F393609

General Info

Members Datasets Scaffolds Average Seq Length
297 179 595 69

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101568173|Ga0070696_1015681732
Length 74
Sequence MTTAQQHQNVSIFLNGTARQVPPGSVVDLLMFLDLDPRTVVVELNREIVRRPALESTYIKEGDEIELVHFVGGG

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
153 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
154 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
155 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
161 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
162 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
163 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
179 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.71
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 15.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_101568173 3300005546 Bacteria 565
2 rootH1_10151528 3300003316 Bacteria 2586
3 rootH1_10151528 3300003323 Bacteria 2347
4 Ga0070683_101747817 3300005329 Bacteria 598
5 Ga0070680_100037258 3300005336 Bacteria 3929
6 Ga0070680_100306983 3300005336 Bacteria 1346
7 Ga0070682_101139843 3300005337 Unclassified 655
8 Ga0070689_101536398 3300005340 Bacteria 603
9 Ga0070687_100071238 3300005343 Bacteria 1867
10 Ga0070659_100170876 3300005366 Unclassified 1780
11 Ga0070659_100587714 3300005366 Unclassified 956
12 Ga0070667_100280122 3300005367 Bacteria 1497
13 Ga0070667_101223162 3300005367 Bacteria 703
14 Ga0070713_100984341 3300005436 Unclassified 813
15 Ga0070705_100214066 3300005440 Bacteria 1330
16 Ga0070705_100408806 3300005440 Bacteria 1007
17 Ga0070700_101745173 3300005441 Unclassified 535
18 Ga0070694_100039570 3300005444 Bacteria 3139
19 Ga0070694_100224975 3300005444 Bacteria 1409
20 Ga0070694_100503581 3300005444 Bacteria 964
21 Ga0070694_100820956 3300005444 Bacteria 763
22 Ga0070694_100931877 3300005444 Unclassified 718
23 Ga0070708_100569384 3300005445 Bacteria 1068
24 Ga0070708_101366572 3300005445 Unclassified 661
25 Ga0070663_100421526 3300005455 Bacteria 1095
26 Ga0070678_101398046 3300005456 Unclassified 653
27 Ga0070662_100356048 3300005457 Bacteria 1200
28 Ga0070662_101116368 3300005457 Unclassified 677
29 Ga0070681_10285822 3300005458 Bacteria 1560
30 Ga0070681_10475950 3300005458 Bacteria 1161
31 Ga0070681_10881304 3300005458 Bacteria 813
32 Ga0068867_100299445 3300005459 Bacteria 1325
33 Ga0070706_100420968 3300005467 Bacteria 1243
34 Ga0070707_100249572 3300005468 Bacteria 1727
35 Ga0070707_100431009 3300005468 Bacteria 1279
36 Ga0070707_102306180 3300005468 Unclassified 506
37 Ga0070698_100871024 3300005471 Bacteria 846
38 Ga0070698_101295131 3300005471 Bacteria 679
39 Ga0070699_100008735 3300005518 Bacteria 8779
40 Ga0070679_100198103 3300005530 Bacteria 1975
41 Ga0070679_101133416 3300005530 Bacteria 727
42 Ga0070679_101502818 3300005530 Unclassified 620
43 Ga0070679_101851332 3300005530 Unclassified 552
