F393712

General Info

Members Datasets Scaffolds Average Seq Length
297 156 297 143

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10403922|Ga0157380_104039222
Length 145
Sequence MRIKHEKAMLDFGRKLADALRPGDVVTLSGPLSAGKTTMVRGVLSGLGHRGDVPSPSFAIVQPYEDLNPPVWHVDLYRIDDPSDLEELGLDDVGAEGVMLVEWPEHAGRRVWPRALALSLEVLDDGARALTAEVPAAWEGRWPLR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
133 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
134 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
135 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
136 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
137 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.37
Rhizosphere 96.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4198986 2162886012 Unclassified 1205
2 JGI24739J22299_10201205 3300001989 Bacteria 584
3 JGI24737J22298_10018178 3300001990 Bacteria 2257
4 JGI24748J21848_1014016 3300002074 Bacteria 951
5 JGI24738J21930_10055740 3300002075 Bacteria 808
6 JGI24034J26672_10007446 3300002239 Bacteria 1589
7 Ga0065712_10092230 3300005290 Bacteria 2319
8 Ga0065712_10156391 3300005290 Bacteria 1332
9 Ga0065715_10095287 3300005293 Bacteria 4120
10 Ga0070658_10001337 3300005327 Bacteria 21022
11 Ga0070658_10040529 3300005327 Bacteria 3757
12 Ga0070658_10060590 3300005327 Bacteria 3082
13 Ga0070658_10070482 3300005327 Bacteria 2862
14 Ga0070658_10109119 3300005327 Bacteria 2291
15 Ga0070658_10355601 3300005327 Bacteria 1254
16 Ga0070676_10031920 3300005328 Bacteria 3014
17 Ga0070676_10181991 3300005328 Bacteria 1367
18 Ga0070683_100788433 3300005329 Bacteria 911
19 Ga0070670_100003505 3300005331 Bacteria 13041
20 Ga0070670_100009058 3300005331 Bacteria 8503
21 Ga0070677_10024315 3300005333 Bacteria 2251
22 Ga0070677_10064312 3300005333 Bacteria 1523
23 Ga0070677_10074495 3300005333 Bacteria 1436
24 Ga0070666_10001385 3300005335 Bacteria 14676
25 Ga0070666_10032812 3300005335 Bacteria 3432
26 Ga0070680_100078128 3300005336 Bacteria 2726
27 Ga0070680_100441782 3300005336 Bacteria 1111
28 Ga0070682_100823534 3300005337 Bacteria 756
29 Ga0068868_100011653 3300005338 Bacteria 6406
30 Ga0068868_101793141 3300005338 Bacteria 580
31 Ga0070660_100019858 3300005339 Bacteria 4930
32 Ga0070660_100029673 3300005339 Bacteria 4101
33 Ga0070660_100050039 3300005339 Bacteria 3215
34 Ga0070660_100167242 3300005339 Bacteria 1774
35 Ga0070660_100335855 3300005339 Unclassified 1243
36 Ga0070660_101121531 3300005339 Bacteria 666
37 Ga0070689_100135775 3300005340 Bacteria 1975
38 Ga0070661_100004741 3300005344 Bacteria 9351
39 Ga0070661_100018491 3300005344 Bacteria 4954
40 Ga0070661_100204582 3300005344 Bacteria 1509
41 Ga0070692_10065419 3300005345 Bacteria 1925
42 Ga0070668_100191998 3300005347 Bacteria 1673
43 Ga0070669_100485835 3300005353 Bacteria 1023
44 Ga0070669_100737455 3300005353 Unclassified 834
45 Ga0070675_100003804 3300005354 Bacteria 11458
46 Ga0070675_100100925 3300005354 Bacteria 2430
47 Ga0070671_100000353 3300005355 Bacteria 31530
48 Ga0070671_100032750 3300005355 Bacteria 4295
49 Ga0070674_100023037 3300005356 Bacteria 4024
50 Ga0070674_100030084 3300005356 Bacteria 3585
51 Ga0070674_100558208 3300005356 Bacteria 962
52 Ga0070673_100005436 3300005364 Bacteria 8152
53 Ga0070673_100022439 3300005364 Bacteria 4594
54 Ga0070673_100808097 3300005364 Bacteria 866
55 Ga0070659_100189580 3300005366 Bacteria 1689
56 Ga0070659_100190824 3300005366 Bacteria 1684
57 Ga0070659_100439183 3300005366 Unclassified 1105
58 Ga0070667_100001401 3300005367 Bacteria 21573
59 Ga0070667_100026194 3300005367 Bacteria 4850
60 Ga0070663_100023351 3300005455 Bacteria 4144
61 Ga0070663_100053099 3300005455 Bacteria 2892
62 Ga0070663_100090171 3300005455 Bacteria 2270
63 Ga0070678_100246820 3300005456 Bacteria 1495
64 Ga0070662_100013115 3300005457 Bacteria 5509
65 Ga0070662_100417251 3300005457 Bacteria 1110
66 Ga0070662_100922676 3300005457 Bacteria 746
67 Ga0070681_10059760 3300005458 Bacteria 3791
68 Ga0068867_100522267 3300005459 Bacteria 1024
69 Ga0070679_100689196 3300005530 Bacteria 964
70 Ga0070684_100781689 3300005535 Bacteria 892
71 Ga0068853_100050021 3300005539 Bacteria 3594
72 Ga0068853_100058701 3300005539 Bacteria 3322
73 Ga0070672_100000538 3300005543 Bacteria 22279
74 Ga0070686_100177692 3300005544 Bacteria 1510
