F393712
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 297 | 156 | 297 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10403922|Ga0157380_104039222 |
| Length | 145 |
| Sequence | MRIKHEKAMLDFGRKLADALRPGDVVTLSGPLSAGKTTMVRGVLSGLGHRGDVPSPSFAIVQPYEDLNPPVWHVDLYRIDDPSDLEELGLDDVGAEGVMLVEWPEHAGRRVWPRALALSLEVLDDGARALTAEVPAAWEGRWPLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 111 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 130 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 131 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 132 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 133 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 134 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 135 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 136 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 137 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 138 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.37 |
| Rhizosphere | 96.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4198986 | 2162886012 | Unclassified | 1205 |
| 2 | JGI24739J22299_10201205 | 3300001989 | Bacteria | 584 |
| 3 | JGI24737J22298_10018178 | 3300001990 | Bacteria | 2257 |
| 4 | JGI24748J21848_1014016 | 3300002074 | Bacteria | 951 |
| 5 | JGI24738J21930_10055740 | 3300002075 | Bacteria | 808 |
| 6 | JGI24034J26672_10007446 | 3300002239 | Bacteria | 1589 |
| 7 | Ga0065712_10092230 | 3300005290 | Bacteria | 2319 |
| 8 | Ga0065712_10156391 | 3300005290 | Bacteria | 1332 |
| 9 | Ga0065715_10095287 | 3300005293 | Bacteria | 4120 |
| 10 | Ga0070658_10001337 | 3300005327 | Bacteria | 21022 |
| 11 | Ga0070658_10040529 | 3300005327 | Bacteria | 3757 |
| 12 | Ga0070658_10060590 | 3300005327 | Bacteria | 3082 |
| 13 | Ga0070658_10070482 | 3300005327 | Bacteria | 2862 |
| 14 | Ga0070658_10109119 | 3300005327 | Bacteria | 2291 |
| 15 | Ga0070658_10355601 | 3300005327 | Bacteria | 1254 |
| 16 | Ga0070676_10031920 | 3300005328 | Bacteria | 3014 |
| 17 | Ga0070676_10181991 | 3300005328 | Bacteria | 1367 |
| 18 | Ga0070683_100788433 | 3300005329 | Bacteria | 911 |
| 19 | Ga0070670_100003505 | 3300005331 | Bacteria | 13041 |
| 20 | Ga0070670_100009058 | 3300005331 | Bacteria | 8503 |
| 21 | Ga0070677_10024315 | 3300005333 | Bacteria | 2251 |
| 22 | Ga0070677_10064312 | 3300005333 | Bacteria | 1523 |
| 23 | Ga0070677_10074495 | 3300005333 | Bacteria | 1436 |
| 24 | Ga0070666_10001385 | 3300005335 | Bacteria | 14676 |
| 25 | Ga0070666_10032812 | 3300005335 | Bacteria | 3432 |
| 26 | Ga0070680_100078128 | 3300005336 | Bacteria | 2726 |
| 27 | Ga0070680_100441782 | 3300005336 | Bacteria | 1111 |
| 28 | Ga0070682_100823534 | 3300005337 | Bacteria | 756 |
| 29 | Ga0068868_100011653 | 3300005338 | Bacteria | 6406 |
| 30 | Ga0068868_101793141 | 3300005338 | Bacteria | 580 |
| 31 | Ga0070660_100019858 | 3300005339 | Bacteria | 4930 |
| 32 | Ga0070660_100029673 | 3300005339 | Bacteria | 4101 |
| 33 | Ga0070660_100050039 | 3300005339 | Bacteria | 3215 |
| 34 | Ga0070660_100167242 | 3300005339 | Bacteria | 1774 |
| 35 | Ga0070660_100335855 | 3300005339 | Unclassified | 1243 |
| 36 | Ga0070660_101121531 | 3300005339 | Bacteria | 666 |
| 37 | Ga0070689_100135775 | 3300005340 | Bacteria | 1975 |
| 38 | Ga0070661_100004741 | 3300005344 | Bacteria | 9351 |
| 39 | Ga0070661_100018491 | 3300005344 | Bacteria | 4954 |
| 40 | Ga0070661_100204582 | 3300005344 | Bacteria | 1509 |
| 41 | Ga0070692_10065419 | 3300005345 | Bacteria | 1925 |
| 42 | Ga0070668_100191998 | 3300005347 | Bacteria | 1673 |
| 43 | Ga0070669_100485835 | 3300005353 | Bacteria | 1023 |
| 44 | Ga0070669_100737455 | 3300005353 | Unclassified | 834 |
| 45 | Ga0070675_100003804 | 3300005354 | Bacteria | 11458 |
| 46 | Ga0070675_100100925 | 3300005354 | Bacteria | 2430 |
| 47 | Ga0070671_100000353 | 3300005355 | Bacteria | 31530 |
| 48 | Ga0070671_100032750 | 3300005355 | Bacteria | 4295 |
| 49 | Ga0070674_100023037 | 3300005356 | Bacteria | 4024 |
| 50 | Ga0070674_100030084 | 3300005356 | Bacteria | 3585 |
| 51 | Ga0070674_100558208 | 3300005356 | Bacteria | 962 |
| 52 | Ga0070673_100005436 | 3300005364 | Bacteria | 8152 |
| 53 | Ga0070673_100022439 | 3300005364 | Bacteria | 4594 |
| 54 | Ga0070673_100808097 | 3300005364 | Bacteria | 866 |
| 55 | Ga0070659_100189580 | 3300005366 | Bacteria | 1689 |
| 56 | Ga0070659_100190824 | 3300005366 | Bacteria | 1684 |
| 57 | Ga0070659_100439183 | 3300005366 | Unclassified | 1105 |
| 58 | Ga0070667_100001401 | 3300005367 | Bacteria | 21573 |
| 59 | Ga0070667_100026194 | 3300005367 | Bacteria | 4850 |
| 60 | Ga0070663_100023351 | 3300005455 | Bacteria | 4144 |
| 61 | Ga0070663_100053099 | 3300005455 | Bacteria | 2892 |
| 62 | Ga0070663_100090171 | 3300005455 | Bacteria | 2270 |
| 63 | Ga0070678_100246820 | 3300005456 | Bacteria | 1495 |
| 64 | Ga0070662_100013115 | 3300005457 | Bacteria | 5509 |
| 65 | Ga0070662_100417251 | 3300005457 | Bacteria | 1110 |
| 66 | Ga0070662_100922676 | 3300005457 | Bacteria | 746 |
| 67 | Ga0070681_10059760 | 3300005458 | Bacteria | 3791 |
| 68 | Ga0068867_100522267 | 3300005459 | Bacteria | 1024 |
| 69 | Ga0070679_100689196 | 3300005530 | Bacteria | 964 |
| 70 | Ga0070684_100781689 | 3300005535 | Bacteria | 892 |