44 Ga0070684_100135762 3300005535 Bacteria 2222
45 Ga0068853_100553250 3300005539 Bacteria 1090
46 Ga0070695_100020802 3300005545 Bacteria 4009
47 Ga0070695_100705107 3300005545 Bacteria 801
48 Ga0070695_101237908 3300005545 Bacteria 615
49 Ga0070696_100000609 3300005546 Bacteria 22984
50 Ga0070696_100068956 3300005546 Bacteria 2484
51 Ga0070696_101644228 3300005546 Unclassified 552
52 Ga0070693_100866544 3300005547 Unclassified 674
53 Ga0070693_101000793 3300005547 Unclassified 632
54 Ga0070704_100485937 3300005549 Bacteria 1069
55 Ga0070704_101967269 3300005549 Bacteria 542
56 Ga0070664_100122139 3300005564 Bacteria 2281
57 Ga0070664_100273507 3300005564 Bacteria 1522
58 Ga0068857_100244740 3300005577 Bacteria 1643
59 Ga0068854_102004990 3300005578 Bacteria 533
60 Ga0068859_100587698 3300005617 Bacteria 1207
61 Ga0068859_101351971 3300005617 Bacteria 785
62 Ga0068863_100052860 3300005841 Bacteria 3849
63 Ga0068858_101150701 3300005842 Bacteria 762
64 Ga0068860_100581586 3300005843 Bacteria 1124
65 Ga0068862_101687078 3300005844 Bacteria 642
66 Ga0081455_10447424 3300005937 Unclassified 883
67 Ga0075432_10243433 3300006058 Unclassified 727
68 Ga0070715_10902396 3300006163 Bacteria 544
69 Ga0075428_100429302 3300006844 Bacteria 1416
70 Ga0075430_100398947 3300006846 Bacteria 1135
71 Ga0075430_100638309 3300006846 Bacteria 878
72 Ga0075431_100087228 3300006847 Bacteria 3220
73 Ga0075431_100178209 3300006847 Bacteria 2182
74 Ga0075431_100382771 3300006847 Bacteria 1411
75 Ga0075431_100383266 3300006847 Bacteria 1410
76 Ga0075433_10027108 3300006852 Bacteria 4857
77 Ga0075433_10290975 3300006852 Bacteria 1447
78 Ga0075434_100011761 3300006871 Bacteria 8267
79 Ga0075434_100091337 3300006871 Bacteria 3047
80 Ga0075434_100486435 3300006871 Bacteria 1255
81 Ga0075436_100024879 3300006914 Bacteria 4117
82 Ga0097620_100587766 3300006931 Bacteria 1207
83 Ga0097620_101352212 3300006931 Bacteria 785
84 Ga0075435_100153721 3300007076 Bacteria 1935
85 Ga0075435_101907640 3300007076 Bacteria 522
86 Ga0111539_10429564 3300009094 Bacteria 1538
87 Ga0111539_10851152 3300009094 Unclassified 1061
88 Ga0105245_11585945 3300009098 Bacteria 706
89 Ga0105245_12726742 3300009098 Bacteria 547
90 Ga0105247_10406563 3300009101 Bacteria 971
91 Ga0114129_10333348 3300009147 Bacteria 2014
92 Ga0114129_10441163 3300009147 Bacteria 1709
93 Ga0114129_11186266 3300009147 Bacteria 952
94 Ga0114129_12247044 3300009147 Unclassified 656
95 Ga0114129_12857887 3300009147 Unclassified 572
96 Ga0105243_11582519 3300009148 Unclassified 681
97 Ga0105241_11506371 3300009174 Bacteria 648
98 Ga0105242_10805604 3300009176 Bacteria 930
99 Ga0105239_13626433 3300010375 Unclassified 502
100 Ga0105246_10187787 3300011119 Bacteria 1597
101 Ga0157378_10047827 3300013297 Bacteria 3803
102 Ga0157375_12387651 3300013308 Bacteria 631
103 Ga0157377_10235375 3300014745 Bacteria 1180
104 Ga0157377_10270217 3300014745 Bacteria 1110
