F393841

General Info

Members Datasets Scaffolds Average Seq Length
297 178 594 161

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1819529|Ga0451576_1819529_21_569
Length 182
Sequence MRATSRVCCEDYELNQGDRRMEIITVKIQKPEATNFILGQSHFIKTVEDIHEALVGTVPGIKFGLAFCEASGECLVRWTGTDEALIELAQTNAQEIGAGHSFILFLGEGYFPINILNVVKNVPEVARIFCATANPTEVLIAQTEQGRGILGVVDGFSPKGVEDEAGITWRKDFLRMIGYKIK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
75 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
76 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
83 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
169 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
170 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
171 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
172 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
173 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
174 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
175 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
176 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
177 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
178 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 1.01
Rhizoplane 6.4
Rhizosphere 86.2
Stem 0
Stem Tuber 0
Unclassified 18.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_1819529 3300045051 Eukaryota 629
2 JGI24735J21928_10000170 3300002067 Bacteria 23260
3 JGI25406J46586_10003885 3300003203 Bacteria 6983
4 Ga0065704_10000630 3300005289 Bacteria 17936
5 Ga0065707_10000939 3300005295 Bacteria 17037
6 Ga0065707_10056591 3300005295 Unclassified 659
7 Ga0065707_10105685 3300005295 Bacteria 2633
8 Ga0065707_10375608 3300005295 Bacteria 884
9 Ga0070658_10451197 3300005327 Bacteria 1108
10 Ga0070689_100732039 3300005340 Bacteria 866
11 Ga0070689_101999377 3300005340 Unclassified 530
12 Ga0070705_100318350 3300005440 Unclassified 1122
13 Ga0070705_100582368 3300005440 Bacteria 863
14 Ga0070700_100233114 3300005441 Unclassified 1311
15 Ga0070694_100073220 3300005444 Bacteria 2366
16 Ga0070706_100114085 3300005467 Unclassified 2516
17 Ga0070707_100169192 3300005468 Bacteria 2130
18 Ga0070698_100019583 3300005471 Bacteria 7100
19 Ga0070698_100484771 3300005471 Bacteria 1173
20 Ga0070698_100784644 3300005471 Unclassified 896
21 Ga0070699_100066924 3300005518 Unclassified 3120
22 Ga0070693_101361604 3300005547 Unclassified 550
23 Ga0070665_100688851 3300005548 Bacteria 1035
24 Ga0070704_100098230 3300005549 Bacteria 2199
25 Ga0070704_100530974 3300005549 Unclassified 1025
26 Ga0068859_100142109 3300005617 Unclassified 2474
27 Ga0068864_100119495 3300005618 Unclassified 2355
28 Ga0081539_10006101 3300005985 Bacteria 11764
29 Ga0081539_10188502 3300005985 Bacteria 962
30 Ga0075427_10001879 3300006194 Bacteria 2755
31 Ga0068871_101557602 3300006358 Bacteria 625
32 Ga0075428_100048794 3300006844 Bacteria 4646
33 Ga0075428_100170851 3300006844 Bacteria 2356
34 Ga0075428_101123629 3300006844 Unclassified 830
35 Ga0075430_100516778 3300006846 Bacteria 985