| 71 | Ga0068853_100050021 | 3300005539 | Bacteria | 3594 |
| 72 | Ga0068853_100058701 | 3300005539 | Bacteria | 3322 |
| 73 | Ga0070672_100000538 | 3300005543 | Bacteria | 22279 |
| 74 | Ga0070686_100177692 | 3300005544 | Bacteria | 1510 |
| 75 | Ga0070693_100109524 | 3300005547 | Bacteria | 1697 |
| 76 | Ga0070665_100122518 | 3300005548 | Bacteria | 2602 |
| 77 | Ga0068855_101628682 | 3300005563 | Bacteria | 660 |
| 78 | Ga0070664_100004992 | 3300005564 | Bacteria | 10631 |
| 79 | Ga0070664_100090018 | 3300005564 | Bacteria | 2655 |
| 80 | Ga0070664_100236528 | 3300005564 | Bacteria | 1638 |
| 81 | Ga0070664_100330467 | 3300005564 | Bacteria | 1383 |
| 82 | Ga0068857_100088717 | 3300005577 | Bacteria | 2767 |
| 83 | Ga0068854_100054750 | 3300005578 | Bacteria | 2871 |
| 84 | Ga0068854_100082314 | 3300005578 | Bacteria | 2379 |
| 85 | Ga0068854_100153217 | 3300005578 | Bacteria | 1779 |
| 86 | Ga0068856_100176223 | 3300005614 | Bacteria | 2150 |
| 87 | Ga0068852_100059667 | 3300005616 | Bacteria | 3309 |
| 88 | Ga0068852_100273950 | 3300005616 | Bacteria | 1625 |
| 89 | Ga0068852_100496045 | 3300005616 | Unclassified | 1215 |
| 90 | Ga0068852_100639993 | 3300005616 | Bacteria | 1070 |
| 91 | Ga0068864_100135615 | 3300005618 | Bacteria | 2216 |
| 92 | Ga0068851_10001873 | 3300005834 | Bacteria | 9244 |
| 93 | Ga0068851_10172829 | 3300005834 | Bacteria | 1193 |
| 94 | Ga0068870_10163371 | 3300005840 | Bacteria | 1323 |
| 95 | Ga0068858_100015942 | 3300005842 | Bacteria | 7060 |
| 96 | Ga0068862_100082236 | 3300005844 | Bacteria | 2795 |
| 97 | Ga0081539_10046108 | 3300005985 | Bacteria | 2500 |
| 98 | Ga0105245_10416510 | 3300009098 | Bacteria | 1346 |
| 99 | Ga0105243_10333624 | 3300009148 | Bacteria | 1386 |
| 100 | Ga0105242_10449442 | 3300009176 | Bacteria | 1214 |
| 101 | Ga0105248_10006764 | 3300009177 | Bacteria | 12572 |
| 102 | Ga0105248_10009265 | 3300009177 | Bacteria | 10836 |
| 103 | Ga0105238_10271642 | 3300009551 | Bacteria | 1676 |
| 104 | Ga0157373_10032971 | 3300013100 | Bacteria | 3728 |
| 105 | Ga0157373_10670837 | 3300013100 | Bacteria | 758 |
| 106 | Ga0157371_10055490 | 3300013102 | Bacteria | 2811 |
| 107 | Ga0157369_10121262 | 3300013105 | Bacteria | 2774 |
| 108 | Ga0157369_10369679 | 3300013105 | Bacteria | 1488 |
| 109 | Ga0157374_10368392 | 3300013296 | Bacteria | 1430 |
| 110 | Ga0157378_10335798 | 3300013297 | Bacteria | 1472 |
| 111 | Ga0163162_10413926 | 3300013306 | Bacteria | 1480 |
| 112 | Ga0157372_11468905 | 3300013307 | Bacteria | 785 |
| 113 | Ga0157375_10016734 | 3300013308 | Bacteria | 6598 |
| 114 | Ga0163163_10112285 | 3300014325 | Bacteria | 2754 |
| 115 | Ga0157380_10403922 | 3300014326 | Bacteria | 1297 |
| 116 | Ga0157377_10417454 | 3300014745 | Bacteria | 918 |
| 117 | Ga0157377_11045999 | 3300014745 | Bacteria | 621 |
| 118 | Ga0157379_10041315 | 3300014968 | Bacteria | 4117 |
| 119 | Ga0163161_10333830 | 3300017792 | Unclassified | 1201 |
| 120 | Ga0207656_10015151 | 3300025321 | Bacteria | 2980 |
| 121 | Ga0207688_10496457 | 3300025901 | Unclassified | 764 |
| 122 | Ga0207680_10007009 | 3300025903 | Bacteria | 5471 |
| 123 | Ga0207645_10050173 | 3300025907 | Bacteria | 2664 |
| 124 | Ga0207645_10392234 | 3300025907 | Bacteria | 933 |
| 125 | Ga0207643_10199633 | 3300025908 | Bacteria | 1217 |
| 126 | Ga0207705_10003918 | 3300025909 | Bacteria | 11313 |
| 127 | Ga0207705_10010737 | 3300025909 | Bacteria | 6649 |
| 128 | Ga0207705_10053656 | 3300025909 | Bacteria | 2905 |
| 129 | Ga0207705_10137025 | 3300025909 | Bacteria | 1825 |
| 130 | Ga0207660_10300910 | 3300025917 | Bacteria | 1277 |
| 131 | Ga0207657_10001550 | 3300025919 | Bacteria | 24636 |
| 132 | Ga0207657_10121110 | 3300025919 | Bacteria | 2152 |
| 133 | Ga0207657_10285685 | 3300025919 | Unclassified | 1309 |
| 134 | Ga0207657_10486587 | 3300025919 | Bacteria | 967 |
| 135 | Ga0207649_10006053 | 3300025920 | Bacteria | 6566 |
| 136 | Ga0207649_10096328 | 3300025920 | Bacteria | 1949 |
| 137 | Ga0207652_10010628 | 3300025921 | Bacteria | 7411 |
| 138 | Ga0207681_10125075 | 3300025923 | Bacteria | 1892 |
| 139 | Ga0207650_10006356 | 3300025925 | Bacteria | 8046 |
| 140 | Ga0207650_10424925 | 3300025925 | Bacteria | 1103 |
| 141 | Ga0207659_10007610 | 3300025926 | Bacteria | 6678 |
| 142 | Ga0207687_10375079 | 3300025927 | Bacteria | 1164 |
| 143 | Ga0207644_10007501 | 3300025931 | Bacteria | 7113 |
| 144 | Ga0207644_10009854 | 3300025931 | Bacteria | 6284 |
| 145 | Ga0207644_10041499 | 3300025931 | Bacteria | 3255 |
| 146 | Ga0207690_10032865 | 3300025932 | Bacteria | 3332 |
| 147 | Ga0207690_10119343 | 3300025932 | Bacteria | 1913 |
| 148 | Ga0207706_10021265 | 3300025933 | Bacteria | 5829 |
| 149 | Ga0207706_10280050 | 3300025933 | Bacteria | 1454 |
| 150 | Ga0207706_10314936 | 3300025933 | Bacteria | 1362 |
| 151 | Ga0207706_10645099 | 3300025933 | Bacteria | 907 |
| 152 | Ga0207670_10486849 | 3300025936 | Bacteria | 1000 |
| 153 | Ga0207669_10004042 | 3300025937 | Bacteria | 6420 |
| 154 | Ga0207669_10017418 | 3300025937 | Bacteria | 3684 |
| 155 | Ga0207669_10406733 | 3300025937 | Bacteria | 1068 |
| 156 | Ga0207669_10459729 | 3300025937 | Bacteria | 1010 |
| 157 | Ga0207691_10004622 | 3300025940 | Bacteria | 13332 |