75 Ga0070693_100109524 3300005547 Bacteria 1697
76 Ga0070665_100122518 3300005548 Bacteria 2602
77 Ga0068855_101628682 3300005563 Bacteria 660
78 Ga0070664_100004992 3300005564 Bacteria 10631
79 Ga0070664_100090018 3300005564 Bacteria 2655
80 Ga0070664_100236528 3300005564 Bacteria 1638
81 Ga0070664_100330467 3300005564 Bacteria 1383
82 Ga0068857_100088717 3300005577 Bacteria 2767
83 Ga0068854_100054750 3300005578 Bacteria 2871
84 Ga0068854_100082314 3300005578 Bacteria 2379
85 Ga0068854_100153217 3300005578 Bacteria 1779
86 Ga0068856_100176223 3300005614 Bacteria 2150
87 Ga0068852_100059667 3300005616 Bacteria 3309
88 Ga0068852_100273950 3300005616 Bacteria 1625
89 Ga0068852_100496045 3300005616 Unclassified 1215
90 Ga0068852_100639993 3300005616 Bacteria 1070
91 Ga0068864_100135615 3300005618 Bacteria 2216
92 Ga0068851_10001873 3300005834 Bacteria 9244
93 Ga0068851_10172829 3300005834 Bacteria 1193
94 Ga0068870_10163371 3300005840 Bacteria 1323
95 Ga0068858_100015942 3300005842 Bacteria 7060
96 Ga0068862_100082236 3300005844 Bacteria 2795
97 Ga0081539_10046108 3300005985 Bacteria 2500
98 Ga0105245_10416510 3300009098 Bacteria 1346
99 Ga0105243_10333624 3300009148 Bacteria 1386
100 Ga0105242_10449442 3300009176 Bacteria 1214
101 Ga0105248_10006764 3300009177 Bacteria 12572
102 Ga0105248_10009265 3300009177 Bacteria 10836
103 Ga0105238_10271642 3300009551 Bacteria 1676
104 Ga0157373_10032971 3300013100 Bacteria 3728
105 Ga0157373_10670837 3300013100 Bacteria 758
106 Ga0157371_10055490 3300013102 Bacteria 2811
107 Ga0157369_10121262 3300013105 Bacteria 2774
108 Ga0157369_10369679 3300013105 Bacteria 1488
109 Ga0157374_10368392 3300013296 Bacteria 1430
110 Ga0157378_10335798 3300013297 Bacteria 1472
111 Ga0163162_10413926 3300013306 Bacteria 1480
112 Ga0157372_11468905 3300013307 Bacteria 785
113 Ga0157375_10016734 3300013308 Bacteria 6598
114 Ga0163163_10112285 3300014325 Bacteria 2754
115 Ga0157380_10403922 3300014326 Bacteria 1297
116 Ga0157377_10417454 3300014745 Bacteria 918
117 Ga0157377_11045999 3300014745 Bacteria 621
118 Ga0157379_10041315 3300014968 Bacteria 4117
119 Ga0163161_10333830 3300017792 Unclassified 1201
120 Ga0207656_10015151 3300025321 Bacteria 2980
121 Ga0207688_10496457 3300025901 Unclassified 764
122 Ga0207680_10007009 3300025903 Bacteria 5471
123 Ga0207645_10050173 3300025907 Bacteria 2664
124 Ga0207645_10392234 3300025907 Bacteria 933
125 Ga0207643_10199633 3300025908 Bacteria 1217
126 Ga0207705_10003918 3300025909 Bacteria 11313
127 Ga0207705_10010737 3300025909 Bacteria 6649
128 Ga0207705_10053656 3300025909 Bacteria 2905
129 Ga0207705_10137025 3300025909 Bacteria 1825
130 Ga0207660_10300910 3300025917 Bacteria 1277
131 Ga0207657_10001550 3300025919 Bacteria 24636
132 Ga0207657_10121110 3300025919 Bacteria 2152
133 Ga0207657_10285685 3300025919 Unclassified 1309
134 Ga0207657_10486587 3300025919 Bacteria 967
135 Ga0207649_10006053 3300025920 Bacteria 6566
136 Ga0207649_10096328 3300025920 Bacteria 1949
137 Ga0207652_10010628 3300025921 Bacteria 7411
138 Ga0207681_10125075 3300025923 Bacteria 1892
139 Ga0207650_10006356 3300025925 Bacteria 8046
140 Ga0207650_10424925 3300025925 Bacteria 1103
141 Ga0207659_10007610 3300025926 Bacteria 6678
142 Ga0207687_10375079 3300025927 Bacteria 1164
143 Ga0207644_10007501 3300025931 Bacteria 7113
144 Ga0207644_10009854 3300025931 Bacteria 6284
145 Ga0207644_10041499 3300025931 Bacteria 3255
146 Ga0207690_10032865 3300025932 Bacteria 3332
147 Ga0207690_10119343 3300025932 Bacteria 1913
148 Ga0207706_10021265 3300025933 Bacteria 5829
149 Ga0207706_10280050 3300025933 Bacteria 1454
150 Ga0207706_10314936 3300025933 Bacteria 1362
151 Ga0207706_10645099 3300025933 Bacteria 907
152 Ga0207670_10486849 3300025936 Bacteria 1000
153 Ga0207669_10004042 3300025937 Bacteria 6420
154 Ga0207669_10017418 3300025937 Bacteria 3684
155 Ga0207669_10406733 3300025937 Bacteria 1068
156 Ga0207669_10459729 3300025937 Bacteria 1010
157 Ga0207691_10004622 3300025940 Bacteria 13332
158 Ga0207691_10037443 3300025940 Bacteria 4492
159 Ga0207691_10119868 3300025940 Bacteria 2333
160 Ga0207691_10417642 3300025940 Bacteria 1143
161 Ga0207711_10000174 3300025941 Bacteria 69263
162 Ga0207711_10019163 3300025941 Bacteria 5696
163 Ga0207711_10122755 3300025941 Bacteria 2320
