootH1_10244500 rootH1_102445005 335
152 3300003856 Ga0058692_1004754 Ga0058692_10047543 335
153 3300005335 Ga0070666_10000249 Ga0070666_100002495 335
154 3300005367 Ga0070667_100090097 Ga0070667_1000900972 335
155 3300005563 Ga0068855_100140855 Ga0068855_1001408552 335
156 3300005842 Ga0068858_100019203 Ga0068858_1000192032 335
157 3300006175 Ga0070712_100000665 Ga0070712_10000066516 335
158 3300006178 Ga0075367_10078296 Ga0075367_100782963 335
159 3300009174 Ga0105241_10117452 Ga0105241_101174522 335
160 3300009177 Ga0105248_10089261 Ga0105248_100892613 335
161 3300014968 Ga0157379_10015853 Ga0157379_100158534 335
162 3300025903 Ga0207680_10000678 Ga0207680_100006786 335
163 3300025941 Ga0207711_10056440 Ga0207711_100564402 335
164 3300025986 Ga0207658_10143318 Ga0207658_101433182 335
165 3300026035 Ga0207703_10103801 Ga0207703_101038012 335
166 3300027312 Ga0209371_1003105 Ga0209371_10031058 335
167 3300027312 Ga0209371_1003931 Ga0209371_10039312 335
168 3300028381 Ga0268264_10383245 Ga0268264_103832451 335
169 3300028800 Ga0265338_10046834 Ga0265338_100468344 335
170 3300030500 Ga0268256_1002793 Ga0268256_10027938 335
171 3300030500 Ga0268256_1004762 Ga0268256_10047625 335
172 3300031711 Ga0265314_10006917 Ga0265314_100069176 335
173 3300031995 Ga0307409_100036613 Ga0307409_1000366132 335
174 3300046519 Ga0495632_0000016 Ga0495632_0000016_195518_196555 335
175 3300046519 Ga0495632_0124533 Ga0495632_0124533_30_1121 335
176 3300048904 Ga0496101_0102285 Ga0496101_0102285_869_1876 335
177 3300048922 Ga0496119_0047903 Ga0496119_0047903_917_1927 335
178 3300050494 nmdc:mga06z11_20347_c1 nmdc:mga06z11_20347_c1_526_1533 335
179 3300053119 Ga0500595_011096 Ga0500595_011096_2290_3297 335
180 3300053131 Ga0500652_000015 Ga0500652_000015_47533_48540 335
181 3300053177 Ga0500636_0141690 Ga0500636_0141690_198_1205 335
182 3300061734 Ga0530510_0181639 Ga0530510_0181639_36_1049 335
183 3300005456 Ga0070678_100105801 Ga0070678_1001058012 336
184 3300005530 Ga0070679_100453760 Ga0070679_1004537601 336
185 3300005548 Ga0070665_100470589 Ga0070665_1004705892 336
186 3300006038 Ga0075365_10051540 Ga0075365_100515402 336
187 3300006175 Ga0070712_100338535 Ga0070712_1003385351 336
188 3300006186 Ga0075369_10024594 Ga0075369_100245942 336
189 3300025907 Ga0207645_10041029 Ga0207645_100410293 336
190 3300025915 Ga0207693_10126153 Ga0207693_101261531 336
191 3300030736 Ga0316180_1166144 Ga0316180_11661442 336
192 3300031456 Ga0307513_10019828 Ga0307513_100198282 336
193 3300031507 Ga0307509_10000005 Ga0307509_10000005214 336
194 3300031548 Ga0307408_100013406 Ga0307408_1000134065 336
195 3300031548 Ga0307408_100118897 Ga0307408_1001188971 336
196 3300031901 Ga0307406_10024692 Ga0307406_100246924 336
197 3300033180 Ga0307510_10158180 Ga0307510_101581802 336
198 3300035692 Ga0373935_0094953 Ga0373935_0094953_415_1425 336
199 3300037068 Ga0373925_0126851 Ga0373925_0126851_604_1614 336
200 3300039437 Ga0436365_0494725 Ga0436365_0494725_2092_3102 336
201 3300044656 Ga0466969_0001162 Ga0466969_0001162_9908_10918 336
202 3300044693 Ga0466961_0006979 Ga0466961_0006979_1443_2453 336
203 3300044735 Ga0466968_0002475 Ga0466968_0002475_496_1506 336
204 3300045049 Ga0466959_0001415 Ga0466959_0001415_4097_5107 336
205 3300046460 Ga0495638_0054151 Ga0495638_0054151_219_1322 336
206 3300046522 Ga0495643_0060003 Ga0495643_0060003_980_1990 336
207 3300046559 Ga0495667_0070795 Ga0495667_0070795_1191_2204 336
208 3300046660 Ga0495625_0052538 Ga0495625_0052538_800_1816 336
209 3300046663 Ga0495635_0138114 Ga0495635_0138114_444_1457 336