| 158 | Ga0207691_10037443 | 3300025940 | Bacteria | 4492 |
| 159 | Ga0207691_10119868 | 3300025940 | Bacteria | 2333 |
| 160 | Ga0207691_10417642 | 3300025940 | Bacteria | 1143 |
| 161 | Ga0207711_10000174 | 3300025941 | Bacteria | 69263 |
| 162 | Ga0207711_10019163 | 3300025941 | Bacteria | 5696 |
| 163 | Ga0207711_10122755 | 3300025941 | Bacteria | 2320 |
| 164 | Ga0207679_10024314 | 3300025945 | Bacteria | 4152 |
| 165 | Ga0207679_10036704 | 3300025945 | Bacteria | 3477 |
| 166 | Ga0207679_11082736 | 3300025945 | Bacteria | 735 |
| 167 | Ga0207651_10003851 | 3300025960 | Bacteria | 7445 |
| 168 | Ga0207651_10023239 | 3300025960 | Bacteria | 3808 |
| 169 | Ga0207640_10833373 | 3300025981 | Bacteria | 801 |
| 170 | Ga0207658_10001219 | 3300025986 | Bacteria | 20364 |
| 171 | Ga0207658_10031120 | 3300025986 | Bacteria | 3786 |
| 172 | Ga0207677_10023831 | 3300026023 | Bacteria | 3788 |
| 173 | Ga0207703_10002959 | 3300026035 | Bacteria | 14405 |
| 174 | Ga0207639_10020080 | 3300026041 | Bacteria | 4779 |
| 175 | Ga0207639_10104421 | 3300026041 | Bacteria | 2297 |
| 176 | Ga0207678_10005334 | 3300026067 | Bacteria | 11513 |
| 177 | Ga0207678_10075139 | 3300026067 | Bacteria | 2895 |
| 178 | Ga0207678_10647082 | 3300026067 | Bacteria | 928 |
| 179 | Ga0207678_11117839 | 3300026067 | Bacteria | 698 |
| 180 | Ga0207678_11266424 | 3300026067 | Bacteria | 653 |
| 181 | Ga0207702_10292167 | 3300026078 | Bacteria | 1544 |
| 182 | Ga0207702_10314968 | 3300026078 | Bacteria | 1489 |
| 183 | Ga0207648_10780617 | 3300026089 | Bacteria | 888 |
| 184 | Ga0207676_10035208 | 3300026095 | Bacteria | 3798 |
| 185 | Ga0207674_10066872 | 3300026116 | Bacteria | 3619 |
| 186 | Ga0207683_10774965 | 3300026121 | Unclassified | 890 |
| 187 | Ga0207698_10011009 | 3300026142 | Bacteria | 5847 |
| 188 | Ga0207698_10181618 | 3300026142 | Bacteria | 1864 |
| 189 | Ga0207698_10469486 | 3300026142 | Bacteria | 1218 |
| 190 | Ga0207698_10705543 | 3300026142 | Bacteria | 1004 |
| 191 | Ga0209974_10010200 | 3300027876 | Bacteria | 3170 |
| 192 | Ga0268266_10096171 | 3300028379 | Bacteria | 2602 |
| 193 | Ga0268266_10103756 | 3300028379 | Bacteria | 2509 |
| 194 | Ga0268265_10225463 | 3300028380 | Bacteria | 1643 |
| 195 | Ga0316182_1400565 | 3300030745 | Unclassified | 744 |
| 196 | Ga0307408_100094308 | 3300031548 | Bacteria | 2266 |
| 197 | Ga0307408_100219983 | 3300031548 | Bacteria | 1549 |
| 198 | Ga0307408_100769329 | 3300031548 | Bacteria | 871 |
| 199 | Ga0307408_100799271 | 3300031548 | Bacteria | 856 |
| 200 | Ga0307405_10230357 | 3300031731 | Bacteria | 1365 |
| 201 | Ga0307413_10058946 | 3300031824 | Bacteria | 2356 |
| 202 | Ga0307413_10930934 | 3300031824 | Bacteria | 740 |
| 203 | Ga0307410_10001701 | 3300031852 | Bacteria | 10140 |
| 204 | Ga0307410_10009159 | 3300031852 | Bacteria | 5538 |
| 205 | Ga0307410_10062659 | 3300031852 | Bacteria | 2549 |
| 206 | Ga0307410_10177513 | 3300031852 | Unclassified | 1610 |
| 207 | Ga0307410_10260702 | 3300031852 | Bacteria | 1352 |
| 208 | Ga0307410_10802851 | 3300031852 | Bacteria | 800 |
| 209 | Ga0307406_10034169 | 3300031901 | Bacteria | 3118 |
| 210 | Ga0307406_10038064 | 3300031901 | Bacteria | 2976 |
| 211 | Ga0307406_10162973 | 3300031901 | Bacteria | 1605 |
| 212 | Ga0307406_10257422 | 3300031901 | Bacteria | 1318 |
| 213 | Ga0307406_11288212 | 3300031901 | Bacteria | 637 |
| 214 | Ga0307407_10023002 | 3300031903 | Bacteria | 3245 |
| 215 | Ga0307407_10069387 | 3300031903 | Bacteria | 2092 |
| 216 | Ga0307407_10176240 | 3300031903 | Bacteria | 1413 |
| 217 | Ga0307412_10247195 | 3300031911 | Bacteria | 1383 |
| 218 | Ga0307412_10405812 | 3300031911 | Bacteria | 1111 |
| 219 | Ga0307412_10555096 | 3300031911 | Bacteria | 965 |
| 220 | Ga0307412_10910336 | 3300031911 | Bacteria | 771 |
| 221 | Ga0307409_100001844 | 3300031995 | Bacteria | 10778 |
| 222 | Ga0307409_100005127 | 3300031995 | Bacteria | 7481 |
| 223 | Ga0307409_100294538 | 3300031995 | Bacteria | 1506 |
| 224 | Ga0307409_100397002 | 3300031995 | Bacteria | 1316 |
| 225 | Ga0307409_100573464 | 3300031995 | Unclassified | 1111 |
| 226 | Ga0307409_100843475 | 3300031995 | Unclassified | 927 |
| 227 | Ga0307416_100002847 | 3300032002 | Bacteria | 10065 |
| 228 | Ga0307416_100040533 | 3300032002 | Bacteria | 3619 |
| 229 | Ga0307416_100072944 | 3300032002 | Bacteria | 2860 |
| 230 | Ga0307416_100205161 | 3300032002 | Bacteria | 1874 |
| 231 | Ga0307416_100362367 | 3300032002 | Bacteria | 1472 |
| 232 | Ga0307414_10039415 | 3300032004 | Bacteria | 3182 |
| 233 | Ga0307414_10100971 | 3300032004 | Bacteria | 2171 |
| 234 | Ga0307414_10124962 | 3300032004 | Bacteria | 1985 |
| 235 | Ga0307414_10339610 | 3300032004 | Bacteria | 1285 |
| 236 | Ga0307411_10000654 | 3300032005 | Bacteria | 12618 |
| 237 | Ga0307411_10179715 | 3300032005 | Bacteria | 1605 |
| 238 | Ga0307411_10200983 | 3300032005 | Bacteria | 1530 |
| 239 | Ga0307415_100008310 | 3300032126 | Bacteria | 5746 |
| 240 | Ga0307415_100049793 | 3300032126 | Bacteria | 2835 |
| 241 | Ga0307415_100548605 | 3300032126 | Bacteria | 1020 |
| 242 | Ga0373961_0201083 | 3300035241 | Bacteria | 703 |
| 243 | Ga0395899_0094270 | 3300037312 | Bacteria | 2166 |
| 244 | Ga0395899_0381864 | 3300037312 | Bacteria | 936 |