164 Ga0207679_10024314 3300025945 Bacteria 4152
165 Ga0207679_10036704 3300025945 Bacteria 3477
166 Ga0207679_11082736 3300025945 Bacteria 735
167 Ga0207651_10003851 3300025960 Bacteria 7445
168 Ga0207651_10023239 3300025960 Bacteria 3808
169 Ga0207640_10833373 3300025981 Bacteria 801
170 Ga0207658_10001219 3300025986 Bacteria 20364
171 Ga0207658_10031120 3300025986 Bacteria 3786
172 Ga0207677_10023831 3300026023 Bacteria 3788
173 Ga0207703_10002959 3300026035 Bacteria 14405
174 Ga0207639_10020080 3300026041 Bacteria 4779
175 Ga0207639_10104421 3300026041 Bacteria 2297
176 Ga0207678_10005334 3300026067 Bacteria 11513
177 Ga0207678_10075139 3300026067 Bacteria 2895
178 Ga0207678_10647082 3300026067 Bacteria 928
179 Ga0207678_11117839 3300026067 Bacteria 698
180 Ga0207678_11266424 3300026067 Bacteria 653
181 Ga0207702_10292167 3300026078 Bacteria 1544
182 Ga0207702_10314968 3300026078 Bacteria 1489
183 Ga0207648_10780617 3300026089 Bacteria 888
184 Ga0207676_10035208 3300026095 Bacteria 3798
185 Ga0207674_10066872 3300026116 Bacteria 3619
186 Ga0207683_10774965 3300026121 Unclassified 890
187 Ga0207698_10011009 3300026142 Bacteria 5847
188 Ga0207698_10181618 3300026142 Bacteria 1864
189 Ga0207698_10469486 3300026142 Bacteria 1218
190 Ga0207698_10705543 3300026142 Bacteria 1004
191 Ga0209974_10010200 3300027876 Bacteria 3170
192 Ga0268266_10096171 3300028379 Bacteria 2602
193 Ga0268266_10103756 3300028379 Bacteria 2509
194 Ga0268265_10225463 3300028380 Bacteria 1643
195 Ga0316182_1400565 3300030745 Unclassified 744
196 Ga0307408_100094308 3300031548 Bacteria 2266
197 Ga0307408_100219983 3300031548 Bacteria 1549
198 Ga0307408_100769329 3300031548 Bacteria 871
199 Ga0307408_100799271 3300031548 Bacteria 856
200 Ga0307405_10230357 3300031731 Bacteria 1365
201 Ga0307413_10058946 3300031824 Bacteria 2356
202 Ga0307413_10930934 3300031824 Bacteria 740
203 Ga0307410_10001701 3300031852 Bacteria 10140
204 Ga0307410_10009159 3300031852 Bacteria 5538
205 Ga0307410_10062659 3300031852 Bacteria 2549
206 Ga0307410_10177513 3300031852 Unclassified 1610
207 Ga0307410_10260702 3300031852 Bacteria 1352
208 Ga0307410_10802851 3300031852 Bacteria 800
209 Ga0307406_10034169 3300031901 Bacteria 3118
210 Ga0307406_10038064 3300031901 Bacteria 2976
211 Ga0307406_10162973 3300031901 Bacteria 1605
212 Ga0307406_10257422 3300031901 Bacteria 1318
213 Ga0307406_11288212 3300031901 Bacteria 637
214 Ga0307407_10023002 3300031903 Bacteria 3245
215 Ga0307407_10069387 3300031903 Bacteria 2092
216 Ga0307407_10176240 3300031903 Bacteria 1413
217 Ga0307412_10247195 3300031911 Bacteria 1383
218 Ga0307412_10405812 3300031911 Bacteria 1111
219 Ga0307412_10555096 3300031911 Bacteria 965
220 Ga0307412_10910336 3300031911 Bacteria 771
221 Ga0307409_100001844 3300031995 Bacteria 10778
222 Ga0307409_100005127 3300031995 Bacteria 7481
223 Ga0307409_100294538 3300031995 Bacteria 1506
224 Ga0307409_100397002 3300031995 Bacteria 1316
225 Ga0307409_100573464 3300031995 Unclassified 1111
226 Ga0307409_100843475 3300031995 Unclassified 927
227 Ga0307416_100002847 3300032002 Bacteria 10065
228 Ga0307416_100040533 3300032002 Bacteria 3619
229 Ga0307416_100072944 3300032002 Bacteria 2860
230 Ga0307416_100205161 3300032002 Bacteria 1874
231 Ga0307416_100362367 3300032002 Bacteria 1472
232 Ga0307414_10039415 3300032004 Bacteria 3182
233 Ga0307414_10100971 3300032004 Bacteria 2171
234 Ga0307414_10124962 3300032004 Bacteria 1985
235 Ga0307414_10339610 3300032004 Bacteria 1285
236 Ga0307411_10000654 3300032005 Bacteria 12618
237 Ga0307411_10179715 3300032005 Bacteria 1605
238 Ga0307411_10200983 3300032005 Bacteria 1530
239 Ga0307415_100008310 3300032126 Bacteria 5746
240 Ga0307415_100049793 3300032126 Bacteria 2835
241 Ga0307415_100548605 3300032126 Bacteria 1020
242 Ga0373961_0201083 3300035241 Bacteria 703
243 Ga0395899_0094270 3300037312 Bacteria 2166
244 Ga0395899_0381864 3300037312 Bacteria 936
245 Ga0395899_0610964 3300037312 Bacteria 693
246 Ga0395900_0003785 3300037418 Bacteria 16206
247 Ga0395900_0014103 3300037418 Bacteria 8159
248 Ga0395900_0109457 3300037418 Bacteria 2838
249 Ga0395900_0137784 3300037418 Bacteria 2500
250 Ga0395900_0335701 3300037418 Bacteria 1488
251 Ga0395898_0025741 3300037466 Bacteria 5926
252 Ga0395898_0799725 3300037466 Bacteria 883
