F393849

General Info

Members Datasets Scaffolds Average Seq Length
297 206 594 265

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_004008|Ga0495627_004008_3064_3984
Length 306
Sequence MSTVTQQATGPDTHSGTADLIARLRTQENRPALVGYLPVGYPTVDRSIEALKTLVDHGVDIIELGIPYTDPVLDGPVIQAAAQGALDAGARVRDVFRVVRELTDYAPHVPVLVMTYWNPVLKYGPDAFARDLAAAGGAGLITPDLIPDEGADWIEASEKHGLDRVFLVAPSSTPERLRLTAGQSRGFVYAASLMGVTGVRNQVGSRAEQLVADTRAAGAPNVCVGLGVSTGAQAAEVGRFADGVIVGSAMVRPLLSDGPLPDDEWAVRLTDLAEVTEDLAAGVRSARASAPADVPAGAKTTSGEAL

Samples

Sample ID Description Type Environment
1 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
68 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
81 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
87 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
88 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
91 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
92 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
170 2643221572 Leifsonia sp. Root60 Isolate Unclassified
171 2643221613 Oerskovia sp. Root22 Isolate Unclassified
172 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
173 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
174 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
175 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
176 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
177 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
178 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
179 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
180 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
181 2808606394 Promicromonospora sp. C35 Isolate Unclassified
182 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
183 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
184 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
185 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
186 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
187 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
188 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
189 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
190 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
191 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
192 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
193 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
194 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
195 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
196 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
197 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
198 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
199 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
200 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
201 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
202 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
203 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
204 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
205 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
206 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.54
Metatranscriptomes 0
Isolates 12.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.06