| 245 | Ga0395899_0610964 | 3300037312 | Bacteria | 693 |
| 246 | Ga0395900_0003785 | 3300037418 | Bacteria | 16206 |
| 247 | Ga0395900_0014103 | 3300037418 | Bacteria | 8159 |
| 248 | Ga0395900_0109457 | 3300037418 | Bacteria | 2838 |
| 249 | Ga0395900_0137784 | 3300037418 | Bacteria | 2500 |
| 250 | Ga0395900_0335701 | 3300037418 | Bacteria | 1488 |
| 251 | Ga0395898_0025741 | 3300037466 | Bacteria | 5926 |
| 252 | Ga0395898_0799725 | 3300037466 | Bacteria | 883 |
| 253 | Ga0395905_0002749 | 3300037471 | Bacteria | 19259 |
| 254 | Ga0395905_0021179 | 3300037471 | Bacteria | 6153 |
| 255 | Ga0395905_0306282 | 3300037471 | Bacteria | 1477 |
| 256 | Ga0395905_0306450 | 3300037471 | Bacteria | 1476 |
| 257 | Ga0395905_0326466 | 3300037471 | Bacteria | 1424 |
| 258 | Ga0395901_0006263 | 3300038443 | Bacteria | 12059 |
| 259 | Ga0395901_0032296 | 3300038443 | Bacteria | 5402 |
| 260 | Ga0395901_0097068 | 3300038443 | Bacteria | 3088 |
| 261 | Ga0395901_0177642 | 3300038443 | Bacteria | 2233 |
| 262 | Ga0395901_1502559 | 3300038443 | Bacteria | 629 |
| 263 | Ga0439433_0143798 | 3300041999 | Unclassified | 611 |
| 264 | Ga0439432_084763 | 3300042006 | Unclassified | 957 |
| 265 | Ga0439432_174926 | 3300042006 | Bacteria | 626 |
| 266 | Ga0439449_0042402 | 3300042007 | Bacteria | 1690 |
| 267 | Ga0439449_0062132 | 3300042007 | Bacteria | 1378 |
| 268 | Ga0450912_000350 | 3300042116 | Bacteria | 2164 |
| 269 | Ga0450914_001107 | 3300042118 | Bacteria | 1584 |
| 270 | Ga0450920_029682 | 3300042122 | Bacteria | 1074 |
| 271 | Ga0450898_042503 | 3300042134 | Bacteria | 863 |
| 272 | Ga0450900_041739 | 3300042136 | Bacteria | 688 |
| 273 | Ga0450907_078785 | 3300042146 | Bacteria | 572 |
| 274 | Ga0439464_0025438 | 3300042439 | Bacteria | 1639 |
| 275 | Ga0451577_0759603 | 3300042876 | Bacteria | 877 |
| 276 | Ga0466972_0190504 | 3300044658 | Bacteria | 961 |
| 277 | Ga0466972_0454631 | 3300044658 | Bacteria | 602 |
| 278 | Ga0466963_0226218 | 3300044694 | Bacteria | 1310 |
| 279 | Ga0453684_2483770 | 3300044712 | Bacteria | 512 |
| 280 | Ga0466970_0305486 | 3300044765 | Unclassified | 898 |
| 281 | Ga0466967_1272667 | 3300045976 | Unclassified | 733 |
| 282 | Ga0495663_0028103 | 3300046525 | Bacteria | 1654 |
| 283 | Ga0495597_0101217 | 3300046542 | Bacteria | 1215 |
| 284 | Ga0495669_0007692 | 3300046684 | Bacteria | 4522 |
| 285 | Ga0495669_0179034 | 3300046684 | Bacteria | 1010 |
| 286 | Ga0495685_269867 | 3300047447 | Unclassified | 537 |
| 287 | Ga0496102_1836811 | 3300048905 | Bacteria | 523 |
| 288 | Ga0496103_0273516 | 3300048906 | Bacteria | 1087 |
| 289 | Ga0496108_0066160 | 3300048911 | Bacteria | 3048 |
| 290 | Ga0496108_1100966 | 3300048911 | Bacteria | 675 |
| 291 | Ga0496109_0152167 | 3300048912 | Bacteria | 2166 |
| 292 | Ga0496110_0001847 | 3300048913 | Bacteria | 15627 |
| 293 | Ga0496110_0125913 | 3300048913 | Bacteria | 2312 |
| 294 | Ga0496111_0007597 | 3300048914 | Bacteria | 7119 |
| 295 | Ga0496112_0673596 | 3300048915 | Bacteria | 963 |
| 296 | Ga0496112_1091825 | 3300048915 | Unclassified | 716 |
| 297 | Ga0501224_035867 | 3300049664 | Unclassified | 745 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046542 | Ga0495597_0101217 | Ga0495597_0101217_40_396 | 117 |
| 2 | 3300048905 | Ga0496102_1836811 | Ga0496102_1836811_93_446 | 117 |
| 3 | 3300048911 | Ga0496108_1100966 | Ga0496108_1100966_279_632 | 117 |
| 4 | 3300048913 | Ga0496110_0125913 | Ga0496110_0125913_1630_1983 | 117 |
| 5 | 3300025936 | Ga0207670_10486849 | Ga0207670_104868491 | 131 |
| 6 | 3300037312 | Ga0395899_0381864 | Ga0395899_0381864_142_543 | 133 |
| 7 | 3300037418 | Ga0395900_0109457 | Ga0395900_0109457_1472_1873 | 133 |
| 8 | 3300037466 | Ga0395898_0799725 | Ga0395898_0799725_378_779 | 133 |
| 9 | 3300038443 | Ga0395901_0006263 | Ga0395901_0006263_7922_8323 | 133 |
| 10 | 3300005355 | Ga0070671_100032750 | Ga0070671_1000327503 | 136 |
| 11 | 3300025931 | Ga0207644_10009854 | Ga0207644_100098544 | 136 |
| 12 | 3300005364 | Ga0070673_100808097 | Ga0070673_1008080972 | 137 |
| 13 | 3300005347 | Ga0070668_100191998 | Ga0070668_1001919983 | 138 |
| 14 | 3300005331 | Ga0070670_100009058 | Ga0070670_1000090582 | 143 |
| 15 | 3300005333 | Ga0070677_10064312 | Ga0070677_100643122 | 143 |
| 16 | 3300005339 | Ga0070660_100335855 | Ga0070660_1003358552 | 143 |
| 17 | 3300025919 | Ga0207657_10285685 | Ga0207657_102856852 | 143 |
| 18 | 3300025933 | Ga0207706_10280050 | Ga0207706_102800502 | 143 |
| 19 | 3300025940 | Ga0207691_10037443 | Ga0207691_100374433 | 143 |
| 20 | 3300025940 | Ga0207691_10119868 | Ga0207691_101198682 | 143 |
| 21 | 3300025941 | Ga0207711_10122755 | Ga0207711_101227552 | 143 |
| 22 | 3300026121 | Ga0207683_10774965 | Ga0207683_107749652 | 143 |
| 23 | 3300031901 | Ga0307406_11288212 | Ga0307406_112882122 | 143 |
| 24 | 3300042439 | Ga0439464_0025438 | Ga0439464_0025438_502_936 | 143 |
| 25 | 2162886012 | MBSR1b_contig_4198986 | MBSR1b_0263.00004940 | 144 |
| 26 | 3300001989 | JGI24739J22299_10201205 | JGI24739J22299_102012052 | 144 |
| 27 | 3300001990 | JGI24737J22298_10018178 | JGI24737J22298_100181782 | 144 |
| 28 | 3300002074 | JGI24748J21848_1014016 | JGI24748J21848_10140162 | 144 |