253 Ga0395905_0002749 3300037471 Bacteria 19259
254 Ga0395905_0021179 3300037471 Bacteria 6153
255 Ga0395905_0306282 3300037471 Bacteria 1477
256 Ga0395905_0306450 3300037471 Bacteria 1476
257 Ga0395905_0326466 3300037471 Bacteria 1424
258 Ga0395901_0006263 3300038443 Bacteria 12059
259 Ga0395901_0032296 3300038443 Bacteria 5402
260 Ga0395901_0097068 3300038443 Bacteria 3088
261 Ga0395901_0177642 3300038443 Bacteria 2233
262 Ga0395901_1502559 3300038443 Bacteria 629
263 Ga0439433_0143798 3300041999 Unclassified 611
264 Ga0439432_084763 3300042006 Unclassified 957
265 Ga0439432_174926 3300042006 Bacteria 626
266 Ga0439449_0042402 3300042007 Bacteria 1690
267 Ga0439449_0062132 3300042007 Bacteria 1378
268 Ga0450912_000350 3300042116 Bacteria 2164
269 Ga0450914_001107 3300042118 Bacteria 1584
270 Ga0450920_029682 3300042122 Bacteria 1074
271 Ga0450898_042503 3300042134 Bacteria 863
272 Ga0450900_041739 3300042136 Bacteria 688
273 Ga0450907_078785 3300042146 Bacteria 572
274 Ga0439464_0025438 3300042439 Bacteria 1639
275 Ga0451577_0759603 3300042876 Bacteria 877
276 Ga0466972_0190504 3300044658 Bacteria 961
277 Ga0466972_0454631 3300044658 Bacteria 602
278 Ga0466963_0226218 3300044694 Bacteria 1310
279 Ga0453684_2483770 3300044712 Bacteria 512
280 Ga0466970_0305486 3300044765 Unclassified 898
281 Ga0466967_1272667 3300045976 Unclassified 733
282 Ga0495663_0028103 3300046525 Bacteria 1654
283 Ga0495597_0101217 3300046542 Bacteria 1215
284 Ga0495669_0007692 3300046684 Bacteria 4522
285 Ga0495669_0179034 3300046684 Bacteria 1010
286 Ga0495685_269867 3300047447 Unclassified 537
287 Ga0496102_1836811 3300048905 Bacteria 523
288 Ga0496103_0273516 3300048906 Bacteria 1087
289 Ga0496108_0066160 3300048911 Bacteria 3048
290 Ga0496108_1100966 3300048911 Bacteria 675
291 Ga0496109_0152167 3300048912 Bacteria 2166
292 Ga0496110_0001847 3300048913 Bacteria 15627
293 Ga0496110_0125913 3300048913 Bacteria 2312
294 Ga0496111_0007597 3300048914 Bacteria 7119
295 Ga0496112_0673596 3300048915 Bacteria 963
296 Ga0496112_1091825 3300048915 Unclassified 716
297 Ga0501224_035867 3300049664 Unclassified 745

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0101217 Ga0495597_0101217_40_396 117
2 3300048905 Ga0496102_1836811 Ga0496102_1836811_93_446 117
3 3300048911 Ga0496108_1100966 Ga0496108_1100966_279_632 117
4 3300048913 Ga0496110_0125913 Ga0496110_0125913_1630_1983 117
5 3300025936 Ga0207670_10486849 Ga0207670_104868491 131
6 3300037312 Ga0395899_0381864 Ga0395899_0381864_142_543 133
7 3300037418 Ga0395900_0109457 Ga0395900_0109457_1472_1873 133
8 3300037466 Ga0395898_0799725 Ga0395898_0799725_378_779 133
9 3300038443 Ga0395901_0006263 Ga0395901_0006263_7922_8323 133
10 3300005355 Ga0070671_100032750 Ga0070671_1000327503 136
11 3300025931 Ga0207644_10009854 Ga0207644_100098544 136
12 3300005364 Ga0070673_100808097 Ga0070673_1008080972 137
13 3300005347 Ga0070668_100191998 Ga0070668_1001919983 138
14 3300005331 Ga0070670_100009058 Ga0070670_1000090582 143
15 3300005333 Ga0070677_10064312 Ga0070677_100643122 143
16 3300005339 Ga0070660_100335855 Ga0070660_1003358552 143
17 3300025919 Ga0207657_10285685 Ga0207657_102856852 143
18 3300025933 Ga0207706_10280050 Ga0207706_102800502 143
19 3300025940 Ga0207691_10037443 Ga0207691_100374433 143
20 3300025940 Ga0207691_10119868 Ga0207691_101198682 143
21 3300025941 Ga0207711_10122755 Ga0207711_101227552 143
22 3300026121 Ga0207683_10774965 Ga0207683_107749652 143
23 3300031901 Ga0307406_11288212 Ga0307406_112882122 143
24 3300042439 Ga0439464_0025438 Ga0439464_0025438_502_936 143
25 2162886012 MBSR1b_contig_4198986 MBSR1b_0263.00004940 144
26 3300001989 JGI24739J22299_10201205 JGI24739J22299_102012052 144
27 3300001990 JGI24737J22298_10018178 JGI24737J22298_100181782 144
28 3300002074 JGI24748J21848_1014016 JGI24748J21848_10140162 144
29 3300002075 JGI24738J21930_10055740 JGI24738J21930_100557401 144
30 3300002239 JGI24034J26672_10007446 JGI24034J26672_100074463 144
31 3300005290 Ga0065712_10092230 Ga0065712_100922302 144
32 3300005290 Ga0065712_10156391 Ga0065712_101563912 144
33 3300005293 Ga0065715_10095287 Ga0065715_100952872 144
34 3300005327 Ga0070658_10001337 Ga0070658_1000133714 144
35 3300005327 Ga0070658_10040529 Ga0070658_100405294 144
36 3300005327 Ga0070658_10060590 Ga0070658_100605903 144