36 Ga0075431_100065850 3300006847 Bacteria 3740
37 Ga0075431_100200960 3300006847 Bacteria 2039
38 Ga0075433_10104960 3300006852 Bacteria 2504
39 Ga0075433_10429577 3300006852 Unclassified 1165
40 Ga0075434_100203938 3300006871 Unclassified 1998
41 Ga0075429_100004051 3300006880 Bacteria 12551
42 Ga0075429_100149232 3300006880 Bacteria 2047
43 Ga0075429_100206880 3300006880 Bacteria 1719
44 Ga0097620_100142106 3300006931 Unclassified 2474
45 Ga0105251_10000731 3300009011 Bacteria 30147
46 Ga0105240_12380192 3300009093 Bacteria 548
47 Ga0114129_10001947 3300009147 Bacteria 28281
48 Ga0114129_10047295 3300009147 Bacteria 6046
49 Ga0114129_10088361 3300009147 Bacteria 4296
50 Ga0114129_10682355 3300009147 Bacteria 1322
51 Ga0105241_10243044 3300009174 Bacteria 1523
52 Ga0105242_10031006 3300009176 Bacteria 4269
53 Ga0105248_10039901 3300009177 Bacteria 5263
54 Ga0105238_10587410 3300009551 Bacteria 1121
55 Ga0105246_10132794 3300011119 Bacteria 1862
56 Ga0105246_10572871 3300011119 Unclassified 971
57 Ga0157374_10457398 3300013296 Bacteria 1278
58 Ga0163162_10019457 3300013306 Bacteria 6659
59 Ga0157375_10267675 3300013308 Bacteria 1871
60 Ga0157377_10509586 3300014745 Bacteria 842
61 Ga0213872_10093196 3300021361 Unclassified 1347
62 Ga0213872_10267553 3300021361 Bacteria 716
63 Ga0207426_1002155 3300025302 Bacteria 13387
64 Ga0207713_1004992 3300025735 Bacteria 8464
65 Ga0207647_10022794 3300025904 Bacteria 4153
66 Ga0207705_10355610 3300025909 Bacteria 1129
67 Ga0207684_10188834 3300025910 Unclassified 1777
68 Ga0207654_10711418 3300025911 Bacteria 722
69 Ga0207695_10365865 3300025913 Bacteria 1328
70 Ga0207660_10678944 3300025917 Bacteria 840
71 Ga0207646_10121696 3300025922 Bacteria 2344
72 Ga0207646_10808523 3300025922 Bacteria 835
73 Ga0207681_10628510 3300025923 Bacteria 889
74 Ga0207694_10446256 3300025924 Bacteria 1080
75 Ga0207669_11379302 3300025937 Bacteria 600
76 Ga0207711_10211662 3300025941 Bacteria 1771
77 Ga0207658_10264137 3300025986 Bacteria 1468
78 Ga0207708_10928647 3300026075 Bacteria 754
79 Ga0207676_10163205 3300026095 Unclassified 1933
80 Ga0207674_10289438 3300026116 Bacteria 1587
81 Ga0207675_101942948 3300026118 Unclassified 606
82 Ga0268265_12343881 3300028380 Unclassified 540
83 Ga0268264_12017217 3300028381 Unclassified 586
84 Ga0265323_10001736 3300028653 Bacteria 10343
85 Ga0265323_10107819 3300028653 Unclassified 916
86 Ga0265338_10003623 3300028800 Bacteria 21531
87 Ga0265332_10034605 3300031238 Bacteria 2195
88 Ga0316579_10028942 3300031691 Bacteria 2525
89 Ga0316576_10124044 3300031727 Unclassified 1941
90 Ga0316576_10163323 3300031727 Unclassified 1680
91 Ga0316578_10023403 3300031728 Bacteria 3457
92 Ga0316577_10001152 3300031733 Bacteria 12097
93 Ga0316577_10075162 3300031733 Unclassified 1886
94 Ga0316577_10096841 3300031733 Bacteria 1653
95 Ga0316577_10174377 3300031733 Bacteria 1214
96 Ga0316577_10231842 3300031733 Bacteria 1044
97 Ga0316577_10391252 3300031733 Unclassified 790