| 29 | 3300002075 | JGI24738J21930_10055740 | JGI24738J21930_100557401 | 144 |
| 30 | 3300002239 | JGI24034J26672_10007446 | JGI24034J26672_100074463 | 144 |
| 31 | 3300005290 | Ga0065712_10092230 | Ga0065712_100922302 | 144 |
| 32 | 3300005290 | Ga0065712_10156391 | Ga0065712_101563912 | 144 |
| 33 | 3300005293 | Ga0065715_10095287 | Ga0065715_100952872 | 144 |
| 34 | 3300005327 | Ga0070658_10001337 | Ga0070658_1000133714 | 144 |
| 35 | 3300005327 | Ga0070658_10040529 | Ga0070658_100405294 | 144 |
| 36 | 3300005327 | Ga0070658_10060590 | Ga0070658_100605903 | 144 |
| 37 | 3300005327 | Ga0070658_10070482 | Ga0070658_100704822 | 144 |
| 38 | 3300005327 | Ga0070658_10109119 | Ga0070658_101091192 | 144 |
| 39 | 3300005327 | Ga0070658_10355601 | Ga0070658_103556012 | 144 |
| 40 | 3300005328 | Ga0070676_10031920 | Ga0070676_100319202 | 144 |
| 41 | 3300005328 | Ga0070676_10181991 | Ga0070676_101819912 | 144 |
| 42 | 3300005329 | Ga0070683_100788433 | Ga0070683_1007884332 | 144 |
| 43 | 3300005331 | Ga0070670_100003505 | Ga0070670_1000035056 | 144 |
| 44 | 3300005333 | Ga0070677_10024315 | Ga0070677_100243152 | 144 |
| 45 | 3300005333 | Ga0070677_10074495 | Ga0070677_100744952 | 144 |
| 46 | 3300005335 | Ga0070666_10001385 | Ga0070666_100013858 | 144 |
| 47 | 3300005335 | Ga0070666_10032812 | Ga0070666_100328123 | 144 |
| 48 | 3300005336 | Ga0070680_100078128 | Ga0070680_1000781283 | 144 |
| 49 | 3300005336 | Ga0070680_100441782 | Ga0070680_1004417822 | 144 |
| 50 | 3300005337 | Ga0070682_100823534 | Ga0070682_1008235342 | 144 |
| 51 | 3300005338 | Ga0068868_100011653 | Ga0068868_1000116532 | 144 |
| 52 | 3300005338 | Ga0068868_101793141 | Ga0068868_1017931411 | 144 |
| 53 | 3300005339 | Ga0070660_100019858 | Ga0070660_1000198584 | 144 |
| 54 | 3300005339 | Ga0070660_100029673 | Ga0070660_1000296733 | 144 |
| 55 | 3300005339 | Ga0070660_100050039 | Ga0070660_1000500393 | 144 |
| 56 | 3300005339 | Ga0070660_100167242 | Ga0070660_1001672422 | 144 |
| 57 | 3300005339 | Ga0070660_101121531 | Ga0070660_1011215311 | 144 |
| 58 | 3300005340 | Ga0070689_100135775 | Ga0070689_1001357752 | 144 |
| 59 | 3300005344 | Ga0070661_100004741 | Ga0070661_1000047414 | 144 |
| 60 | 3300005344 | Ga0070661_100018491 | Ga0070661_1000184912 | 144 |
| 61 | 3300005344 | Ga0070661_100204582 | Ga0070661_1002045822 | 144 |
| 62 | 3300005345 | Ga0070692_10065419 | Ga0070692_100654192 | 144 |
| 63 | 3300005353 | Ga0070669_100485835 | Ga0070669_1004858352 | 144 |
| 64 | 3300005353 | Ga0070669_100737455 | Ga0070669_1007374552 | 144 |
| 65 | 3300005354 | Ga0070675_100003804 | Ga0070675_1000038046 | 144 |
| 66 | 3300005354 | Ga0070675_100100925 | Ga0070675_1001009252 | 144 |
| 67 | 3300005355 | Ga0070671_100000353 | Ga0070671_10000035313 | 144 |
| 68 | 3300005356 | Ga0070674_100023037 | Ga0070674_1000230374 | 144 |
| 69 | 3300005356 | Ga0070674_100030084 | Ga0070674_1000300844 | 144 |
| 70 | 3300005356 | Ga0070674_100558208 | Ga0070674_1005582082 | 144 |
| 71 | 3300005364 | Ga0070673_100005436 | Ga0070673_1000054366 | 144 |
| 72 | 3300005364 | Ga0070673_100022439 | Ga0070673_1000224394 | 144 |
| 73 | 3300005366 | Ga0070659_100189580 | Ga0070659_1001895802 | 144 |
| 74 | 3300005366 | Ga0070659_100190824 | Ga0070659_1001908242 | 144 |
| 75 | 3300005366 | Ga0070659_100439183 | Ga0070659_1004391831 | 144 |
| 76 | 3300005367 | Ga0070667_100001401 | Ga0070667_1000014018 | 144 |
| 77 | 3300005367 | Ga0070667_100026194 | Ga0070667_1000261944 | 144 |
| 78 | 3300005455 | Ga0070663_100023351 | Ga0070663_1000233513 | 144 |
| 79 | 3300005455 | Ga0070663_100053099 | Ga0070663_1000530994 | 144 |
| 80 | 3300005455 | Ga0070663_100090171 | Ga0070663_1000901712 | 144 |
| 81 | 3300005456 | Ga0070678_100246820 | Ga0070678_1002468202 | 144 |
| 82 | 3300005457 | Ga0070662_100013115 | Ga0070662_1000131153 | 144 |
| 83 | 3300005457 | Ga0070662_100417251 | Ga0070662_1004172512 | 144 |
| 84 | 3300005457 | Ga0070662_100922676 | Ga0070662_1009226761 | 144 |
| 85 | 3300005458 | Ga0070681_10059760 | Ga0070681_100597603 | 144 |
| 86 | 3300005459 | Ga0068867_100522267 | Ga0068867_1005222671 | 144 |
| 87 | 3300005530 | Ga0070679_100689196 | Ga0070679_1006891962 | 144 |
| 88 | 3300005535 | Ga0070684_100781689 | Ga0070684_1007816892 | 144 |
| 89 | 3300005539 | Ga0068853_100050021 | Ga0068853_1000500213 | 144 |
| 90 | 3300005539 | Ga0068853_100058701 | Ga0068853_1000587013 | 144 |
| 91 | 3300005543 | Ga0070672_100000538 | Ga0070672_10000053814 | 144 |
| 92 | 3300005544 | Ga0070686_100177692 | Ga0070686_1001776922 | 144 |
| 93 | 3300005547 | Ga0070693_100109524 | Ga0070693_1001095243 | 144 |
| 94 | 3300005548 | Ga0070665_100122518 | Ga0070665_1001225181 | 144 |
| 95 | 3300005563 | Ga0068855_101628682 | Ga0068855_1016286822 | 144 |
| 96 | 3300005564 | Ga0070664_100004992 | Ga0070664_1000049923 | 144 |
| 97 | 3300005564 | Ga0070664_100090018 | Ga0070664_1000900182 | 144 |
| 98 | 3300005564 | Ga0070664_100236528 | Ga0070664_1002365282 | 144 |
| 99 | 3300005564 | Ga0070664_100330467 | Ga0070664_1003304672 | 144 |
| 100 | 3300005577 | Ga0068857_100088717 | Ga0068857_1000887172 | 144 |
| 101 | 3300005578 | Ga0068854_100054750 | Ga0068854_1000547502 | 144 |
| 102 | 3300005578 | Ga0068854_100082314 | Ga0068854_1000823142 | 144 |