105 Ga0157379_10286859 3300014968 Bacteria 1498
106 Ga0163161_11955897 3300017792 Unclassified 522
107 Ga0207710_10513077 3300025900 Bacteria 623
108 Ga0207688_10091516 3300025901 Bacteria 1747
109 Ga0207707_10044056 3300025912 Bacteria 3891
110 Ga0207707_10232113 3300025912 Bacteria 1605
111 Ga0207707_10779994 3300025912 Bacteria 797
112 Ga0207660_10107772 3300025917 Bacteria 2091
113 Ga0207660_10151907 3300025917 Bacteria 1780
114 Ga0207652_10202319 3300025921 Bacteria 1787
115 Ga0207652_10291871 3300025921 Bacteria 1471
116 Ga0207652_11128949 3300025921 Bacteria 685
117 Ga0207646_10308474 3300025922 Bacteria 1430
118 Ga0207646_10471121 3300025922 Bacteria 1133
119 Ga0207646_11084626 3300025922 Bacteria 705
120 Ga0207700_10025211 3300025928 Bacteria 4127
121 Ga0207690_11559561 3300025932 Bacteria 552
122 Ga0207706_10135592 3300025933 Bacteria 2165
123 Ga0207686_11290427 3300025934 Unclassified 599
124 Ga0207704_11859412 3300025938 Unclassified 518
125 Ga0207665_10304945 3300025939 Bacteria 1191
126 Ga0207661_10596340 3300025944 Bacteria 1014
127 Ga0207679_10125870 3300025945 Bacteria 2048
128 Ga0207679_10479237 3300025945 Bacteria 1107
129 Ga0207679_12077063 3300025945 Bacteria 516
130 Ga0207640_10251730 3300025981 Unclassified 1371
131 Ga0207658_10890797 3300025986 Bacteria 810
132 Ga0207703_10715658 3300026035 Bacteria 953
133 Ga0207639_10385417 3300026041 Bacteria 1260
134 Ga0207678_10219913 3300026067 Bacteria 1626
135 Ga0207678_11048006 3300026067 Unclassified 722
136 Ga0207708_10058423 3300026075 Bacteria 2943
137 Ga0207708_10654556 3300026075 Bacteria 894
138 Ga0207708_11341387 3300026075 Bacteria 627
139 Ga0207641_10037757 3300026088 Bacteria 4036
140 Ga0207674_10545559 3300026116 Bacteria 1120
141 Ga0207675_102525300 3300026118 Unclassified 524
142 Ga0209983_1136441 3300027665 Bacteria 561
143 Ga0209971_1102763 3300027682 Unclassified 700
144 Ga0209974_10014972 3300027876 Bacteria 2576
145 Ga0209974_10084583 3300027876 Unclassified 1095
146 Ga0207428_10210336 3300027907 Bacteria 1461
147 Ga0207428_10502023 3300027907 Bacteria 881
148 Ga0268265_10540427 3300028380 Unclassified 1105
149 Ga0268265_12045045 3300028380 Bacteria 580
150 Ga0307408_100012048 3300031548 Bacteria 5724
151 Ga0307408_100032930 3300031548 Bacteria 3617
152 Ga0316575_10005962 3300031665 Bacteria 4362
153 Ga0316579_10007827 3300031691 Bacteria 4429
154 Ga0316576_10016070 3300031727 Bacteria 5045
155 Ga0316578_10145100 3300031728 Bacteria 1429
156 Ga0316578_10237003 3300031728 Bacteria 1096
157 Ga0316578_10255656 3300031728 Bacteria 1051
158 Ga0307405_10178025 3300031731 Bacteria 1524
159 Ga0307405_11438559 3300031731 Unclassified 604
160 Ga0307413_10014198 3300031824 Bacteria 4035
161 Ga0307406_10007653 3300031901 Bacteria 5999
162 Ga0307406_10186904 3300031901 Bacteria 1513
163 Ga0307412_10030351 3300031911 Bacteria 3403
164 Ga0307409_100005823 3300031995 Bacteria 7151
165 Ga0307416_100000327 3300032002 Bacteria 24584