Nodule 0
Rhizoplane 4.04
Rhizosphere 79.8
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495627_004008 3300046453 Bacteria 6287
2 JGI25407J50210_10001336 3300003373 Bacteria 5554
3 Ga0070676_10090768 3300005328 Bacteria 1871
4 Ga0070683_100079744 3300005329 Bacteria 3063
5 Ga0070683_100529604 3300005329 Bacteria 1126
6 Ga0070680_100399164 3300005336 Bacteria 1172
7 Ga0070682_100249762 3300005337 Bacteria 1278
8 Ga0070668_100003517 3300005347 Bacteria 11551
9 Ga0070668_100059542 3300005347 Bacteria 2956
10 Ga0070709_10201358 3300005434 Bacteria 1410
11 Ga0070713_100063155 3300005436 Bacteria 3104
12 Ga0070708_100031917 3300005445 Bacteria 4563
13 Ga0070663_100004756 3300005455 Bacteria 8014
14 Ga0070706_100090496 3300005467 Bacteria 2837
15 Ga0070706_100688711 3300005467 Bacteria 948
16 Ga0068855_100060915 3300005563 Bacteria 4410
17 Ga0068856_100265230 3300005614 Bacteria 1733
18 Ga0068856_100513725 3300005614 Bacteria 1219
19 Ga0068858_100236354 3300005842 Bacteria 1733
20 Ga0068858_100756521 3300005842 Bacteria 947
21 Ga0068862_100159089 3300005844 Bacteria 2015
22 Ga0081455_10000660 3300005937 Bacteria 44685
23 Ga0081455_10001185 3300005937 Bacteria 32662
24 Ga0081455_10002913 3300005937 Bacteria 20091
25 Ga0081455_10011332 3300005937 Bacteria 8965
26 Ga0081538_10000131 3300005981 Bacteria 77253
27 Ga0081538_10001569 3300005981 Bacteria 23451
28 Ga0075365_10112432 3300006038 Bacteria 1873
29 Ga0075365_10334894 3300006038 Bacteria 1066
30 Ga0075364_10000981 3300006051 Bacteria 15078
31 Ga0075364_10039440 3300006051 Bacteria 3061
32 Ga0075364_10101056 3300006051 Bacteria 1920
33 Ga0075364_10310280 3300006051 Bacteria 1074
34 Ga0070712_100510059 3300006175 Bacteria 1009
35 Ga0075362_10037078 3300006177 Bacteria 2136
36 Ga0075362_10078345 3300006177 Bacteria 1520
37 Ga0075367_10105380 3300006178 Bacteria 1727
38 Ga0075428_100000247 3300006844 Bacteria 52987
39 Ga0075428_100119625 3300006844 Bacteria 2867
40 Ga0075428_100283679 3300006844 Bacteria 1782
41 Ga0075428_100383861 3300006844 Bacteria 1506
42 Ga0075430_100003020 3300006846 Bacteria 14082
43 Ga0075430_100568379 3300006846 Bacteria 935
44 Ga0075431_100009669 3300006847 Bacteria 9683
45 Ga0075429_100000279 3300006880 Bacteria 36024
46 Ga0105244_10001355 3300009036 Bacteria 19958
47 Ga0111539_10904934 3300009094 Bacteria 1026
48 Ga0105245_10293978 3300009098 Bacteria 1592
49 Ga0114129_10023965 3300009147 Bacteria 8648
50 Ga0114129_10162299 3300009147 Bacteria 3051
51 Ga0114129_11232555 3300009147 Bacteria 930
52 Ga0105239_10227460 3300010375 Bacteria 2093
53 Ga0105239_10688700 3300010375 Bacteria 1168
54 Ga0157371_10021696 3300013102 Bacteria 4712
55 Ga0157369_10445632 3300013105 Bacteria 1341
56 Ga0157375_11147014 3300013308 Bacteria 911
57 Ga0157380_10162066 3300014326 Bacteria 1945
58 Ga0157376_10980557 3300014969 Bacteria 867
59 Ga0209051_1016651 3300025303 Bacteria 3313
60 Ga0207699_10377583 3300025906 Bacteria 1005
61 Ga0207645_10078257 3300025907 Bacteria 2119
62 Ga0207684_10076216 3300025910 Bacteria 2850
63 Ga0207681_10309842 3300025923 Bacteria 1252
64 Ga0207700_10388422 3300025928 Bacteria 1221
65 Ga0207691_10718535 3300025940 Bacteria 842
66 Ga0207711_10643000 3300025941 Bacteria 990
67 Ga0207661_10055144 3300025944 Bacteria 3187
68 Ga0207668_10020025 3300025972 Bacteria 4243
69 Ga0207668_10166318 3300025972 Bacteria 1725
70 Ga0207640_10424733 3300025981 Bacteria 1089
71 Ga0207703_10211584 3300026035 Bacteria 1729
72 Ga0207703_10351611 3300026035 Bacteria 1357
73 Ga0207675_100114537 3300026118 Bacteria 2547
74 Ga0207683_10091802 3300026121 Bacteria 2705
75 Ga0207428_10034612 3300027907 Bacteria 4136
76 Ga0268266_10170211 3300028379 Bacteria 1977
77 Ga0268265_10197720 3300028380 Bacteria 1741
78 Ga0268265_10360423 3300028380 Bacteria 1331
79 Ga0307515_10019035 3300028794 Bacteria 12390
80 Ga0307515_10022719 3300028794 Bacteria 11041
81 Ga0316179_1050526 3300030734 Bacteria 1245
82 Ga0307509_10204029 3300031507 Bacteria 1810
83 Ga0316576_10014267 3300031727 Bacteria 5306
84 Ga0316576_10099154 3300031727 Bacteria 2176
85 Ga0316578_10045936 3300031728 Bacteria 2544
86 Ga0316577_10050743 3300031733 Bacteria 2316
87 Ga0307413_10111012 3300031824 Bacteria 1836
88 Ga0307406_10072254 3300031901 Bacteria 2264
89 Ga0307409_100416790 3300031995 Bacteria 1287
90 Ga0307415_100041221 3300032126 Bacteria 3064
91 Ga0316585_10024987 3300032137 Bacteria 1851
92 Ga0307507_10009833 3300033179 Bacteria 12600
93 Ga0373948_0004150 3300034817 Bacteria 2274
94 Ga0373928_0030838 3300035084 Bacteria 1187
95 Ga0373946_0017989 3300035171 Bacteria 2708
96 Ga0373931_0000001 3300035691 Bacteria 634029
97 Ga0373931_0000022 3300035691 Bacteria 137028
98 Ga0373927_0019640 3300035695 Bacteria 4430
99 Ga0373947_0056794 3300035725 Bacteria 2367
100 Ga0373947_0187387 3300035725 Bacteria 1349
101 Ga0316582_0040305 3300036647 Bacteria 2914
102 Ga0373925_0052699 3300037068 Bacteria 3040
103 Ga0395899_0031568 3300037312 Bacteria 3981
104 Ga0395900_0043798 3300037418 Bacteria 4613
105 Ga0395898_0121019 3300037466 Bacteria 2507
106 Ga0395905_0063898 3300037471 Bacteria 3444
107 Ga0395901_0279880 3300038443 Bacteria 1733
108 Ga0395901_0303265 3300038443 Bacteria 1656
109 Ga0400483_184101 3300039062 Bacteria 2275
110 Ga0439438_094261 3300041405 Bacteria 728
111 Ga0439466_0019963 3300041411 Bacteria 2394
112 Ga0451793_1929525 3300041452 Bacteria 1645
113 Ga0439448_0017224 3300042005 Bacteria 2205
114 Ga0439449_0001831 3300042007 Bacteria 8367
115 Ga0439449_0066529 3300042007 Bacteria 1329
116 Ga0439450_001165 3300042008 Bacteria 3761
117 Ga0439454_001966 3300042011 Bacteria 2081
118 Ga0439455_0009800 3300042012 Bacteria 2089
119 Ga0439457_001938 3300042014 Bacteria 6092
120 Ga0439463_049513 3300042016 Bacteria 1071
121 Ga0450907_026765 3300042146 Bacteria 977
122 Ga0439464_0009409 3300042439 Bacteria 2572
123 Ga0451577_0003286 3300042876 Bacteria 18182
124 Ga0466972_0163151 3300044658 Bacteria 1047
125 Ga0466965_0017625 3300044683 Bacteria 3416
126 Ga0466965_0035004 3300044683 Bacteria 2459
127 Ga0466961_0145918 3300044693 Bacteria 1480
128 Ga0453684_0105004 3300044712 Bacteria 3447
129 Ga0466957_0179649 3300044842 Bacteria 1382
130 Ga0451576_0632846 3300045051 Bacteria 1124
131 Ga0466967_0155732 3300045976 Bacteria 2140
132 Ga0466967_0359733 3300045976 Bacteria 1410
133 Ga0495603_0250424 3300046455 Bacteria 1020
134 Ga0495629_0383945 3300046459 Unclassified 956
135 Ga0495582_0096812 3300046473 Bacteria 1650
136 Ga0495639_0055444 3300046475 Bacteria 1808
137 Ga0495618_0145669 3300046514 Bacteria 1514
138 Ga0495630_0084841 3300046517 Bacteria 2391
139 Ga0495640_0076119 3300046533 Bacteria 2240
140 Ga0495586_0045235 3300046535 Bacteria 2372
141 Ga0495634_0019530 3300046642 Bacteria 4814
142 Ga0495657_0144006 3300046675 Bacteria 1484
143 Ga0495647_0184440 3300046681 Bacteria 909
144 Ga0495613_0000201 3300046689 Bacteria 58736
145 Ga0495613_0209865 3300046689 Bacteria 1370
146 Ga0495589_0135364 3300046794 Bacteria 1182
147 Ga0495581_0050548 3300047315 Bacteria 2401
148 Ga0495680_0326602 3300047322 Bacteria 1073
149 Ga0495683_0000307 3300047323 Bacteria 41369
150 Ga0495614_0036510 3300048089 Bacteria 2110
151 Ga0496100_0027352 3300048903 Bacteria 3507
152 Ga0496101_0030638 3300048904 Bacteria 3774
153 Ga0496101_0433317 3300048904 Bacteria 1037
154 Ga0496102_0407837 3300048905 Bacteria 1277
155 Ga0496104_0074875 3300048907 Bacteria 3223
156 Ga0496108_0282025 3300048911 Bacteria 1446
157 Ga0496109_0001713 3300048912 Bacteria 18287
158 Ga0496110_0113487 3300048913 Bacteria 2437
159 Ga0496113_0091272 3300048916 Bacteria 2348
160 Ga0496113_0243469 3300048916 Bacteria 1435
161 Ga0496114_0104681 3300048917 Bacteria 2420
162 Ga0496119_0021172 3300048922 Bacteria 4710
163 Ga0496125_0002066 3300048928 Bacteria 27109
164 Ga0496126_0038579 3300048929 Bacteria 4443
165 Ga0496126_0053475 3300048929 Bacteria 3664
166 Ga0501031_0025181 3300049568 Bacteria 3881
167 Ga0501031_0030920 3300049568 Bacteria 3493
168 Ga0501033_0008849 3300049570 Bacteria 7776
169 Ga0501033_0229014 3300049570 Bacteria 1321
170 Ga0501034_0030716 3300049571 Bacteria 5460
171 Ga0501034_0044898 3300049571 Bacteria 4467
172 Ga0501034_0098755 3300049571 Bacteria 2915
173 Ga0501036_0002026 3300049572 Bacteria 15768
174 Ga0501036_0016503 3300049572 Bacteria 6168
175 Ga0501036_0136782 3300049572 Bacteria 2068
176 Ga0501037_0006631 3300049573 Bacteria 8466
177 Ga0501037_0426688 3300049573 Bacteria 907
178 Ga0501038_0052865 3300049574 Bacteria 3500
179 Ga0501039_0025352 3300049575 Bacteria 4555
180 Ga0501039_0188358 3300049575 Bacteria 1623
181 Ga0501039_0235706 3300049575 Bacteria 1439
182 Ga0501040_0006249 3300049576 Bacteria 7730
183 Ga0501040_0012478 3300049576 Bacteria 5568
184 Ga0501040_0051786 3300049576 Bacteria 2808
185 Ga0501040_0186226 3300049576 Bacteria 1472
186 Ga0501041_0007281 3300049577 Bacteria 6498
187 Ga0501041_0030972 3300049577 Bacteria 3229
188 Ga0501042_0008231 3300049578 Bacteria 6872
189 Ga0501042_0021164 3300049578 Bacteria 4529
190 Ga0501042_0111459 3300049578 Bacteria 1970
191 Ga0501042_0212091 3300049578 Bacteria 1397
192 Ga0501043_0184011 3300049579 Bacteria 1627
193 Ga0501046_0028102 3300049580 Bacteria 4583
194 Ga0501047_0080482 3300049581 Bacteria 3131
195 Ga0501048_0070250 3300049582 Bacteria 2473
196 Ga0501048_0078825 3300049582 Bacteria 2325
197 Ga0501068_0137232 3300049584 Bacteria 1532
198 Ga0501068_0208715 3300049584 Bacteria 1240
199 Ga0501069_0340504 3300049585 Bacteria 883
200 Ga0501071_0020629 3300049587 Bacteria 4582
201 Ga0501071_0031099 3300049587 Bacteria 3781