| 103 | 3300005578 | Ga0068854_100153217 | Ga0068854_1001532172 | 144 |
| 104 | 3300005614 | Ga0068856_100176223 | Ga0068856_1001762232 | 144 |
| 105 | 3300005616 | Ga0068852_100059667 | Ga0068852_1000596672 | 144 |
| 106 | 3300005616 | Ga0068852_100273950 | Ga0068852_1002739503 | 144 |
| 107 | 3300005616 | Ga0068852_100496045 | Ga0068852_1004960451 | 144 |
| 108 | 3300005616 | Ga0068852_100639993 | Ga0068852_1006399932 | 144 |
| 109 | 3300005618 | Ga0068864_100135615 | Ga0068864_1001356152 | 144 |
| 110 | 3300005834 | Ga0068851_10001873 | Ga0068851_100018734 | 144 |
| 111 | 3300005834 | Ga0068851_10172829 | Ga0068851_101728292 | 144 |
| 112 | 3300005840 | Ga0068870_10163371 | Ga0068870_101633712 | 144 |
| 113 | 3300005842 | Ga0068858_100015942 | Ga0068858_1000159422 | 144 |
| 114 | 3300005844 | Ga0068862_100082236 | Ga0068862_1000822363 | 144 |
| 115 | 3300005985 | Ga0081539_10046108 | Ga0081539_100461083 | 144 |
| 116 | 3300009098 | Ga0105245_10416510 | Ga0105245_104165102 | 144 |
| 117 | 3300009148 | Ga0105243_10333624 | Ga0105243_103336242 | 144 |
| 118 | 3300009176 | Ga0105242_10449442 | Ga0105242_104494422 | 144 |
| 119 | 3300009177 | Ga0105248_10006764 | Ga0105248_100067646 | 144 |
| 120 | 3300009177 | Ga0105248_10009265 | Ga0105248_100092657 | 144 |
| 121 | 3300009551 | Ga0105238_10271642 | Ga0105238_102716423 | 144 |
| 122 | 3300013100 | Ga0157373_10032971 | Ga0157373_100329712 | 144 |
| 123 | 3300013100 | Ga0157373_10670837 | Ga0157373_106708371 | 144 |
| 124 | 3300013102 | Ga0157371_10055490 | Ga0157371_100554903 | 144 |
| 125 | 3300013105 | Ga0157369_10121262 | Ga0157369_101212622 | 144 |
| 126 | 3300013105 | Ga0157369_10369679 | Ga0157369_103696792 | 144 |
| 127 | 3300013296 | Ga0157374_10368392 | Ga0157374_103683922 | 144 |
| 128 | 3300013297 | Ga0157378_10335798 | Ga0157378_103357982 | 144 |
| 129 | 3300013306 | Ga0163162_10413926 | Ga0163162_104139262 | 144 |
| 130 | 3300013307 | Ga0157372_11468905 | Ga0157372_114689052 | 144 |
| 131 | 3300013308 | Ga0157375_10016734 | Ga0157375_100167343 | 144 |
| 132 | 3300014325 | Ga0163163_10112285 | Ga0163163_101122852 | 144 |
| 133 | 3300014326 | Ga0157380_10403922 | Ga0157380_104039222 | 144 |
| 134 | 3300014745 | Ga0157377_10417454 | Ga0157377_104174542 | 144 |
| 135 | 3300014745 | Ga0157377_11045999 | Ga0157377_110459992 | 144 |
| 136 | 3300014968 | Ga0157379_10041315 | Ga0157379_100413152 | 144 |
| 137 | 3300017792 | Ga0163161_10333830 | Ga0163161_103338302 | 144 |
| 138 | 3300025321 | Ga0207656_10015151 | Ga0207656_100151512 | 144 |
| 139 | 3300025901 | Ga0207688_10496457 | Ga0207688_104964572 | 144 |
| 140 | 3300025903 | Ga0207680_10007009 | Ga0207680_100070093 | 144 |
| 141 | 3300025907 | Ga0207645_10050173 | Ga0207645_100501732 | 144 |
| 142 | 3300025907 | Ga0207645_10392234 | Ga0207645_103922342 | 144 |
| 143 | 3300025908 | Ga0207643_10199633 | Ga0207643_101996332 | 144 |
| 144 | 3300025909 | Ga0207705_10003918 | Ga0207705_100039182 | 144 |
| 145 | 3300025909 | Ga0207705_10010737 | Ga0207705_100107373 | 144 |
| 146 | 3300025909 | Ga0207705_10053656 | Ga0207705_100536562 | 144 |
| 147 | 3300025909 | Ga0207705_10137025 | Ga0207705_101370252 | 144 |
| 148 | 3300025917 | Ga0207660_10300910 | Ga0207660_103009102 | 144 |
| 149 | 3300025919 | Ga0207657_10001550 | Ga0207657_100015503 | 144 |
| 150 | 3300025919 | Ga0207657_10121110 | Ga0207657_101211102 | 144 |
| 151 | 3300025919 | Ga0207657_10486587 | Ga0207657_104865872 | 144 |
| 152 | 3300025920 | Ga0207649_10006053 | Ga0207649_100060534 | 144 |
| 153 | 3300025920 | Ga0207649_10096328 | Ga0207649_100963282 | 144 |
| 154 | 3300025921 | Ga0207652_10010628 | Ga0207652_100106284 | 144 |
| 155 | 3300025923 | Ga0207681_10125075 | Ga0207681_101250752 | 144 |
| 156 | 3300025925 | Ga0207650_10006356 | Ga0207650_100063563 | 144 |
| 157 | 3300025925 | Ga0207650_10424925 | Ga0207650_104249252 | 144 |
| 158 | 3300025926 | Ga0207659_10007610 | Ga0207659_100076103 | 144 |
| 159 | 3300025927 | Ga0207687_10375079 | Ga0207687_103750792 | 144 |
| 160 | 3300025931 | Ga0207644_10007501 | Ga0207644_100075013 | 144 |
| 161 | 3300025931 | Ga0207644_10041499 | Ga0207644_100414992 | 144 |
| 162 | 3300025932 | Ga0207690_10032865 | Ga0207690_100328651 | 144 |
| 163 | 3300025932 | Ga0207690_10119343 | Ga0207690_101193432 | 144 |
| 164 | 3300025933 | Ga0207706_10021265 | Ga0207706_100212653 | 144 |
| 165 | 3300025933 | Ga0207706_10314936 | Ga0207706_103149362 | 144 |
| 166 | 3300025933 | Ga0207706_10645099 | Ga0207706_106450992 | 144 |
| 167 | 3300025937 | Ga0207669_10004042 | Ga0207669_100040426 | 144 |
| 168 | 3300025937 | Ga0207669_10017418 | Ga0207669_100174182 | 144 |
| 169 | 3300025937 | Ga0207669_10406733 | Ga0207669_104067332 | 144 |
| 170 | 3300025937 | Ga0207669_10459729 | Ga0207669_104597292 | 144 |
| 171 | 3300025940 | Ga0207691_10004622 | Ga0207691_100046226 | 144 |
| 172 | 3300025940 | Ga0207691_10417642 | Ga0207691_104176422 | 144 |
| 173 | 3300025941 | Ga0207711_10000174 | Ga0207711_1000017448 | 144 |
| 174 | 3300025941 | Ga0207711_10019163 | Ga0207711_100191633 | 144 |
| 175 | 3300025945 | Ga0207679_10024314 | Ga0207679_100243142 | 144 |
| 176 | 3300025945 | Ga0207679_10036704 | Ga0207679_100367042 | 144 |
| 177 | 3300025945 | Ga0207679_11082736 | Ga0207679_110827362 | 144 |