166 Ga0307416_101214412 3300032002 Bacteria 860
167 Ga0307414_10028643 3300032004 Bacteria 3615
168 Ga0307411_10024575 3300032005 Bacteria 3593
169 Ga0307411_10446298 3300032005 Bacteria 1081
170 Ga0307411_11823123 3300032005 Bacteria 565
171 Ga0307415_100038678 3300032126 Bacteria 3146
172 Ga0307415_100103846 3300032126 Bacteria 2092
173 Ga0307415_101220186 3300032126 Unclassified 709
174 Ga0316583_10033694 3300032133 Bacteria 1819
175 Ga0373948_0211482 3300034817 Bacteria 510
176 Ga0373926_0462273 3300035083 Bacteria 504
177 Ga0373944_0261156 3300035089 Bacteria 642
178 Ga0316574_0011238 3300035398 Bacteria 5083
179 Ga0316574_0173992 3300035398 Bacteria 1386
180 Ga0316582_0083572 3300036647 Bacteria 2089
181 Ga0395899_0689154 3300037312 Bacteria 642
182 Ga0395905_0426312 3300037471 Bacteria 1223
183 Ga0395905_1236737 3300037471 Bacteria 650
184 Ga0316581_0065555 3300037588 Bacteria 1115
185 Ga0451802_1230046 3300041460 Bacteria 785
186 Ga0439446_0169677 3300042156 Bacteria 725
187 Ga0439446_0344742 3300042156 Unclassified 530
188 Ga0439435_0198163 3300042436 Bacteria 661
189 Ga0451577_0335689 3300042876 Bacteria 1371
190 Ga0451577_0640109 3300042876 Bacteria 964
191 Ga0453683_1218770 3300044673 Unclassified 504
192 Ga0453684_1361871 3300044712 Unclassified 738
193 Ga0451576_0237741 3300045051 Bacteria 1902
194 Ga0451576_1939336 3300045051 Bacteria 607
195 Ga0495630_0487896 3300046517 Unclassified 945
196 Ga0495642_0082312 3300046528 Bacteria 1357
197 Ga0495647_0429670 3300046681 Bacteria 609
198 Ga0495614_0561450 3300048089 Unclassified 546
199 Ga0496101_0458998 3300048904 Bacteria 1005
200 Ga0496101_1532180 3300048904 Bacteria 519
201 Ga0496102_0056853 3300048905 Bacteria 3570
202 Ga0496102_1319770 3300048905 Bacteria 641
203 Ga0496104_0086958 3300048907 Bacteria 2985
204 Ga0496106_0529834 3300048909 Unclassified 946
205 Ga0496106_1200553 3300048909 Unclassified 592
206 Ga0496108_0070769 3300048911 Bacteria 2944
207 Ga0496108_0217633 3300048911 Bacteria 1659
208 Ga0496109_0163461 3300048912 Bacteria 2086
209 Ga0496110_0290560 3300048913 Unclassified 1489
210 Ga0496110_0399518 3300048913 Bacteria 1253
211 Ga0496114_0035278 3300048917 Bacteria 4130
212 Ga0501290_026480 3300049513 Bacteria 815
213 Ga0501031_0041781 3300049568 Bacteria 2994
214 Ga0501031_0045063 3300049568 Bacteria 2878
215 Ga0501033_0172369 3300049570 Bacteria 1554
216 Ga0501033_0875015 3300049570 Bacteria 605
217 Ga0501036_0302880 3300049572 Bacteria 1337
218 Ga0501036_0596452 3300049572 Bacteria 916
219 Ga0501036_1292962 3300049572 Bacteria 593
220 Ga0501038_0099446 3300049574 Bacteria 2425
221 Ga0501039_0161003 3300049575 Bacteria 1764
222 Ga0501039_1125817 3300049575 Bacteria 608
223 Ga0501040_0019620 3300049576 Bacteria 4500
224 Ga0501040_0033399 3300049576 Bacteria 3486
225 Ga0501040_0596036 3300049576 Unclassified 798
226 Ga0501040_0761912 3300049576 Bacteria 700