202 Ga0501071_0112844 3300049587 Bacteria 2010
203 Ga0501072_0008102 3300049588 Bacteria 7974
204 Ga0501072_0025822 3300049588 Bacteria 4577
205 Ga0501074_0084703 3300049590 Bacteria 2272
206 Ga0501074_0145863 3300049590 Bacteria 1693
207 Ga0501075_0013166 3300049591 Bacteria 5897
208 Ga0501075_0023165 3300049591 Bacteria 4544
209 Ga0501075_0236987 3300049591 Bacteria 1391
210 Ga0501075_0376019 3300049591 Bacteria 1083
211 Ga0501075_0501007 3300049591 Bacteria 926
212 Ga0501076_0005751 3300049592 Bacteria 8934
213 Ga0501076_0014774 3300049592 Bacteria 5887
214 Ga0501076_0021934 3300049592 Bacteria 4904
215 Ga0501076_0022116 3300049592 Bacteria 4885
216 Ga0501077_0001328 3300049593 Bacteria 14940
217 Ga0501077_0034709 3300049593 Bacteria 3210
218 Ga0501077_0052646 3300049593 Bacteria 2585
219 Ga0501079_0005065 3300049741 Bacteria 9784
220 Ga0501079_0012252 3300049741 Bacteria 6544
221 Ga0501079_0053509 3300049741 Bacteria 3114
222 Ga0501079_0225037 3300049741 Bacteria 1466
223 Ga0501080_0264839 3300049742 Bacteria 1565
224 Ga0501081_0009641 3300049743 Bacteria 6294
225 Ga0501081_0276268 3300049743 Bacteria 1229
226 Ga0501081_0482636 3300049743 Bacteria 923
227 Ga0501045_0012122 3300049824 Bacteria 6066
228 Ga0501045_0032309 3300049824 Bacteria 3793
229 Ga0501045_0057770 3300049824 Bacteria 2839
230 Ga0501045_0105941 3300049824 Bacteria 2083
231 nmdc:mga03683_63700_c1 3300050489 Bacteria 1563
232 nmdc:mga00v17_17718_c1 3300050491 Bacteria 4037
233 nmdc:mga00v17_28711_c1 3300050491 Bacteria 3260
234 nmdc:mga0yw44_126695_c1 3300050492 Bacteria 1649
235 nmdc:mga0yw44_1558_c1 3300050492 Bacteria 9185
236 nmdc:mga0yw44_62253_c1 3300050492 Bacteria 2291
237 nmdc:mga05p37_222159_c1 3300050507 Bacteria 2279
238 nmdc:mga05p37_248211_c1 3300050507 Bacteria 2136
239 nmdc:mga09592_297187_c1 3300050508 Bacteria 1400
240 nmdc:mga09592_625_c1 3300050508 Bacteria 27036
241 nmdc:mga0qj67_14429_c1 3300050509 Bacteria 5973
242 nmdc:mga0qj67_23787_c1 3300050509 Bacteria 4717
243 nmdc:mga0qj67_451188_c1 3300050509 Bacteria 1036
244 nmdc:mga0qj67_64856_c1 3300050509 Bacteria 2907
245 nmdc:mga06r32_3487_c2 3300050510 Bacteria 4089
246 nmdc:mga08y16_22733_c1 3300050511 Bacteria 6620
247 Ga0495612_0058594 3300053078 Bacteria 1592
248 Ga0495612_0162633 3300053078 Bacteria 975
249 Ga0500652_001596 3300053131 Bacteria 6905
250 Ga0500568_0042188 3300053139 Bacteria 1829
251 Ga0501084_0009062 3300054114 Bacteria 8232
252 Ga0501084_0026950 3300054114 Bacteria 4801
253 Ga0501084_0195456 3300054114 Bacteria 1707
254 Ga0501084_0528258 3300054114 Bacteria 997
255 Ga0501082_0008088 3300060353 Bacteria 9076
256 Ga0501082_0462249 3300060353 Bacteria 1109
257 Ga0530510_0000388 3300061734 Bacteria 28562
258 Ga0530510_0019166 3300061734 Bacteria 4853
259 Ga0530510_0019574 3300061734 Bacteria 4805
260 Ga0530510_0020708 3300061734 Bacteria 4677
261 2643875121 2643221572 Bacteria 3614809
262 2644084309 2643221613 Bacteria 4622396
263 2738696011 2738541272 Bacteria 6848551
264 2739203773 2738543005 Bacteria 5278128
265 2739324833 2738543027 Bacteria 6409078
266 2739366793 2738543034 Bacteria 6084756
267 2739605631 2739367654 Bacteria 6049412
268 2753038676 2751185725 Bacteria 5740550
269 2753327188 2751185792 Bacteria 5739090
270 2760307533 2758568522 Bacteria 5953541
271 2760623947 2758568621 Bacteria 5967089
272 2809028862 2808606394 Bacteria 6248540
273 2812375101 2811994882 Bacteria 4688362
274 2819427858 2818991318 Bacteria 5266538
275 2819691860 2818991462 Bacteria 4320267
276 2819729363 2818991469 Bacteria 4644110
277 2835191681 2835188231 Bacteria 3476928
278 2839988832 2839986021 Bacteria 3685650
279 2861520970 2861520306 Bacteria 8348283
280 2904769276 2904765812 Bacteria 5369154
281 2904772832 2904770941 Bacteria 5580202
282 2908814362 2908811453 Bacteria 5478616
283 2919422803 2919420072 Bacteria 5390363
284 2919434944 2919432681 Bacteria 5390474
285 2928146552 2928142448 Bacteria 5288925
286 2932430588 2932426870 Bacteria 4547726
287 2932431746 2932431166 Bacteria 4215299
288 2946025802 2946024296 Bacteria 3508095
289 2956941268 2956939328 Bacteria 3474458
290 2974317846 2974315732 Bacteria 4602776
291 8004024413 8004021418 Bacteria 4313954
292 8004026046 8004025490 Bacteria 4327753
293 8046356465 8046352972 Bacteria 3613806
294 8047714765 8047710418 Bacteria 11023148
295 8056055112 8056054917 Bacteria 5736694
296 8056585102 8056579771 Bacteria 5840325
297 8057568633 8057568493 Bacteria 7221719
298 Ga0495627_004008
299 JGI25407J50210_10001336
300 Ga0070676_10090768
301 Ga0070683_100079744
302 Ga0070683_100529604
303 Ga0070680_100399164
304 Ga0070682_100249762
305 Ga0070668_100003517
306 Ga0070668_100059542
307 Ga0070709_10201358
308 Ga0070713_100063155
309 Ga0070708_100031917
310 Ga0070663_100004756
311 Ga0070706_100090496
312 Ga0070706_100688711
313 Ga0068855_100060915
314 Ga0068856_100265230
315 Ga0068856_100513725
316 Ga0068858_100236354
317 Ga0068858_100756521
318 Ga0068862_100159089
319 Ga0081455_10000660
320 Ga0081455_10001185
321 Ga0081455_10002913
322 Ga0081455_10011332
323 Ga0081538_10000131
324 Ga0081538_10001569
325 Ga0075365_10112432
326 Ga0075365_10334894
327 Ga0075364_10000981
328 Ga0075364_10039440
329 Ga0075364_10101056
330 Ga0075364_10310280
331 Ga0070712_100510059
332 Ga0075362_10037078
333 Ga0075362_10078345
334 Ga0075367_10105380
335 Ga0075428_100000247
336 Ga0075428_100119625
337 Ga0075428_100283679
338 Ga0075428_100383861
339 Ga0075430_100003020
340 Ga0075430_100568379
341 Ga0075431_100009669
342 Ga0075429_100000279
343 Ga0105244_10001355
344 Ga0111539_10904934
345 Ga0105245_10293978
346 Ga0114129_10023965
347 Ga0114129_10162299
348 Ga0114129_11232555
349 Ga0105239_10227460
350 Ga0105239_10688700
351 Ga0157371_10021696
352 Ga0157369_10445632
353 Ga0157375_11147014
354 Ga0157380_10162066
355 Ga0157376_10980557
356 Ga0209051_1016651
357 Ga0207699_10377583
358 Ga0207645_10078257
359 Ga0207684_10076216
360 Ga0207681_10309842
361 Ga0207700_10388422
362 Ga0207691_10718535
363 Ga0207711_10643000
364 Ga0207661_10055144
365 Ga0207668_10020025
366 Ga0207668_10166318
367 Ga0207640_10424733
368 Ga0207703_10211584
369 Ga0207703_10351611
370 Ga0207675_100114537
371 Ga0207683_10091802
372 Ga0207428_10034612
373 Ga0268266_10170211
374 Ga0268265_10197720
375 Ga0268265_10360423
376 Ga0307515_10019035
377 Ga0307515_10022719
378 Ga0316179_1050526
379 Ga0307509_10204029