98 Ga0316577_10427329 3300031733 Unclassified 753
99 Ga0307406_10487565 3300031901 Bacteria 997
100 Ga0307409_101826143 3300031995 Bacteria 637
101 Ga0307416_100184866 3300032002 Unclassified 1958
102 Ga0307415_101247896 3300032126 Bacteria 702
103 Ga0316585_10178480 3300032137 Unclassified 702
104 Ga0316585_10207927 3300032137 Unclassified 647
105 Ga0373928_0074700 3300035084 Unclassified 845
106 Ga0373941_0429184 3300035115 Unclassified 551
107 Ga0316574_0117095 3300035398 Unclassified 1709
108 Ga0316582_0003147 3300036647 Bacteria 8006
109 Ga0316582_0065010 3300036647 Bacteria 2348
110 Ga0316582_0249180 3300036647 Unclassified 1217
111 Ga0316582_0574437 3300036647 Unclassified 776
112 Ga0316584_0018598 3300036712 Bacteria 5014
113 Ga0316584_0042236 3300036712 Unclassified 3400
114 Ga0316584_0066231 3300036712 Bacteria 2707
115 Ga0316584_0067707 3300036712 Bacteria 2676
116 Ga0316584_0078602 3300036712 Bacteria 2471
117 Ga0316584_0136570 3300036712 Unclassified 1830
118 Ga0316584_0179451 3300036712 Bacteria 1568
119 Ga0316584_0386404 3300036712 Unclassified 999
120 Ga0316584_0391710 3300036712 Bacteria 991
121 Ga0316584_0877630 3300036712 Unclassified 605
122 Ga0395900_0067938 3300037418 Bacteria 3662
123 Ga0395905_0004153 3300037471 Bacteria 15148
124 Ga0316581_0003374 3300037588 Unclassified 3971
125 Ga0400489_08769 3300039093 Bacteria 5291
126 Ga0436361_0055861 3300039447 Bacteria 2787
127 Ga0436361_0212210 3300039447 Unclassified 865
128 Ga0436361_0334996 3300039447 Bacteria 5199
129 Ga0436361_0934266 3300039447 Unclassified 976
130 Ga0436361_1015032 3300039447 Bacteria 4482
131 Ga0451577_0026330 3300042876 Bacteria 5268
132 Ga0451577_0034669 3300042876 Bacteria 4548
133 Ga0451577_0035593 3300042876 Bacteria 4485
134 Ga0451577_0193994 3300042876 Bacteria 1832
135 Ga0451577_0212700 3300042876 Bacteria 1747
136 Ga0451577_1329201 3300042876 Unclassified 639
137 Ga0453683_0247305 3300044673 Unclassified 1136
138 Ga0453683_0372854 3300044673 Bacteria 918
139 Ga0453684_0000430 3300044712 Bacteria 171415
140 Ga0453684_0000599 3300044712 Bacteria 133150
141 Ga0453684_0000973 3300044712 Bacteria 94244
142 Ga0453684_0001353 3300044712 Bacteria 71575
143 Ga0453684_0012067 3300044712 Bacteria 14350
144 Ga0453684_0013090 3300044712 Bacteria 13543
145 Ga0453684_0034556 3300044712 Bacteria 7013
146 Ga0453684_0077575 3300044712 Bacteria 4162
147 Ga0453684_0089085 3300044712 Bacteria 3818
148 Ga0453684_0098304 3300044712 Unclassified 3589
149 Ga0453684_0385765 3300044712 Unclassified 1572
150 Ga0453684_0541138 3300044712 Bacteria 1284
151 Ga0453684_0545268 3300044712 Bacteria 1278
152 Ga0453684_0585763 3300044712 Bacteria 1224
153 Ga0453684_0614812 3300044712 Bacteria 1189
154 Ga0453684_0744164 3300044712 Unclassified 1062
155 Ga0453684_0774833 3300044712 Bacteria 1036
156 Ga0453684_0957001 3300044712 Unclassified 913
157 Ga0453684_1030989 3300044712 Bacteria 873
158 Ga0453684_1038727 3300044712 Bacteria 869