37 3300005327 Ga0070658_10070482 Ga0070658_100704822 144
38 3300005327 Ga0070658_10109119 Ga0070658_101091192 144
39 3300005327 Ga0070658_10355601 Ga0070658_103556012 144
40 3300005328 Ga0070676_10031920 Ga0070676_100319202 144
41 3300005328 Ga0070676_10181991 Ga0070676_101819912 144
42 3300005329 Ga0070683_100788433 Ga0070683_1007884332 144
43 3300005331 Ga0070670_100003505 Ga0070670_1000035056 144
44 3300005333 Ga0070677_10024315 Ga0070677_100243152 144
45 3300005333 Ga0070677_10074495 Ga0070677_100744952 144
46 3300005335 Ga0070666_10001385 Ga0070666_100013858 144
47 3300005335 Ga0070666_10032812 Ga0070666_100328123 144
48 3300005336 Ga0070680_100078128 Ga0070680_1000781283 144
49 3300005336 Ga0070680_100441782 Ga0070680_1004417822 144
50 3300005337 Ga0070682_100823534 Ga0070682_1008235342 144
51 3300005338 Ga0068868_100011653 Ga0068868_1000116532 144
52 3300005338 Ga0068868_101793141 Ga0068868_1017931411 144
53 3300005339 Ga0070660_100019858 Ga0070660_1000198584 144
54 3300005339 Ga0070660_100029673 Ga0070660_1000296733 144
55 3300005339 Ga0070660_100050039 Ga0070660_1000500393 144
56 3300005339 Ga0070660_100167242 Ga0070660_1001672422 144
57 3300005339 Ga0070660_101121531 Ga0070660_1011215311 144
58 3300005340 Ga0070689_100135775 Ga0070689_1001357752 144
59 3300005344 Ga0070661_100004741 Ga0070661_1000047414 144
60 3300005344 Ga0070661_100018491 Ga0070661_1000184912 144
61 3300005344 Ga0070661_100204582 Ga0070661_1002045822 144
62 3300005345 Ga0070692_10065419 Ga0070692_100654192 144
63 3300005353 Ga0070669_100485835 Ga0070669_1004858352 144
64 3300005353 Ga0070669_100737455 Ga0070669_1007374552 144
65 3300005354 Ga0070675_100003804 Ga0070675_1000038046 144
66 3300005354 Ga0070675_100100925 Ga0070675_1001009252 144
67 3300005355 Ga0070671_100000353 Ga0070671_10000035313 144
68 3300005356 Ga0070674_100023037 Ga0070674_1000230374 144
69 3300005356 Ga0070674_100030084 Ga0070674_1000300844 144
70 3300005356 Ga0070674_100558208 Ga0070674_1005582082 144
71 3300005364 Ga0070673_100005436 Ga0070673_1000054366 144
72 3300005364 Ga0070673_100022439 Ga0070673_1000224394 144
73 3300005366 Ga0070659_100189580 Ga0070659_1001895802 144
74 3300005366 Ga0070659_100190824 Ga0070659_1001908242 144
75 3300005366 Ga0070659_100439183 Ga0070659_1004391831 144
76 3300005367 Ga0070667_100001401 Ga0070667_1000014018 144
77 3300005367 Ga0070667_100026194 Ga0070667_1000261944 144
78 3300005455 Ga0070663_100023351 Ga0070663_1000233513 144
79 3300005455 Ga0070663_100053099 Ga0070663_1000530994 144
80 3300005455 Ga0070663_100090171 Ga0070663_1000901712 144
81 3300005456 Ga0070678_100246820 Ga0070678_1002468202 144
82 3300005457 Ga0070662_100013115 Ga0070662_1000131153 144
83 3300005457 Ga0070662_100417251 Ga0070662_1004172512 144
84 3300005457 Ga0070662_100922676 Ga0070662_1009226761 144
85 3300005458 Ga0070681_10059760 Ga0070681_100597603 144
86 3300005459 Ga0068867_100522267 Ga0068867_1005222671 144
87 3300005530 Ga0070679_100689196 Ga0070679_1006891962 144
88 3300005535 Ga0070684_100781689 Ga0070684_1007816892 144
89 3300005539 Ga0068853_100050021 Ga0068853_1000500213 144
90 3300005539 Ga0068853_100058701 Ga0068853_1000587013 144
91 3300005543 Ga0070672_100000538 Ga0070672_10000053814 144
92 3300005544 Ga0070686_100177692 Ga0070686_1001776922 144
93 3300005547 Ga0070693_100109524 Ga0070693_1001095243 144
94 3300005548 Ga0070665_100122518 Ga0070665_1001225181 144
95 3300005563 Ga0068855_101628682 Ga0068855_1016286822 144
96 3300005564 Ga0070664_100004992 Ga0070664_1000049923 144
97 3300005564 Ga0070664_100090018 Ga0070664_1000900182 144
98 3300005564 Ga0070664_100236528 Ga0070664_1002365282 144
99 3300005564 Ga0070664_100330467 Ga0070664_1003304672 144
100 3300005577 Ga0068857_100088717 Ga0068857_1000887172 144
101 3300005578 Ga0068854_100054750 Ga0068854_1000547502 144
102 3300005578 Ga0068854_100082314 Ga0068854_1000823142 144
103 3300005578 Ga0068854_100153217 Ga0068854_1001532172 144
104 3300005614 Ga0068856_100176223 Ga0068856_1001762232 144
105 3300005616 Ga0068852_100059667 Ga0068852_1000596672 144
106 3300005616 Ga0068852_100273950 Ga0068852_1002739503 144
107 3300005616 Ga0068852_100496045 Ga0068852_1004960451 144
108 3300005616 Ga0068852_100639993 Ga0068852_1006399932 144
109 3300005618 Ga0068864_100135615 Ga0068864_1001356152 144
110 3300005834 Ga0068851_10001873 Ga0068851_100018734 144
111 3300005834 Ga0068851_10172829 Ga0068851_101728292 144
112 3300005840 Ga0068870_10163371 Ga0068870_101633712 144
113 3300005842 Ga0068858_100015942 Ga0068858_1000159422 144
114 3300005844 Ga0068862_100082236 Ga0068862_1000822363 144
115 3300005985 Ga0081539_10046108 Ga0081539_100461083 144
116 3300009098 Ga0105245_10416510 Ga0105245_104165102 144
117 3300009148 Ga0105243_10333624 Ga0105243_103336242 144
118 3300009176 Ga0105242_10449442 Ga0105242_104494422 144
119 3300009177 Ga0105248_10006764 Ga0105248_100067646 144
120 3300009177 Ga0105248_10009265 Ga0105248_100092657 144
121 3300009551 Ga0105238_10271642 Ga0105238_102716423 144
122 3300013100 Ga0157373_10032971 Ga0157373_100329712 144
123 3300013100 Ga0157373_10670837 Ga0157373_106708371 144
124 3300013102 Ga0157371_10055490 Ga0157371_100554903 144
125 3300013105 Ga0157369_10121262 Ga0157369_101212622 144
126 3300013105 Ga0157369_10369679 Ga0157369_103696792 144
127 3300013296 Ga0157374_10368392 Ga0157374_103683922 144
128 3300013297 Ga0157378_10335798 Ga0157378_103357982 144
129 3300013306 Ga0163162_10413926 Ga0163162_104139262 144
130 3300013307 Ga0157372_11468905 Ga0157372_114689052 144
131 3300013308 Ga0157375_10016734 Ga0157375_100167343 144
132 3300014325 Ga0163163_10112285 Ga0163163_101122852 144
133 3300014326 Ga0157380_10403922 Ga0157380_104039222 144
134 3300014745 Ga0157377_10417454 Ga0157377_104174542 144
135 3300014745 Ga0157377_11045999 Ga0157377_110459992 144
136 3300014968 Ga0157379_10041315 Ga0157379_100413152 144
137 3300017792 Ga0163161_10333830 Ga0163161_103338302 144
138 3300025321 Ga0207656_10015151 Ga0207656_100151512 144
139 3300025901 Ga0207688_10496457 Ga0207688_104964572 144
140 3300025903 Ga0207680_10007009 Ga0207680_100070093 144
141 3300025907 Ga0207645_10050173 Ga0207645_100501732 144
142 3300025907 Ga0207645_10392234 Ga0207645_103922342 144
143 3300025908 Ga0207643_10199633 Ga0207643_101996332 144
144 3300025909 Ga0207705_10003918 Ga0207705_100039182 144
145 3300025909 Ga0207705_10010737 Ga0207705_100107373 144
146 3300025909 Ga0207705_10053656 Ga0207705_100536562 144
147 3300025909 Ga0207705_10137025 Ga0207705_101370252 144
148 3300025917 Ga0207660_10300910 Ga0207660_103009102 144
149 3300025919 Ga0207657_10001550 Ga0207657_100015503 144
150 3300025919 Ga0207657_10121110 Ga0207657_101211102 144
151 3300025919 Ga0207657_10486587 Ga0207657_104865872 144
152 3300025920 Ga0207649_10006053 Ga0207649_100060534 144
153 3300025920 Ga0207649_10096328 Ga0207649_100963282 144
154 3300025921 Ga0207652_10010628 Ga0207652_100106284 144
155 3300025923 Ga0207681_10125075 Ga0207681_101250752 144
156 3300025925 Ga0207650_10006356 Ga0207650_100063563 144
157 3300025925 Ga0207650_10424925 Ga0207650_104249252 144
158 3300025926 Ga0207659_10007610 Ga0207659_100076103 144
159 3300025927 Ga0207687_10375079 Ga0207687_103750792 144
160 3300025931 Ga0207644_10007501 Ga0207644_100075013 144
161 3300025931 Ga0207644_10041499 Ga0207644_100414992 144
162 3300025932 Ga0207690_10032865 Ga0207690_100328651 144
163 3300025932 Ga0207690_10119343 Ga0207690_101193432 144
164 3300025933 Ga0207706_10021265 Ga0207706_100212653 144
165 3300025933 Ga0207706_10314936 Ga0207706_103149362 144
166 3300025933 Ga0207706_10645099 Ga0207706_106450992 144
167 3300025937 Ga0207669_10004042 Ga0207669_100040426 144
168 3300025937 Ga0207669_10017418 Ga0207669_100174182 144
169 3300025937 Ga0207669_10406733 Ga0207669_104067332 144
170 3300025937 Ga0207669_10459729 Ga0207669_104597292 144
171 3300025940 Ga0207691_10004622 Ga0207691_100046226 144
172 3300025940 Ga0207691_10417642 Ga0207691_104176422 144
173 3300025941 Ga0207711_10000174 Ga0207711_1000017448 144
174 3300025941 Ga0207711_10019163 Ga0207711_100191633 144
175 3300025945 Ga0207679_10024314 Ga0207679_100243142 144
176 3300025945 Ga0207679_10036704 Ga0207679_100367042 144
177 3300025945 Ga0207679_11082736 Ga0207679_110827362 144
178 3300025960 Ga0207651_10003851 Ga0207651_100038514 144
179 3300025960 Ga0207651_10023239 Ga0207651_100232394 144
180 3300025981 Ga0207640_10833373 Ga0207640_108333732 144
181 3300025986 Ga0207658_10001219 Ga0207658_100012196 144
182 3300025986 Ga0207658_10031120 Ga0207658_100311203 144
183 3300026023 Ga0207677_10023831 Ga0207677_100238314 144
184 3300026035 Ga0207703_10002959 Ga0207703_100029596 144
185 3300026041 Ga0207639_10020080 Ga0207639_100200803 144
186 3300026041 Ga0207639_10104421 Ga0207639_101044212 144
187 3300026067 Ga0207678_10005334 Ga0207678_100053346 144
188 3300026067 Ga0207678_10075139 Ga0207678_100751394 144
189 3300026067 Ga0207678_10647082 Ga0207678_106470822 144
190 3300026067 Ga0207678_11117839 Ga0207678_111178392 144
191 3300026067 Ga0207678_11266424 Ga0207678_112664242 144
192 3300026078 Ga0207702_10292167 Ga0207702_102921672 144
193 3300026078 Ga0207702_10314968 Ga0207702_103149682 144
194 3300026089 Ga0207648_10780617 Ga0207648_107806172 144
195 3300026095 Ga0207676_10035208 Ga0207676_100352084 144
196 3300026116 Ga0207674_10066872 Ga0207674_100668724 144
197 3300026142 Ga0207698_10011009 Ga0207698_100110092 144
198 3300026142 Ga0207698_10181618 Ga0207698_101816182 144
199 3300026142 Ga0207698_10469486 Ga0207698_104694862 144
200 3300026142 Ga0207698_10705543 Ga0207698_107055432 144
201 3300027876 Ga0209974_10010200 Ga0209974_100102002 144
202 3300028379 Ga0268266_10096171 Ga0268266_100961712 144
203 3300028379 Ga0268266_10103756 Ga0268266_101037563 144
204 3300028380 Ga0268265_10225463 Ga0268265_102254632 144
205 3300030745 Ga0316182_1400565 Ga0316182_14005652 144
206 3300031548 Ga0307408_100094308 Ga0307408_1000943082 144
207 3300031548 Ga0307408_100219983 Ga0307408_1002199832 144
208 3300031548 Ga0307408_100769329 Ga0307408_1007693292 144
209 3300031548 Ga0307408_100799271 Ga0307408_1007992712 144
210 3300031731 Ga0307405_10230357 Ga0307405_102303572 144
211 3300031824 Ga0307413_10058946 Ga0307413_100589462 144
212 3300031824 Ga0307413_10930934 Ga0307413_109309342 144
213 3300031852 Ga0307410_10001701 Ga0307410_100017013 144
214 3300031852 Ga0307410_10009159 Ga0307410_100091594 144
215 3300031852 Ga0307410_10062659 Ga0307410_100626592 144
216 3300031852 Ga0307410_10177513 Ga0307410_101775132 144
217 3300031852 Ga0307410_10260702 Ga0307410_102607022 144
218 3300031852 Ga0307410_10802851 Ga0307410_108028512 144
219 3300031901 Ga0307406_10034169 Ga0307406_100341693 144
220 3300031901 Ga0307406_10038064 Ga0307406_100380644 144
221 3300031901 Ga0307406_10162973 Ga0307406_101629732 144
222 3300031901 Ga0307406_10257422 Ga0307406_102574222 144
223 3300031903 Ga0307407_10023002 Ga0307407_100230022 144
224 3300031903 Ga0307407_10069387 Ga0307407_100693872 144
225 3300031903 Ga0307407_10176240 Ga0307407_101762402 144
226 3300031911 Ga0307412_10247195 Ga0307412_102471952 144
227 3300031911 Ga0307412_10405812 Ga0307412_104058122 144
228 3300031911 Ga0307412_10555096 Ga0307412_105550962 144
229 3300031911 Ga0307412_10910336 Ga0307412_109103362 144
230 3300031995 Ga0307409_100001844 Ga0307409_1000018446 144
231 3300031995 Ga0307409_100005127 Ga0307409_1000051276 144
232 3300031995 Ga0307409_100294538 Ga0307409_1002945382 144
233 3300031995 Ga0307409_100397002 Ga0307409_1003970022 144
234 3300031995 Ga0307409_100573464 Ga0307409_1005734641 144
235 3300031995 Ga0307409_100843475 Ga0307409_1008434751 144
236 3300032002 Ga0307416_100002847 Ga0307416_1000028473 144
237 3300032002 Ga0307416_100040533 Ga0307416_1000405332 144
238 3300032002 Ga0307416_100072944 Ga0307416_1000729442 144
239 3300032002 Ga0307416_100205161 Ga0307416_1002051612 144
240 3300032002 Ga0307416_100362367 Ga0307416_1003623672 144
241 3300032004 Ga0307414_10039415 Ga0307414_100394154 144
242 3300032004 Ga0307414_10100971 Ga0307414_101009712 144
243 3300032004 Ga0307414_10124962 Ga0307414_101249622 144
244 3300032004 Ga0307414_10339610 Ga0307414_103396102 144
245 3300032005 Ga0307411_10000654 Ga0307411_100006546 144
246 3300032005 Ga0307411_10179715 Ga0307411_101797152 144
247 3300032005 Ga0307411_10200983 Ga0307411_102009832 144
248 3300032126 Ga0307415_100008310 Ga0307415_1000083105 144
249 3300032126 Ga0307415_100049793 Ga0307415_1000497934 144
250 3300032126 Ga0307415_100548605 Ga0307415_1005486052 144
251 3300035241 Ga0373961_0201083 Ga0373961_0201083_137_571 144
252 3300037312 Ga0395899_0094270 Ga0395899_0094270_628_1062 144
253 3300037312 Ga0395899_0610964 Ga0395899_0610964_158_592 144
254 3300037418 Ga0395900_0003785 Ga0395900_0003785_1157_1591 144
255 3300037418 Ga0395900_0014103 Ga0395900_0014103_1557_1991 144
256 3300037418 Ga0395900_0137784 Ga0395900_0137784_1075_1509 144
257 3300037418 Ga0395900_0335701 Ga0395900_0335701_1013_1447 144
258 3300037466 Ga0395898_0025741 Ga0395898_0025741_4489_4923 144
259 3300037471 Ga0395905_0002749 Ga0395905_0002749_10699_11133 144
260 3300037471 Ga0395905_0021179 Ga0395905_0021179_279_713 144
261 3300037471 Ga0395905_0306282 Ga0395905_0306282_376_810 144
262 3300037471 Ga0395905_0306450 Ga0395905_0306450_784_1218 144
263 3300037471 Ga0395905_0326466 Ga0395905_0326466_866_1300 144
264 3300038443 Ga0395901_0032296 Ga0395901_0032296_2905_3339 144
265 3300038443 Ga0395901_0097068 Ga0395901_0097068_1166_1600 144
266 3300038443 Ga0395901_0177642 Ga0395901_0177642_111_545 144
267 3300038443 Ga0395901_1502559 Ga0395901_1502559_134_568 144
268 3300041999 Ga0439433_0143798 Ga0439433_0143798_24_458 144
269 3300042006 Ga0439432_084763 Ga0439432_084763_357_791 144
270 3300042006 Ga0439432_174926 Ga0439432_174926_123_557 144
271 3300042007 Ga0439449_0042402 Ga0439449_0042402_852_1286 144
272 3300042007 Ga0439449_0062132 Ga0439449_0062132_485_919 144
273 3300042116 Ga0450912_000350 Ga0450912_000350_217_651 144
274 3300042118 Ga0450914_001107 Ga0450914_001107_968_1402 144
275 3300042122 Ga0450920_029682 Ga0450920_029682_93_527 144
276 3300042134 Ga0450898_042503 Ga0450898_042503_240_674 144
277 3300042136 Ga0450900_041739 Ga0450900_041739_214_648 144
278 3300042146 Ga0450907_078785 Ga0450907_078785_119_553 144
279 3300042876 Ga0451577_0759603 Ga0451577_0759603_139_573 144
280 3300044658 Ga0466972_0190504 Ga0466972_0190504_291_725 144
281 3300044658 Ga0466972_0454631 Ga0466972_0454631_123_557 144
282 3300044694 Ga0466963_0226218 Ga0466963_0226218_193_627 144
283 3300044712 Ga0453684_2483770 Ga0453684_2483770_54_488 144
284 3300044765 Ga0466970_0305486 Ga0466970_0305486_423_857 144
285 3300045976 Ga0466967_1272667 Ga0466967_1272667_244_678 144
286 3300046525 Ga0495663_0028103 Ga0495663_0028103_868_1302 144
287 3300046684 Ga0495669_0007692 Ga0495669_0007692_2122_2556 144
288 3300046684 Ga0495669_0179034 Ga0495669_0179034_84_518 144
289 3300047447 Ga0495685_269867 Ga0495685_269867_62_496 144
290 3300048906 Ga0496103_0273516 Ga0496103_0273516_402_836 144
291 3300048911 Ga0496108_0066160 Ga0496108_0066160_1393_1827 144
292 3300048912 Ga0496109_0152167 Ga0496109_0152167_305_739 144
293 3300048913 Ga0496110_0001847 Ga0496110_0001847_9625_10059 144
294 3300048914 Ga0496111_0007597 Ga0496111_0007597_3555_3989 144
295 3300048915 Ga0496112_0673596 Ga0496112_0673596_53_490 144
296 3300048915 Ga0496112_1091825 Ga0496112_1091825_151_585 144
297 3300049664 Ga0501224_035867 Ga0501224_035867_154_588 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

3

130

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n9a-assembly1.cif.gz_E-2 crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp 0.8996 1 140
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8982 1 140
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.8726 1 140
1fl9-assembly3.cif.gz_C the yjee protein 0.8724 1 140
6n9a-assembly1.cif.gz_E-2 crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp 0.8705 1 140
ID Description Score Start End Superfamily
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8965 10 140 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8693 1 132 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8516 1 140 3.40.50.300
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8425 10 140 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8246 1 140 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4P6FSB6-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9734 1 141 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A2E5PAK7-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9564 1 132 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A3M1FVU2-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9552 1 140 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A2E3XDK5-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9525 1 140 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A2A5C5B1-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9515 1 140 GO:0002949
GO:0005524
GO:0005737
GO:0016740

Feature Viewer

pLDDT pTM Quality
90.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map