380 Ga0316576_10014267
381 Ga0316576_10099154
382 Ga0316578_10045936
383 Ga0316577_10050743
384 Ga0307413_10111012
385 Ga0307406_10072254
386 Ga0307409_100416790
387 Ga0307415_100041221
388 Ga0316585_10024987
389 Ga0307507_10009833
390 Ga0373948_0004150
391 Ga0373928_0030838
392 Ga0373946_0017989
393 Ga0373931_0000001
394 Ga0373931_0000022
395 Ga0373927_0019640
396 Ga0373947_0056794
397 Ga0373947_0187387
398 Ga0316582_0040305
399 Ga0373925_0052699
400 Ga0395899_0031568
401 Ga0395900_0043798
402 Ga0395898_0121019
403 Ga0395905_0063898
404 Ga0395901_0279880
405 Ga0395901_0303265
406 Ga0400483_184101
407 Ga0439438_094261
408 Ga0439466_0019963
409 Ga0451793_1929525
410 Ga0439448_0017224
411 Ga0439449_0001831
412 Ga0439449_0066529
413 Ga0439450_001165
414 Ga0439454_001966
415 Ga0439455_0009800
416 Ga0439457_001938
417 Ga0439463_049513
418 Ga0450907_026765
419 Ga0439464_0009409
420 Ga0451577_0003286
421 Ga0466972_0163151
422 Ga0466965_0017625
423 Ga0466965_0035004
424 Ga0466961_0145918
425 Ga0453684_0105004
426 Ga0466957_0179649
427 Ga0451576_0632846
428 Ga0466967_0155732
429 Ga0466967_0359733
430 Ga0495603_0250424
431 Ga0495629_0383945
432 Ga0495582_0096812
433 Ga0495639_0055444
434 Ga0495618_0145669
435 Ga0495630_0084841
436 Ga0495640_0076119
437 Ga0495586_0045235
438 Ga0495634_0019530
439 Ga0495657_0144006
440 Ga0495647_0184440
441 Ga0495613_0000201
442 Ga0495613_0209865
443 Ga0495589_0135364
444 Ga0495581_0050548
445 Ga0495680_0326602
446 Ga0495683_0000307
447 Ga0495614_0036510
448 Ga0496100_0027352
449 Ga0496101_0030638
450 Ga0496101_0433317
451 Ga0496102_0407837
452 Ga0496104_0074875
453 Ga0496108_0282025
454 Ga0496109_0001713
455 Ga0496110_0113487
456 Ga0496113_0091272
457 Ga0496113_0243469
458 Ga0496114_0104681
459 Ga0496119_0021172
460 Ga0496125_0002066
461 Ga0496126_0038579
462 Ga0496126_0053475
463 Ga0501031_0025181
464 Ga0501031_0030920
465 Ga0501033_0008849
466 Ga0501033_0229014
467 Ga0501034_0030716
468 Ga0501034_0044898
469 Ga0501034_0098755
470 Ga0501036_0002026
471 Ga0501036_0016503
472 Ga0501036_0136782
473 Ga0501037_0006631
474 Ga0501037_0426688
475 Ga0501038_0052865
476 Ga0501039_0025352
477 Ga0501039_0188358
478 Ga0501039_0235706
479 Ga0501040_0006249
480 Ga0501040_0012478
481 Ga0501040_0051786
482 Ga0501040_0186226
483 Ga0501041_0007281
484 Ga0501041_0030972
485 Ga0501042_0008231
486 Ga0501042_0021164
487 Ga0501042_0111459
488 Ga0501042_0212091
489 Ga0501043_0184011
490 Ga0501046_0028102
491 Ga0501047_0080482
492 Ga0501048_0070250
493 Ga0501048_0078825
494 Ga0501068_0137232
495 Ga0501068_0208715
496 Ga0501069_0340504
497 Ga0501071_0020629
498 Ga0501071_0031099
499 Ga0501071_0112844
500 Ga0501072_0008102
501 Ga0501072_0025822
502 Ga0501074_0084703
503 Ga0501074_0145863
504 Ga0501075_0013166
505 Ga0501075_0023165
506 Ga0501075_0236987
507 Ga0501075_0376019
508 Ga0501075_0501007
509 Ga0501076_0005751
510 Ga0501076_0014774
511 Ga0501076_0021934
512 Ga0501076_0022116
513 Ga0501077_0001328
514 Ga0501077_0034709
515 Ga0501077_0052646
516 Ga0501079_0005065
517 Ga0501079_0012252
518 Ga0501079_0053509
519 Ga0501079_0225037
520 Ga0501080_0264839
521 Ga0501081_0009641
522 Ga0501081_0276268
523 Ga0501081_0482636
524 Ga0501045_0012122