159 Ga0453684_1040264 3300044712 Unclassified 868
160 Ga0453684_1099234 3300044712 Bacteria 840
161 Ga0453684_1110675 3300044712 Unclassified 835
162 Ga0451576_0004396 3300045051 Bacteria 18345
163 Ga0451576_0008584 3300045051 Bacteria 11973
164 Ga0451576_0048525 3300045051 Bacteria 4459
165 Ga0451576_1191306 3300045051 Bacteria 796
166 Ga0451576_1373358 3300045051 Bacteria 735
167 Ga0495603_0155944 3300046455 Bacteria 1325
168 Ga0495590_0003225 3300046457 Bacteria 6668
169 Ga0495629_0018515 3300046459 Bacteria 4982
170 Ga0495629_0520731 3300046459 Bacteria 800
171 Ga0495638_0002129 3300046460 Bacteria 16653
172 Ga0495653_0016101 3300046463 Bacteria 6092
173 Ga0495653_0058481 3300046463 Bacteria 2930
174 Ga0495653_0090990 3300046463 Bacteria 2231
175 Ga0495650_0053064 3300046471 Bacteria 1662
176 Ga0495580_0003382 3300046472 Bacteria 13631
177 Ga0495580_0219798 3300046472 Bacteria 1306
178 Ga0495605_0023841 3300046474 Bacteria 3211
179 Ga0495664_0008370 3300046477 Bacteria 5769
180 Ga0495664_0043750 3300046477 Bacteria 2654
181 Ga0495664_0114198 3300046477 Bacteria 1631
182 Ga0495584_0026589 3300046491 Bacteria 2932
183 Ga0495585_0109400 3300046492 Bacteria 1471
184 Ga0495616_0273657 3300046513 Bacteria 719
185 Ga0495628_0012508 3300046516 Bacteria 7153
186 Ga0495628_0077626 3300046516 Bacteria 2583
187 Ga0495630_0055285 3300046517 Bacteria 2975
188 Ga0495642_0024079 3300046528 Bacteria 2407
189 Ga0495652_0367346 3300046529 Bacteria 1026
190 Ga0495665_0000297 3300046531 Bacteria 25024
191 Ga0495645_0104577 3300046543 Bacteria 2010
192 Ga0495625_0147542 3300046660 Bacteria 1583
193 Ga0495635_0123410 3300046663 Bacteria 1766
194 Ga0495588_0081352 3300046674 Bacteria 1691
195 Ga0495599_0197839 3300046678 Bacteria 1235
196 Ga0495623_0032224 3300046679 Bacteria 3369
197 Ga0495646_0046465 3300046680 Bacteria 2647
198 Ga0495646_0127885 3300046680 Bacteria 1432
199 Ga0495646_0155741 3300046680 Bacteria 1268
200 Ga0495669_0017094 3300046684 Bacteria 3109
201 Ga0495624_0058184 3300046690 Bacteria 2429
202 Ga0495624_0211230 3300046690 Bacteria 1177
203 Ga0495670_0013212 3300046691 Bacteria 4061
204 Ga0495589_0025672 3300046794 Bacteria 2989
205 Ga0495600_0336372 3300046809 Bacteria 947
206 Ga0495660_0131375 3300046810 Bacteria 1256
207 Ga0495604_0068997 3300047317 Bacteria 2681
208 Ga0495674_0026327 3300047319 Bacteria 5322
209 Ga0495674_0204747 3300047319 Bacteria 1636
210 Ga0495672_0244055 3300047320 Bacteria 875
211 Ga0495680_0050646 3300047322 Bacteria 3246
212 Ga0495683_0010011 3300047323 Bacteria 5029
213 Ga0495687_072388 3300047443 Bacteria 1377
214 Ga0495675_0057758 3300047444 Bacteria 2460
215 Ga0495675_0185159 3300047444 Bacteria 1273
216 Ga0495675_0404037 3300047444 Bacteria 796
217 Ga0495673_0110275 3300047469 Bacteria 1101
218 Ga0495593_0022377 3300047673 Bacteria 3522
219 Ga0495593_0162771 3300047673 Bacteria 1126
220 Ga0495593_0378804 3300047673 Bacteria 707
221 Ga0495602_0483325 3300048088 Bacteria 868
222 Ga0496100_0041591 3300048903 Bacteria 2930