| 178 | 3300025960 | Ga0207651_10003851 | Ga0207651_100038514 | 144 |
| 179 | 3300025960 | Ga0207651_10023239 | Ga0207651_100232394 | 144 |
| 180 | 3300025981 | Ga0207640_10833373 | Ga0207640_108333732 | 144 |
| 181 | 3300025986 | Ga0207658_10001219 | Ga0207658_100012196 | 144 |
| 182 | 3300025986 | Ga0207658_10031120 | Ga0207658_100311203 | 144 |
| 183 | 3300026023 | Ga0207677_10023831 | Ga0207677_100238314 | 144 |
| 184 | 3300026035 | Ga0207703_10002959 | Ga0207703_100029596 | 144 |
| 185 | 3300026041 | Ga0207639_10020080 | Ga0207639_100200803 | 144 |
| 186 | 3300026041 | Ga0207639_10104421 | Ga0207639_101044212 | 144 |
| 187 | 3300026067 | Ga0207678_10005334 | Ga0207678_100053346 | 144 |
| 188 | 3300026067 | Ga0207678_10075139 | Ga0207678_100751394 | 144 |
| 189 | 3300026067 | Ga0207678_10647082 | Ga0207678_106470822 | 144 |
| 190 | 3300026067 | Ga0207678_11117839 | Ga0207678_111178392 | 144 |
| 191 | 3300026067 | Ga0207678_11266424 | Ga0207678_112664242 | 144 |
| 192 | 3300026078 | Ga0207702_10292167 | Ga0207702_102921672 | 144 |
| 193 | 3300026078 | Ga0207702_10314968 | Ga0207702_103149682 | 144 |
| 194 | 3300026089 | Ga0207648_10780617 | Ga0207648_107806172 | 144 |
| 195 | 3300026095 | Ga0207676_10035208 | Ga0207676_100352084 | 144 |
| 196 | 3300026116 | Ga0207674_10066872 | Ga0207674_100668724 | 144 |
| 197 | 3300026142 | Ga0207698_10011009 | Ga0207698_100110092 | 144 |
| 198 | 3300026142 | Ga0207698_10181618 | Ga0207698_101816182 | 144 |
| 199 | 3300026142 | Ga0207698_10469486 | Ga0207698_104694862 | 144 |
| 200 | 3300026142 | Ga0207698_10705543 | Ga0207698_107055432 | 144 |
| 201 | 3300027876 | Ga0209974_10010200 | Ga0209974_100102002 | 144 |
| 202 | 3300028379 | Ga0268266_10096171 | Ga0268266_100961712 | 144 |
| 203 | 3300028379 | Ga0268266_10103756 | Ga0268266_101037563 | 144 |
| 204 | 3300028380 | Ga0268265_10225463 | Ga0268265_102254632 | 144 |
| 205 | 3300030745 | Ga0316182_1400565 | Ga0316182_14005652 | 144 |
| 206 | 3300031548 | Ga0307408_100094308 | Ga0307408_1000943082 | 144 |
| 207 | 3300031548 | Ga0307408_100219983 | Ga0307408_1002199832 | 144 |
| 208 | 3300031548 | Ga0307408_100769329 | Ga0307408_1007693292 | 144 |
| 209 | 3300031548 | Ga0307408_100799271 | Ga0307408_1007992712 | 144 |
| 210 | 3300031731 | Ga0307405_10230357 | Ga0307405_102303572 | 144 |
| 211 | 3300031824 | Ga0307413_10058946 | Ga0307413_100589462 | 144 |
| 212 | 3300031824 | Ga0307413_10930934 | Ga0307413_109309342 | 144 |
| 213 | 3300031852 | Ga0307410_10001701 | Ga0307410_100017013 | 144 |
| 214 | 3300031852 | Ga0307410_10009159 | Ga0307410_100091594 | 144 |
| 215 | 3300031852 | Ga0307410_10062659 | Ga0307410_100626592 | 144 |
| 216 | 3300031852 | Ga0307410_10177513 | Ga0307410_101775132 | 144 |
| 217 | 3300031852 | Ga0307410_10260702 | Ga0307410_102607022 | 144 |
| 218 | 3300031852 | Ga0307410_10802851 | Ga0307410_108028512 | 144 |
| 219 | 3300031901 | Ga0307406_10034169 | Ga0307406_100341693 | 144 |
| 220 | 3300031901 | Ga0307406_10038064 | Ga0307406_100380644 | 144 |
| 221 | 3300031901 | Ga0307406_10162973 | Ga0307406_101629732 | 144 |
| 222 | 3300031901 | Ga0307406_10257422 | Ga0307406_102574222 | 144 |
| 223 | 3300031903 | Ga0307407_10023002 | Ga0307407_100230022 | 144 |
| 224 | 3300031903 | Ga0307407_10069387 | Ga0307407_100693872 | 144 |
| 225 | 3300031903 | Ga0307407_10176240 | Ga0307407_101762402 | 144 |
| 226 | 3300031911 | Ga0307412_10247195 | Ga0307412_102471952 | 144 |
| 227 | 3300031911 | Ga0307412_10405812 | Ga0307412_104058122 | 144 |
| 228 | 3300031911 | Ga0307412_10555096 | Ga0307412_105550962 | 144 |
| 229 | 3300031911 | Ga0307412_10910336 | Ga0307412_109103362 | 144 |
| 230 | 3300031995 | Ga0307409_100001844 | Ga0307409_1000018446 | 144 |
| 231 | 3300031995 | Ga0307409_100005127 | Ga0307409_1000051276 | 144 |
| 232 | 3300031995 | Ga0307409_100294538 | Ga0307409_1002945382 | 144 |
| 233 | 3300031995 | Ga0307409_100397002 | Ga0307409_1003970022 | 144 |
| 234 | 3300031995 | Ga0307409_100573464 | Ga0307409_1005734641 | 144 |
| 235 | 3300031995 | Ga0307409_100843475 | Ga0307409_1008434751 | 144 |
| 236 | 3300032002 | Ga0307416_100002847 | Ga0307416_1000028473 | 144 |
| 237 | 3300032002 | Ga0307416_100040533 | Ga0307416_1000405332 | 144 |
| 238 | 3300032002 | Ga0307416_100072944 | Ga0307416_1000729442 | 144 |
| 239 | 3300032002 | Ga0307416_100205161 | Ga0307416_1002051612 | 144 |
| 240 | 3300032002 | Ga0307416_100362367 | Ga0307416_1003623672 | 144 |
| 241 | 3300032004 | Ga0307414_10039415 | Ga0307414_100394154 | 144 |
| 242 | 3300032004 | Ga0307414_10100971 | Ga0307414_101009712 | 144 |
| 243 | 3300032004 | Ga0307414_10124962 | Ga0307414_101249622 | 144 |
| 244 | 3300032004 | Ga0307414_10339610 | Ga0307414_103396102 | 144 |
| 245 | 3300032005 | Ga0307411_10000654 | Ga0307411_100006546 | 144 |
| 246 | 3300032005 | Ga0307411_10179715 | Ga0307411_101797152 | 144 |
| 247 | 3300032005 | Ga0307411_10200983 | Ga0307411_102009832 | 144 |
| 248 | 3300032126 | Ga0307415_100008310 | Ga0307415_1000083105 | 144 |
| 249 | 3300032126 | Ga0307415_100049793 | Ga0307415_1000497934 | 144 |
| 250 | 3300032126 | Ga0307415_100548605 | Ga0307415_1005486052 | 144 |
| 251 | 3300035241 | Ga0373961_0201083 | Ga0373961_0201083_137_571 | 144 |