210 3300047471 Ga0495684_0049481 Ga0495684_0049481_585_1598 336
211 3300048929 Ga0496126_0073502 Ga0496126_0073502_394_1500 336
212 3300049513 Ga0501290_000630 Ga0501290_000630_4108_5124 336
213 3300049515 Ga0501292_000024 Ga0501292_000024_40200_41216 336
214 3300049517 Ga0501294_001397 Ga0501294_001397_1271_2287 336
215 3300049523 Ga0501300_001002 Ga0501300_001002_2976_4229 336
216 3300049578 Ga0501042_0062157 Ga0501042_0062157_469_1479 336
217 3300049583 Ga0501067_0003875 Ga0501067_0003875_6997_8007 336
218 3300049591 Ga0501075_0001358 Ga0501075_0001358_12218_13228 336
219 3300049593 Ga0501077_0001418 Ga0501077_0001418_10717_11727 336
220 3300049663 Ga0501223_000076 Ga0501223_000076_27759_28775 336
221 3300049663 Ga0501223_000261 Ga0501223_000261_7451_8467 336
222 3300049663 Ga0501223_001356 Ga0501223_001356_4488_5504 336
223 3300049664 Ga0501224_000020 Ga0501224_000020_45553_46569 336
224 3300049664 Ga0501224_009655 Ga0501224_009655_261_1277 336
225 3300049668 Ga0501233_000035 Ga0501233_000035_8777_9865 336
226 3300049669 Ga0501235_000602 Ga0501235_000602_1224_2312 336
227 3300049686 Ga0501257_000038 Ga0501257_000038_35756_36772 336
228 3300049688 Ga0501259_001211 Ga0501259_001211_264_1280 336
229 3300049705 Ga0501225_0000009 Ga0501225_0000009_87936_88952 336
230 3300049705 Ga0501225_0001025 Ga0501225_0001025_6911_7927 336
231 3300049705 Ga0501225_0028816 Ga0501225_0028816_312_1328 336
232 3300049707 Ga0501234_000668 Ga0501234_000668_3747_4763 336
233 3300049708 Ga0501245_000341 Ga0501245_000341_4227_5243 336
234 3300049742 Ga0501080_0121459 Ga0501080_0121459_488_1498 336
235 3300049776 Ga0501280_000349 Ga0501280_000349_10005_11021 336
236 3300049777 Ga0501281_00245 Ga0501281_00245_154_1170 336
237 3300049778 Ga0501282_000011 Ga0501282_000011_3564_4580 336
238 3300049779 Ga0501283_000964 Ga0501283_000964_1467_2483 336
239 3300049853 Ga0501226_000044 Ga0501226_000044_27775_28791 336
240 3300053077 Ga0495601_0135951 Ga0495601_0135951_350_1360 336
241 3300053077 Ga0495601_0169685 Ga0495601_0169685_294_1304 336
242 3300053084 Ga0495595_0039533 Ga0495595_0039533_593_1603 336
243 3300053085 Ga0495619_0011158 Ga0495619_0011158_1791_2801 336
244 3300053093 Ga0500651_0054807 Ga0500651_0054807_747_1757 336
245 3300053178 Ga0500637_0004096 Ga0500637_0004096_1215_2327 336
246 3300060353 Ga0501082_0000015 Ga0501082_0000015_37396_38406 336
247 iso_pu_bacteria 2786546940 2788433583 336
248 3300005549 Ga0070704_100007299 Ga0070704_1000072995 337
249 3300006177 Ga0075362_10012821 Ga0075362_100128214 337
250 3300006353 Ga0075370_10057088 Ga0075370_100570883 337
251 3300024225 Ga0224572_1014533 Ga0224572_10145331 337
252 3300025299 Ga0209256_1037403 Ga0209256_10374032 337
253 3300046694 Ga0495649_0119885 Ga0495649_0119885_349_1365 337
254 3300048928 Ga0496125_0156923 Ga0496125_0156923_226_1242 337
255 3300049586 Ga0501070_0297664 Ga0501070_0297664_113_1126 337
256 3300049588 Ga0501072_0134337 Ga0501072_0134337_554_1570 337
257 3300049823 Ga0501044_0000174 Ga0501044_0000174_12448_13461 337
258 3300050496 nmdc:mga07m45_21428_c1 nmdc:mga07m45_21428_c1_232_1248 337
259 3300050516 nmdc:mga0sz30_1281_c1 nmdc:mga0sz30_1281_c1_3462_4478 337
260 3300053116 Ga0500592_000026 Ga0500592_000026_10409_11425 337
261 3300053158 Ga0500627_0000095 Ga0500627_0000095_8542_9558 337
262 3300002705 JGI25156J39149_1016126 JGI25156J39149_10161261 338
263 3300002741 JGI25157J39369_1001142 JGI25157J39369_10011425 338
264 3300002987 JGI25159J45721_1001078 JGI25159J45721_10010782 338
265 3300003354 JGI25160J50197_1000023 JGI25160J50197_1000023174 338
266 3300003374 JGI25161J50226_1000012 JGI25161J50226_1000012174 338
267 3300003762 Ga0055542_1000473 Ga0055542_100047323 338
268 3300003763 Ga0055529_1003586 Ga0055529_10035862 338
269 3300004625 Ga0055543_1000009 Ga0055543_1000009174 338
270 3300005262 Ga0065165_1000064 Ga0065165_100006423 338
271 3300009174 Ga0105241_10041731 Ga0105241_100417312 338
272 3300009553 Ga0105249_10249379 Ga0105249_102493792 338
273 3300010375 Ga0105239_10158009 Ga0105239_101580092 338
274 3300010375 Ga0105239_10490174 Ga0105239_104901742 338
275 3300025208 Ga0209436_106850 Ga0209436_1068502 338
276 3300025250 Ga0209026_1000041 Ga0209026_100004110 338
277 3300025254 Ga0209148_1000317 Ga0209148_100031746 338
278 3300025256 Ga0209759_1000168 Ga0209759_100016836 338
279 3300025272 Ga0209455_1000152 Ga0209455_100015253 338
280 3300025284 Ga0209130_1000048 Ga0209130_100004823 338
281 3300025297 Ga0209758_1011784 Ga0209758_10117845 338
282 3300025302 Ga0207426_1000136 Ga0207426_100013623 338
283 3300025904 Ga0207647_10006873 Ga0207647_100068736 338
284 3300025911 Ga0207654_10218397 Ga0207654_102183972 338
285 3300025916 Ga0207663_10186480 Ga0207663_101864801 338
286 3300032002 Ga0307416_100036824 Ga0307416_1000368242 338
287 3300032126 Ga0307415_100309757 Ga0307415_1003097571 338
288 3300041997 Ga0439431_0009805 Ga0439431_0009805_815_1951 338
289 3300046512 Ga0495610_0050695 Ga0495610_0050695_52_1071 338
290 3300046660 Ga0495625_0038037 Ga0495625_0038037_917_2023 338
291 3300048922 Ga0496119_0014278 Ga0496119_0014278_1605_2621 338
292 3300048923 Ga0496120_0063774 Ga0496120_0063774_535_1557 338
293 3300049571 Ga0501034_0247108 Ga0501034_0247108_269_1291 338
294 3300053155 Ga0500620_000201 Ga0500620_000201_1201_2217 338
295 3300053155 Ga0500620_029952 Ga0500620_029952_380_1396 338
296 3300053727 Ga0500611_004430 Ga0500611_004430_288_1304 338
297 iso_pu_bacteria 2889010040 2889015882 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

250

376

0.97

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

282

411

0.81

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

105

210

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vem-assembly1.cif.gz_B the nadph-assisted quinone oxidoreductase from phytophthora capsici 0.9566 2 336
7vem-assembly1.cif.gz_B the nadph-assisted quinone oxidoreductase from phytophthora capsici 0.9456 2 336
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9394 1 335
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9287 1 335
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9174 1 338
ID Description Score Start End Superfamily
af_Q54UL7_143_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9607 144 282 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9575 144 282 3.40.50.720
af_Q75JT6_127_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9544 147 279 3.40.50.720
af_O94564_145_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 143 282 3.40.50.720
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9495 148 282 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A291SNP8-F1-model_v4 deleted 0.981 35 336
AF-A0A2H3FDH2-F1-model_v4 deleted 0.979 2 324
AF-A0A532B1Y0-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9772 159 332
AF-A0A5C1YN49-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9766 2 335 GO:0016491
AF-A0A6J4XZI8-F1-model_v4 Alcohol dehydrogenase (EC) (EC 1.1.1.1) 0.9765 1 336 GO:0004022

Feature Viewer

pLDDT pTM Quality
95.36 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map