223 Ga0496100_0059059 3300048903 Bacteria 2519
224 Ga0496101_0001286 3300048904 Bacteria 15007
225 Ga0496102_0071253 3300048905 Bacteria 3191
226 Ga0496102_0101289 3300048905 Bacteria 2675
227 Ga0496102_0456799 3300048905 Bacteria 1198
228 Ga0496103_0007330 3300048906 Bacteria 6574
229 Ga0496103_0439799 3300048906 Bacteria 837
230 Ga0496104_0071353 3300048907 Bacteria 3302
231 Ga0496105_0022126 3300048908 Bacteria 5150
232 Ga0496107_0003822 3300048910 Bacteria 10116
233 Ga0496109_0046656 3300048912 Bacteria 3936
234 Ga0496109_1026725 3300048912 Bacteria 762
235 Ga0496110_0007776 3300048913 Bacteria 8588
236 Ga0496111_0015172 3300048914 Bacteria 5281
237 Ga0496112_0032825 3300048915 Bacteria 5040
238 Ga0496113_0001200 3300048916 Bacteria 14198
239 Ga0496115_0397746 3300048918 Bacteria 1118
240 Ga0496115_0437067 3300048918 Bacteria 1058
241 Ga0496117_0014445 3300048920 Bacteria 6802
242 Ga0496119_0017656 3300048922 Bacteria 5357
243 Ga0496119_0037094 3300048922 Bacteria 3171
244 Ga0496121_0011028 3300048924 Bacteria 10086
245 Ga0496121_0121247 3300048924 Bacteria 1975
246 Ga0496122_0004713 3300048925 Bacteria 16745
247 Ga0496124_0012487 3300048927 Bacteria 8381
248 Ga0496125_0007643 3300048928 Bacteria 11460
249 Ga0496126_0000272 3300048929 Bacteria 110072
250 Ga0496126_0819387 3300048929 Bacteria 712
251 Ga0501295_035854 3300049518 Bacteria 1005
252 Ga0501036_1058523 3300049572 Bacteria 663
253 Ga0501039_0635272 3300049575 Bacteria 836
254 Ga0501041_0092372 3300049577 Bacteria 1869
255 Ga0501041_0290751 3300049577 Bacteria 1029
256 Ga0501046_0354209 3300049580 Bacteria 1065
257 Ga0501072_0084485 3300049588 Bacteria 2517
258 Ga0501074_0112710 3300049590 Bacteria 1946
259 Ga0501075_0268347 3300049591 Bacteria 1301
260 Ga0501076_0488255 3300049592 Bacteria 1015
261 Ga0501076_0501761 3300049592 Bacteria 1000
262 Ga0501079_0194302 3300049741 Bacteria 1584
263 Ga0501079_0847762 3300049741 Bacteria 720
264 Ga0501080_0166045 3300049742 Bacteria 2037
265 Ga0501081_1331965 3300049743 Unclassified 545
266 Ga0501045_0479068 3300049824 Bacteria 925
267 nmdc:mga05p37_127303_c1 3300050507 Unclassified 3127
268 nmdc:mga05p37_163_c1 3300050507 Bacteria 64430
269 nmdc:mga05p37_18132_c1 3300050507 Bacteria 8505
270 nmdc:mga05p37_18731_c1 3300050507 Bacteria 8366
271 nmdc:mga05p37_234487_c1 3300050507 Bacteria 2210
272 nmdc:mga05p37_950412_c1 3300050507 Bacteria 920
273 nmdc:mga09592_3821_c1 3300050508 Bacteria 12132
274 nmdc:mga09592_42797_c1 3300050508 Bacteria 3810
275 nmdc:mga09592_478936_c1 3300050508 Bacteria 1073
276 nmdc:mga0qj67_331141_c1 3300050509 Bacteria 1232
277 nmdc:mga0qj67_44663_c1 3300050509 Unclassified 3493
278 nmdc:mga06r32_180497_c1 3300050510 Bacteria 2096
279 nmdc:mga06r32_277521_c1 3300050510 Bacteria 1663
280 nmdc:mga06r32_602318_c1 3300050510 Bacteria 1070
281 nmdc:mga0a205_379564_c1 3300050515 Bacteria 1279
282 nmdc:mga0a205_413624_c1 3300050515 Unclassified 1211
283 nmdc:mga0a205_993001_c1 3300050515 Unclassified 686
284 Ga0500622_0003418 3300053156 Bacteria 10655
285 Ga0501084_0041989 3300054114 Bacteria 3825
286 Ga0501084_0178113 3300054114 Bacteria 1794
287 2501075517 2501025501 Bacteria 7768574
288 2501077303 2501025502 Bacteria 9641094
289 2501409819 2501025504 Bacteria 8008976
290 2511087172 2510917013 Bacteria 9951648
291 2511097268 2510917014 Bacteria 8296963
292 2511103946 2510917015 Bacteria 7950052
293 2513557517 2513237082 Bacteria 8640282
294 2513564384 2513237083 Bacteria 8410967
295 2516023989 2515154189 Bacteria 9629850
296 2883093209 2883087390 Bacteria 9532701
297 8003955738 8003955200 Bacteria 8601927
298 Ga0451576_1819529
299 JGI24735J21928_10000170
300 JGI25406J46586_10003885
301 Ga0065704_10000630
302 Ga0065707_10000939
303 Ga0065707_10056591
304 Ga0065707_10105685
305 Ga0065707_10375608
306 Ga0070658_10451197
307 Ga0070689_100732039
308 Ga0070689_101999377
309 Ga0070705_100318350
310 Ga0070705_100582368
311 Ga0070700_100233114
312 Ga0070694_100073220
313 Ga0070706_100114085
314 Ga0070707_100169192
315 Ga0070698_100019583
316 Ga0070698_100484771
317 Ga0070698_100784644
318 Ga0070699_100066924
319 Ga0070693_101361604
320 Ga0070665_100688851
321 Ga0070704_100098230
322 Ga0070704_100530974
323 Ga0068859_100142109
324 Ga0068864_100119495
325 Ga0081539_10006101
326 Ga0081539_10188502
327 Ga0075427_10001879
328 Ga0068871_101557602
329 Ga0075428_100048794
330 Ga0075428_100170851
331 Ga0075428_101123629
332 Ga0075430_100516778
333 Ga0075431_100065850
334 Ga0075431_100200960
335 Ga0075433_10104960
336 Ga0075433_10429577
337 Ga0075434_100203938
338 Ga0075429_100004051
339 Ga0075429_100149232
340 Ga0075429_100206880
341 Ga0097620_100142106
342 Ga0105251_10000731
343 Ga0105240_12380192
344 Ga0114129_10001947
345 Ga0114129_10047295
346 Ga0114129_10088361
347 Ga0114129_10682355
348 Ga0105241_10243044
349 Ga0105242_10031006
350 Ga0105248_10039901
351 Ga0105238_10587410
352 Ga0105246_10132794
353 Ga0105246_10572871
354 Ga0157374_10457398
355 Ga0163162_10019457
356 Ga0157375_10267675
357 Ga0157377_10509586
358 Ga0213872_10093196
359 Ga0213872_10267553
360 Ga0207426_1002155
361 Ga0207713_1004992
362 Ga0207647_10022794
363 Ga0207705_10355610
364 Ga0207684_10188834
365 Ga0207654_10711418
366 Ga0207695_10365865
367 Ga0207660_10678944
368 Ga0207646_10121696
369 Ga0207646_10808523
370 Ga0207681_10628510
371 Ga0207694_10446256
372 Ga0207669_11379302
373 Ga0207711_10211662
374 Ga0207658_10264137
375 Ga0207708_10928647
376 Ga0207676_10163205
377 Ga0207674_10289438
378 Ga0207675_101942948
379 Ga0268265_12343881
380 Ga0268264_12017217
381 Ga0265323_10001736
382 Ga0265323_10107819
383 Ga0265338_10003623
384 Ga0265332_10034605
385 Ga0316579_10028942
386 Ga0316576_10124044
387 Ga0316576_10163323
388 Ga0316578_10023403
389 Ga0316577_10001152
390 Ga0316577_10075162
391 Ga0316577_10096841
392 Ga0316577_10174377
393 Ga0316577_10231842
394 Ga0316577_10391252
395 Ga0316577_10427329
396 Ga0307406_10487565
397 Ga0307409_101826143
398 Ga0307416_100184866
399 Ga0307415_101247896
400 Ga0316585_10178480
401 Ga0316585_10207927
402 Ga0373928_0074700
403 Ga0373941_0429184
404 Ga0316574_0117095
405 Ga0316582_0003147
406 Ga0316582_0065010
407 Ga0316582_0249180
408 Ga0316582_0574437
409 Ga0316584_0018598
410 Ga0316584_0042236
411 Ga0316584_0066231
412 Ga0316584_0067707
413 Ga0316584_0078602
414 Ga0316584_0136570
415 Ga0316584_0179451
416 Ga0316584_0386404
417 Ga0316584_0391710
418 Ga0316584_0877630
419 Ga0395900_0067938
420 Ga0395905_0004153
421 Ga0316581_0003374
422 Ga0400489_08769
423 Ga0436361_0055861
424 Ga0436361_0212210
425 Ga0436361_0334996
426 Ga0436361_0934266
427 Ga0436361_1015032
428 Ga0451577_0026330
429 Ga0451577_0034669
430 Ga0451577_0035593
431 Ga0451577_0193994
432 Ga0451577_0212700
433 Ga0451577_1329201
434 Ga0453683_0247305
435 Ga0453683_0372854
436 Ga0453684_0000430
437 Ga0453684_0000599
438 Ga0453684_0000973
439 Ga0453684_0001353
440 Ga0453684_0012067
441 Ga0453684_0013090
442 Ga0453684_0034556
443 Ga0453684_0077575
444 Ga0453684_0089085
445 Ga0453684_0098304
446 Ga0453684_0385765
447 Ga0453684_0541138
448 Ga0453684_0545268
449 Ga0453684_0585763
450 Ga0453684_0614812
451 Ga0453684_0744164
452 Ga0453684_0774833
453 Ga0453684_0957001
454 Ga0453684_1030989
455 Ga0453684_1038727
456 Ga0453684_1040264
457 Ga0453684_1099234
458 Ga0453684_1110675
459 Ga0451576_0004396
460 Ga0451576_0008584
461 Ga0451576_0048525
462 Ga0451576_1191306
463 Ga0451576_1373358
464 Ga0495603_0155944
465 Ga0495590_0003225
466 Ga0495629_0018515
467 Ga0495629_0520731
468 Ga0495638_0002129
469 Ga0495653_0016101
470 Ga0495653_0058481
471 Ga0495653_0090990
472 Ga0495650_0053064
473 Ga0495580_0003382
474 Ga0495580_0219798
475 Ga0495605_0023841
476 Ga0495664_0008370
477 Ga0495664_0043750
478 Ga0495664_0114198
479 Ga0495584_0026589
480 Ga0495585_0109400
481 Ga0495616_0273657
482 Ga0495628_0012508
483 Ga0495628_0077626
484 Ga0495630_0055285
485 Ga0495642_0024079
486 Ga0495652_0367346
487 Ga0495665_0000297
488 Ga0495645_0104577
489 Ga0495625_0147542
490 Ga0495635_0123410
491 Ga0495588_0081352
492 Ga0495599_0197839
493 Ga0495623_0032224
494 Ga0495646_0046465
495 Ga0495646_0127885
496 Ga0495646_0155741
497 Ga0495669_0017094
498 Ga0495624_0058184
499 Ga0495624_0211230
500 Ga0495670_0013212
501 Ga0495589_0025672
502 Ga0495600_0336372
503 Ga0495660_0131375
504 Ga0495604_0068997
505 Ga0495674_0026327
506 Ga0495674_0204747
507 Ga0495672_0244055
508 Ga0495680_0050646
509 Ga0495683_0010011
510 Ga0495687_072388
511 Ga0495675_0057758
512 Ga0495675_0185159
513 Ga0495675_0404037
514 Ga0495673_0110275
515 Ga0495593_0022377
516 Ga0495593_0162771
517 Ga0495593_0378804
518 Ga0495602_0483325
519 Ga0496100_0041591
520 Ga0496100_0059059
521 Ga0496101_0001286
522 Ga0496102_0071253
523 Ga0496102_0101289
524 Ga0496102_0456799
525 Ga0496103_0007330
526 Ga0496103_0439799
527 Ga0496104_0071353
528 Ga0496105_0022126
529 Ga0496107_0003822
530 Ga0496109_0046656
531 Ga0496109_1026725
532 Ga0496110_0007776
533 Ga0496111_0015172
534 Ga0496112_0032825
535 Ga0496113_0001200
536 Ga0496115_0397746
537 Ga0496115_0437067
538 Ga0496117_0014445
539 Ga0496119_0017656
540 Ga0496119_0037094
541 Ga0496121_0011028
542 Ga0496121_0121247
543 Ga0496122_0004713
544 Ga0496124_0012487
545 Ga0496125_0007643
546 Ga0496126_0000272
547 Ga0496126_0819387
548 Ga0501295_035854
549 Ga0501036_1058523
550 Ga0501039_0635272
551 Ga0501041_0092372
552 Ga0501041_0290751
553 Ga0501046_0354209
554 Ga0501072_0084485
555 Ga0501074_0112710
556 Ga0501075_0268347
557 Ga0501076_0488255
558 Ga0501076_0501761
559 Ga0501079_0194302
560 Ga0501079_0847762
561 Ga0501080_0166045
562 Ga0501081_1331965
563 Ga0501045_0479068
564 nmdc:mga05p37_127303_c1
565 nmdc:mga05p37_163_c1
566 nmdc:mga05p37_18132_c1
567 nmdc:mga05p37_18731_c1
568 nmdc:mga05p37_234487_c1
569 nmdc:mga05p37_950412_c1
570 nmdc:mga09592_3821_c1
571 nmdc:mga09592_42797_c1
572 nmdc:mga09592_478936_c1
573 nmdc:mga0qj67_331141_c1
574 nmdc:mga0qj67_44663_c1
575 nmdc:mga06r32_180497_c1
576 nmdc:mga06r32_277521_c1
577 nmdc:mga06r32_602318_c1
578 nmdc:mga0a205_379564_c1
579 nmdc:mga0a205_413624_c1
580 nmdc:mga0a205_993001_c1
581 Ga0500622_0003418
582 Ga0501084_0041989
583 Ga0501084_0178113
584 2501075517
585 2501077303
586 2501409819
587 2511087172
588 2511097268
589 2511103946
590 2513557517
591 2513564384
592 2516023989
593 2883093209
594 8003955738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04008

Adenosine_kin

Adenosine specific kinase

26

180

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vgg-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein ttha1091 from thermus thermophilus hb8 0.9717 1 161
2ekm-assembly1.cif.gz_C structure of st1219 protein from sulfolobus tokodaii 0.9573 1 161
2ekm-assembly1.cif.gz_C structure of st1219 protein from sulfolobus tokodaii 0.9515 1 161
2jb7-assembly1.cif.gz_A pae2307 with amp 0.9492 2 161
2d16-assembly1.cif.gz_A crystal structure of ph1918 protein from pyrococcus horikoshii ot3 0.9437 2 161
ID Description Score Start End Superfamily
2gl0B00 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1634;Ta1353-like 0.9438 2 159 3.40.1520.10
2gl0B00 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1634;Ta1353-like 0.9212 2 159 3.40.1520.10
1rlhA02 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1634;Ta1353-like 0.8659 14 114 3.40.1520.10
1rlhA02 Alpha Beta;3-Layer(aba) Sandwich;hypothetical protein tt1634;Ta1353-like 0.8504 14 114 3.40.1520.10
4hzbE00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6753 114 138 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A660Y6Q6-F1-model_v4 Adenosine monophosphate-protein transferase 0.9954 1 109
AF-A0A7V0M1J8-F1-model_v4 Adenosine monophosphate-protein transferase 0.9953 1 95
AF-A0A0D2E013-F1-model_v4 DNA-directed RNA polymerase 0.9896 1 155 GO:0006351
GO:0055029
AF-A0A7V4E675-F1-model_v4 Adenosine monophosphate-protein transferase 0.9882 1 143 GO:0016740
AF-A0A660Y6Q6-F1-model_v4 Adenosine monophosphate-protein transferase 0.9863 1 109

Map