227 Ga0501041_0034302 3300049577 Bacteria 3072
228 Ga0501041_0105060 3300049577 Bacteria 1750
229 Ga0501042_0136958 3300049578 Bacteria 1765
230 Ga0501046_0079162 3300049580 Bacteria 2541
231 Ga0501048_0093651 3300049582 Bacteria 2119
232 Ga0501048_0265751 3300049582 Bacteria 1219
233 Ga0501048_0376724 3300049582 Bacteria 1013
234 Ga0501067_0098044 3300049583 Bacteria 1628
235 Ga0501068_0812016 3300049584 Bacteria 614
236 Ga0501069_0778923 3300049585 Bacteria 579
237 Ga0501072_0825514 3300049588 Bacteria 725
238 Ga0501074_0127233 3300049590 Bacteria 1823
239 Ga0501074_0590708 3300049590 Bacteria 785
240 Ga0501075_0186016 3300049591 Bacteria 1584
241 Ga0501075_0601851 3300049591 Bacteria 838
242 Ga0501076_0037341 3300049592 Bacteria 3809
243 Ga0501076_0358108 3300049592 Bacteria 1198
244 Ga0501076_0559088 3300049592 Bacteria 943
245 Ga0501077_0003427 3300049593 Bacteria 9537
246 Ga0501077_0008009 3300049593 Bacteria 6532
247 Ga0501207_121065 3300049654 Bacteria 543
248 Ga0501209_215401 3300049656 Bacteria 594
249 Ga0501221_256013 3300049704 Bacteria 504
250 Ga0501245_034763 3300049708 Bacteria 846
251 Ga0501079_0037419 3300049741 Bacteria 3740
252 Ga0501079_0859108 3300049741 Bacteria 714
253 Ga0501079_1494769 3300049741 Bacteria 531
254 Ga0501080_0072559 3300049742 Bacteria 3203
255 Ga0501080_1364793 3300049742 Bacteria 605
256 Ga0501081_0007914 3300049743 Bacteria 6895
257 Ga0501081_0020653 3300049743 Bacteria 4391
258 Ga0501081_0270811 3300049743 Bacteria 1242
259 Ga0501081_0670903 3300049743 Unclassified 778
260 Ga0501083_0087654 3300049744 Bacteria 2058
261 Ga0501271_024496 3300049768 Bacteria 716
262 Ga0501272_036973 3300049769 Bacteria 640
263 Ga0501273_014064 3300049770 Bacteria 1027
264 Ga0501283_043684 3300049779 Bacteria 781
265 Ga0501045_0007832 3300049824 Bacteria 7432
266 Ga0501045_0061636 3300049824 Bacteria 2752
267 nmdc:mga05p37_443640_c1 3300050507 Bacteria 1504
268 nmdc:mga05p37_549623_c1 3300050507 Bacteria 1315
269 nmdc:mga05p37_880842_c1 3300050507 Bacteria 968
270 nmdc:mga09592_408368_c1 3300050508 Bacteria 1173
271 nmdc:mga06r32_115761_c1 3300050510 Bacteria 2641
272 nmdc:mga06r32_1318024_c1 3300050510 Bacteria 665
273 nmdc:mga06r32_1430450_c1 3300050510 Bacteria 633
274 nmdc:mga06r32_2803_c1 3300050510 Bacteria 15622
275 nmdc:mga08y16_556122_c1 3300050511 Unclassified 1161
276 nmdc:mga08y16_627331_c1 3300050511 Bacteria 1081
277 nmdc:mga0n895_1141992_c1 3300050512 Bacteria 755
278 nmdc:mga0n895_84555_c1 3300050512 Bacteria 3166
279 nmdc:mga0n895_874126_c1 3300050512 Bacteria 886
280 nmdc:mga0n895_907472_c1 3300050512 Bacteria 866
281 nmdc:mga0rr50_343845_c1 3300050513 Bacteria 1254
282 nmdc:mga0rr50_990323_c1 3300050513 Unclassified 716
283 nmdc:mga08x19_39552_c1 3300050514 Bacteria 2998
284 nmdc:mga08x19_877795_c1 3300050514 Bacteria 637
285 nmdc:mga0a205_32621_c1 3300050515 Bacteria 4993
286 nmdc:mga0a205_41362_c1 3300050515 Bacteria 4438
287 nmdc:mga0a205_855986_c1 3300050515 Bacteria 756
288 Ga0501084_0016494 3300054114 Bacteria 6134
289 Ga0501084_0033866 3300054114 Bacteria 4273
290 Ga0501084_0106041 3300054114 Bacteria 2361
291 Ga0590075_026302 3300059424 Bacteria 1465
292 Ga0590077_057407 3300059426 Bacteria 880
293 Ga0501082_0020342 3300060353 Bacteria 5722
294 Ga0501082_0178281 3300060353 Bacteria 1848
295 Ga0501082_0936876 3300060353 Bacteria 757
296 Ga0530510_0212540 3300061734 Bacteria 1437
297 2881647889 2881644220 Bacteria 5302661
298 3006982981 3006978542 Bacteria 5328100
299 Ga0070696_101568173
300 rootH1_10151528
301 Ga0070683_101747817
302 Ga0070680_100037258
303 Ga0070680_100306983
304 Ga0070682_101139843
305 Ga0070689_101536398
306 Ga0070687_100071238
307 Ga0070659_100170876
308 Ga0070659_100587714
309 Ga0070667_100280122
310 Ga0070667_101223162
311 Ga0070713_100984341
312 Ga0070705_100214066
313 Ga0070705_100408806
314 Ga0070700_101745173
315 Ga0070694_100039570
316 Ga0070694_100224975
317 Ga0070694_100503581
318 Ga0070694_100820956
319 Ga0070694_100931877
320 Ga0070708_100569384
321 Ga0070708_101366572
322 Ga0070663_100421526
323 Ga0070678_101398046
324 Ga0070662_100356048
325 Ga0070662_101116368
326 Ga0070681_10285822
327 Ga0070681_10475950
328 Ga0070681_10881304
329 Ga0068867_100299445
330 Ga0070706_100420968
331 Ga0070707_100249572
332 Ga0070707_100431009
333 Ga0070707_102306180
334 Ga0070698_100871024
335 Ga0070698_101295131
336 Ga0070699_100008735
337 Ga0070679_100198103
338 Ga0070679_101133416
339 Ga0070679_101502818
340 Ga0070679_101851332
341 Ga0070684_100135762
342 Ga0068853_100553250
343 Ga0070695_100020802
344 Ga0070695_100705107
345 Ga0070695_101237908
346 Ga0070696_100000609
347 Ga0070696_100068956
348 Ga0070696_101644228
349 Ga0070693_100866544
350 Ga0070693_101000793
351 Ga0070704_100485937
352 Ga0070704_101967269
353 Ga0070664_100122139
354 Ga0070664_100273507
355 Ga0068857_100244740
356 Ga0068854_102004990
357 Ga0068859_100587698
358 Ga0068859_101351971
359 Ga0068863_100052860
360 Ga0068858_101150701
361 Ga0068860_100581586
362 Ga0068862_101687078
363 Ga0081455_10447424
364 Ga0075432_10243433
365 Ga0070715_10902396
366 Ga0075428_100429302
367 Ga0075430_100398947
368 Ga0075430_100638309
369 Ga0075431_100087228
370 Ga0075431_100178209
371 Ga0075431_100382771
372 Ga0075431_100383266
373 Ga0075433_10027108
374 Ga0075433_10290975
375 Ga0075434_100011761
376 Ga0075434_100091337
377 Ga0075434_100486435
378 Ga0075436_100024879
379 Ga0097620_100587766
380 Ga0097620_101352212
381 Ga0075435_100153721
382 Ga0075435_101907640
383 Ga0111539_10429564
384 Ga0111539_10851152
385 Ga0105245_11585945
386 Ga0105245_12726742
387 Ga0105247_10406563
388 Ga0114129_10333348
389 Ga0114129_10441163
390 Ga0114129_11186266
391 Ga0114129_12247044
392 Ga0114129_12857887
393 Ga0105243_11582519
394 Ga0105241_11506371
395 Ga0105242_10805604
396 Ga0105239_13626433
397 Ga0105246_10187787
398 Ga0157378_10047827
399 Ga0157375_12387651
400 Ga0157377_10235375
401 Ga0157377_10270217
402 Ga0157379_10286859
403 Ga0163161_11955897
404 Ga0207710_10513077
405 Ga0207688_10091516
406 Ga0207707_10044056
407 Ga0207707_10232113
408 Ga0207707_10779994
409 Ga0207660_10107772
410 Ga0207660_10151907
411 Ga0207652_10202319
412 Ga0207652_10291871
413 Ga0207652_11128949
414 Ga0207646_10308474
415 Ga0207646_10471121
416 Ga0207646_11084626
417 Ga0207700_10025211
418 Ga0207690_11559561
419 Ga0207706_10135592
420 Ga0207686_11290427
421 Ga0207704_11859412
422 Ga0207665_10304945
423 Ga0207661_10596340
424 Ga0207679_10125870
425 Ga0207679_10479237
426 Ga0207679_12077063
427 Ga0207640_10251730
428 Ga0207658_10890797
429 Ga0207703_10715658
430 Ga0207639_10385417
431 Ga0207678_10219913
432 Ga0207678_11048006
433 Ga0207708_10058423
434 Ga0207708_10654556
435 Ga0207708_11341387
436 Ga0207641_10037757
437 Ga0207674_10545559
438 Ga0207675_102525300
439 Ga0209983_1136441
440 Ga0209971_1102763
441 Ga0209974_10014972
442 Ga0209974_10084583
443 Ga0207428_10210336
444 Ga0207428_10502023
445 Ga0268265_10540427
446 Ga0268265_12045045
447 Ga0307408_100012048
448 Ga0307408_100032930
449 Ga0316575_10005962
450 Ga0316579_10007827
451 Ga0316576_10016070
452 Ga0316578_10145100
453 Ga0316578_10237003
454 Ga0316578_10255656
455 Ga0307405_10178025
456 Ga0307405_11438559
457 Ga0307413_10014198
458 Ga0307406_10007653
459 Ga0307406_10186904
460 Ga0307412_10030351
461 Ga0307409_100005823
462 Ga0307416_100000327
463 Ga0307416_101214412
464 Ga0307414_10028643
465 Ga0307411_10024575
466 Ga0307411_10446298
467 Ga0307411_11823123
468 Ga0307415_100038678
469 Ga0307415_100103846
470 Ga0307415_101220186
471 Ga0316583_10033694
472 Ga0373948_0211482
473 Ga0373926_0462273
474 Ga0373944_0261156
475 Ga0316574_0011238
476 Ga0316574_0173992
477 Ga0316582_0083572
478 Ga0395899_0689154
479 Ga0395905_0426312
480 Ga0395905_1236737
481 Ga0316581_0065555
482 Ga0451802_1230046
483 Ga0439446_0169677
484 Ga0439446_0344742
485 Ga0439435_0198163
486 Ga0451577_0335689
487 Ga0451577_0640109
488 Ga0453683_1218770
489 Ga0453684_1361871
490 Ga0451576_0237741
491 Ga0451576_1939336
492 Ga0495630_0487896
493 Ga0495642_0082312
494 Ga0495647_0429670
495 Ga0495614_0561450
496 Ga0496101_0458998
497 Ga0496101_1532180
498 Ga0496102_0056853
499 Ga0496102_1319770
500 Ga0496104_0086958
501 Ga0496106_0529834
502 Ga0496106_1200553
503 Ga0496108_0070769
504 Ga0496108_0217633
505 Ga0496109_0163461
506 Ga0496110_0290560
507 Ga0496110_0399518
508 Ga0496114_0035278
509 Ga0501290_026480
510 Ga0501031_0041781
511 Ga0501031_0045063
512 Ga0501033_0172369
513 Ga0501033_0875015
514 Ga0501036_0302880
515 Ga0501036_0596452
516 Ga0501036_1292962
517 Ga0501038_0099446
518 Ga0501039_0161003
519 Ga0501039_1125817
520 Ga0501040_0019620
521 Ga0501040_0033399
522 Ga0501040_0596036
523 Ga0501040_0761912
524 Ga0501041_0034302
525 Ga0501041_0105060
526 Ga0501042_0136958
527 Ga0501046_0079162
528 Ga0501048_0093651
529 Ga0501048_0265751
530 Ga0501048_0376724
531 Ga0501067_0098044
532 Ga0501068_0812016
533 Ga0501069_0778923
534 Ga0501072_0825514
535 Ga0501074_0127233
536 Ga0501074_0590708
537 Ga0501075_0186016
538 Ga0501075_0601851
539 Ga0501076_0037341
540 Ga0501076_0358108
541 Ga0501076_0559088
542 Ga0501077_0003427
543 Ga0501077_0008009
544 Ga0501207_121065
545 Ga0501209_215401
546 Ga0501221_256013
547 Ga0501245_034763
548 Ga0501079_0037419
549 Ga0501079_0859108
550 Ga0501079_1494769
551 Ga0501080_0072559
552 Ga0501080_1364793
553 Ga0501081_0007914
554 Ga0501081_0020653
555 Ga0501081_0270811
556 Ga0501081_0670903
557 Ga0501083_0087654
558 Ga0501271_024496
559 Ga0501272_036973
560 Ga0501273_014064
561 Ga0501283_043684
562 Ga0501045_0007832
563 Ga0501045_0061636
564 nmdc:mga05p37_443640_c1
565 nmdc:mga05p37_549623_c1
566 nmdc:mga05p37_880842_c1
567 nmdc:mga09592_408368_c1
568 nmdc:mga06r32_115761_c1
569 nmdc:mga06r32_1318024_c1
570 nmdc:mga06r32_1430450_c1
571 nmdc:mga06r32_2803_c1
572 nmdc:mga08y16_556122_c1
573 nmdc:mga08y16_627331_c1
574 nmdc:mga0n895_1141992_c1
575 nmdc:mga0n895_84555_c1
576 nmdc:mga0n895_874126_c1
577 nmdc:mga0n895_907472_c1
578 nmdc:mga0rr50_343845_c1
579 nmdc:mga0rr50_990323_c1
580 nmdc:mga08x19_39552_c1
581 nmdc:mga08x19_877795_c1
582 nmdc:mga0a205_32621_c1
583 nmdc:mga0a205_41362_c1
584 nmdc:mga0a205_855986_c1
585 Ga0501084_0016494
586 Ga0501084_0033866
587 Ga0501084_0106041
588 Ga0590075_026302
589 Ga0590077_057407
590 Ga0501082_0020342
591 Ga0501082_0178281
592 Ga0501082_0936876
593 Ga0530510_0212540
594 2881647889
595 3006982981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

12

74

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.9004 4 69
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.8879 4 69
2lek-assembly1.cif.gz_A solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 0.8792 6 69
3cwi-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137 0.861 4 69
1tyg-assembly1.cif.gz_G-2 structure of the thiazole synthase/this complex 0.8145 6 67
ID Description Score Start End Superfamily
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8857 6 69 3.10.20.30
2lekA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8792 6 69 3.10.20.30
3cwiA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8615 6 68 3.10.20.30
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.861 6 69 3.10.20.30
af_P96262_1_68_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8427 4 69 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1G1LKC3-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9929 4 69
AF-A0A7C0UPL4-F1-model_v4 Sulfur carrier protein ThiS 0.9895 4 65
AF-A0A2V9YPX9-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9889 4 64
AF-A0A1W9UCK7-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9887 4 69
AF-A0A2V7TIJ2-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9864 3 69 GO:0004789
GO:0005737
GO:0009228
GO:0046872

Map