525 Ga0501045_0032309
526 Ga0501045_0057770
527 Ga0501045_0105941
528 nmdc:mga03683_63700_c1
529 nmdc:mga00v17_17718_c1
530 nmdc:mga00v17_28711_c1
531 nmdc:mga0yw44_126695_c1
532 nmdc:mga0yw44_1558_c1
533 nmdc:mga0yw44_62253_c1
534 nmdc:mga05p37_222159_c1
535 nmdc:mga05p37_248211_c1
536 nmdc:mga09592_297187_c1
537 nmdc:mga09592_625_c1
538 nmdc:mga0qj67_14429_c1
539 nmdc:mga0qj67_23787_c1
540 nmdc:mga0qj67_451188_c1
541 nmdc:mga0qj67_64856_c1
542 nmdc:mga06r32_3487_c2
543 nmdc:mga08y16_22733_c1
544 Ga0495612_0058594
545 Ga0495612_0162633
546 Ga0500652_001596
547 Ga0500568_0042188
548 Ga0501084_0009062
549 Ga0501084_0026950
550 Ga0501084_0195456
551 Ga0501084_0528258
552 Ga0501082_0008088
553 Ga0501082_0462249
554 Ga0530510_0000388
555 Ga0530510_0019166
556 Ga0530510_0019574
557 Ga0530510_0020708
558 2643875121
559 2644084309
560 2738696011
561 2739203773
562 2739324833
563 2739366793
564 2739605631
565 2753038676
566 2753327188
567 2760307533
568 2760623947
569 2809028862
570 2812375101
571 2819427858
572 2819691860
573 2819729363
574 2835191681
575 2839988832
576 2861520970
577 2904769276
578 2904772832
579 2908814362
580 2919422803
581 2919434944
582 2928146552
583 2932430588
584 2932431746
585 2946025802
586 2956941268
587 2974317846
588 8004024413
589 8004026046
590 8046356465
591 8047714765
592 8056055112
593 8056585102
594 8057568633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00290

Trp_syntA

Tryptophan synthase alpha chain

22

283

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ocw-assembly1.cif.gz_A structure of mycobacterium tuberculosis tryptophan synthase in space group f222 0.9224 11 256
6e9p-assembly2.cif.gz_C crystal structure of tryptophan synthase from m. tuberculosis - open form with brd0059 bound 0.9088 11 256
5tch-assembly2.cif.gz_G crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form, trpa-g66v mutant 0.9083 11 256
6dwe-assembly1.cif.gz_A crystal structure of tryptophan synthase from m. tuberculosis - aminoacrylate- and brd0059-bound form 0.9062 15 256
2clk-assembly1.cif.gz_A tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p) 0.9054 11 256
ID Description Score Start End Superfamily
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9384 11 252 3.20.20.70
af_B4F800_73_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9138 11 255 3.20.20.70
af_Q2FYR3_1_242_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.905 23 257 3.20.20.70
6du1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9034 15 256 3.20.20.70
5ey5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9031 11 256 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3A4AVX3-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9651 10 258 GO:0004834
GO:0005829
GO:0006568
AF-A0A3C2AZU7-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9582 146 255 GO:0004834
GO:0005829
GO:0006568
AF-A0A0T6AIK0-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9556 11 256 GO:0004834
GO:0005829
GO:0006568
AF-A0A4Q6G664-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9523 11 257 GO:0004834
GO:0005829
GO:0006568
AF-A0A355DDL1-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.952 11 257 GO:0004834
GO:0005829
GO:0006568

Map