| 252 | 3300037312 | Ga0395899_0094270 | Ga0395899_0094270_628_1062 | 144 |
| 253 | 3300037312 | Ga0395899_0610964 | Ga0395899_0610964_158_592 | 144 |
| 254 | 3300037418 | Ga0395900_0003785 | Ga0395900_0003785_1157_1591 | 144 |
| 255 | 3300037418 | Ga0395900_0014103 | Ga0395900_0014103_1557_1991 | 144 |
| 256 | 3300037418 | Ga0395900_0137784 | Ga0395900_0137784_1075_1509 | 144 |
| 257 | 3300037418 | Ga0395900_0335701 | Ga0395900_0335701_1013_1447 | 144 |
| 258 | 3300037466 | Ga0395898_0025741 | Ga0395898_0025741_4489_4923 | 144 |
| 259 | 3300037471 | Ga0395905_0002749 | Ga0395905_0002749_10699_11133 | 144 |
| 260 | 3300037471 | Ga0395905_0021179 | Ga0395905_0021179_279_713 | 144 |
| 261 | 3300037471 | Ga0395905_0306282 | Ga0395905_0306282_376_810 | 144 |
| 262 | 3300037471 | Ga0395905_0306450 | Ga0395905_0306450_784_1218 | 144 |
| 263 | 3300037471 | Ga0395905_0326466 | Ga0395905_0326466_866_1300 | 144 |
| 264 | 3300038443 | Ga0395901_0032296 | Ga0395901_0032296_2905_3339 | 144 |
| 265 | 3300038443 | Ga0395901_0097068 | Ga0395901_0097068_1166_1600 | 144 |
| 266 | 3300038443 | Ga0395901_0177642 | Ga0395901_0177642_111_545 | 144 |
| 267 | 3300038443 | Ga0395901_1502559 | Ga0395901_1502559_134_568 | 144 |
| 268 | 3300041999 | Ga0439433_0143798 | Ga0439433_0143798_24_458 | 144 |
| 269 | 3300042006 | Ga0439432_084763 | Ga0439432_084763_357_791 | 144 |
| 270 | 3300042006 | Ga0439432_174926 | Ga0439432_174926_123_557 | 144 |
| 271 | 3300042007 | Ga0439449_0042402 | Ga0439449_0042402_852_1286 | 144 |
| 272 | 3300042007 | Ga0439449_0062132 | Ga0439449_0062132_485_919 | 144 |
| 273 | 3300042116 | Ga0450912_000350 | Ga0450912_000350_217_651 | 144 |
| 274 | 3300042118 | Ga0450914_001107 | Ga0450914_001107_968_1402 | 144 |
| 275 | 3300042122 | Ga0450920_029682 | Ga0450920_029682_93_527 | 144 |
| 276 | 3300042134 | Ga0450898_042503 | Ga0450898_042503_240_674 | 144 |
| 277 | 3300042136 | Ga0450900_041739 | Ga0450900_041739_214_648 | 144 |
| 278 | 3300042146 | Ga0450907_078785 | Ga0450907_078785_119_553 | 144 |
| 279 | 3300042876 | Ga0451577_0759603 | Ga0451577_0759603_139_573 | 144 |
| 280 | 3300044658 | Ga0466972_0190504 | Ga0466972_0190504_291_725 | 144 |
| 281 | 3300044658 | Ga0466972_0454631 | Ga0466972_0454631_123_557 | 144 |
| 282 | 3300044694 | Ga0466963_0226218 | Ga0466963_0226218_193_627 | 144 |
| 283 | 3300044712 | Ga0453684_2483770 | Ga0453684_2483770_54_488 | 144 |
| 284 | 3300044765 | Ga0466970_0305486 | Ga0466970_0305486_423_857 | 144 |
| 285 | 3300045976 | Ga0466967_1272667 | Ga0466967_1272667_244_678 | 144 |
| 286 | 3300046525 | Ga0495663_0028103 | Ga0495663_0028103_868_1302 | 144 |
| 287 | 3300046684 | Ga0495669_0007692 | Ga0495669_0007692_2122_2556 | 144 |
| 288 | 3300046684 | Ga0495669_0179034 | Ga0495669_0179034_84_518 | 144 |
| 289 | 3300047447 | Ga0495685_269867 | Ga0495685_269867_62_496 | 144 |
| 290 | 3300048906 | Ga0496103_0273516 | Ga0496103_0273516_402_836 | 144 |
| 291 | 3300048911 | Ga0496108_0066160 | Ga0496108_0066160_1393_1827 | 144 |
| 292 | 3300048912 | Ga0496109_0152167 | Ga0496109_0152167_305_739 | 144 |
| 293 | 3300048913 | Ga0496110_0001847 | Ga0496110_0001847_9625_10059 | 144 |
| 294 | 3300048914 | Ga0496111_0007597 | Ga0496111_0007597_3555_3989 | 144 |
| 295 | 3300048915 | Ga0496112_0673596 | Ga0496112_0673596_53_490 | 144 |
| 296 | 3300048915 | Ga0496112_1091825 | Ga0496112_1091825_151_585 | 144 |
| 297 | 3300049664 | Ga0501224_035867 | Ga0501224_035867_154_588 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6n9a-assembly1.cif.gz_E-2 | crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp | 0.8996 | 1 | 140 |
| 5np9-assembly1.cif.gz_A | crystal structure of bacillus subtilis ydib in complex with adp | 0.8982 | 1 | 140 |
| 5mvr-assembly1.cif.gz_A | crystal structure of bacillus subtilus ydib | 0.8726 | 1 | 140 |
| 1fl9-assembly3.cif.gz_C | the yjee protein | 0.8724 | 1 | 140 |
| 6n9a-assembly1.cif.gz_E-2 | crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp | 0.8705 | 1 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWK9_1_139_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8965 | 10 | 140 | 3.40.50.300 |
| af_P9WFS7_20_166_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8693 | 1 | 132 | 3.40.50.300 |
| af_P0AF67_2_153_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8516 | 1 | 140 | 3.40.50.300 |
| af_Q2FWK9_1_139_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8425 | 10 | 140 | 3.40.50.300 |
| af_P0AF67_2_153_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8246 | 1 | 140 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P6FSB6-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9734 | 1 | 141 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A2E5PAK7-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9564 | 1 | 132 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A3M1FVU2-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9552 | 1 | 140 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A2E3XDK5-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9525 | 1 | 140 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A2A5C5B1-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9515 | 1 | 140 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar