F393582

General Info

Members Datasets Scaffolds Average Seq Length
297 171 594 216

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100134419|Ga0070713_1001344193
Length 248
Sequence VARPKLFRASGLIGCNTLYEGFRVVHRVSVAVMTAKQILAFITDIGIVPVVRAATAEHAIQAVEACYNGGIRAAEITMTVPGAVHALEKVADRLGDKIMLGAGTVLDPETARICMLAGAQFFVTPSLRISTIEMCKRYSKVICPGALTPTEVLTAWEAGADVVKVFPCGNVGGAKYIKALKGPFPQIEMVPTGGVNLETAGDFLKAGACAVAVGGELVDAKLMKEGRFDAIEERARQYLDVIAKARAA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 0
Rhizoplane 0.34
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 24.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100134419 3300005436 Unclassified 2184
2 Ga0070658_10215217 3300005327 Bacteria 1624
3 Ga0068869_100817983 3300005334 Bacteria 802
4 Ga0070680_100218493 3300005336 Unclassified 1608
5 Ga0070680_100405607 3300005336 Bacteria 1162
6 Ga0070689_100139078 3300005340 Bacteria 1952
7 Ga0070661_100038791 3300005344 Unclassified 3469
8 Ga0070675_100121417 3300005354 Bacteria 2220
9 Ga0070673_100223898 3300005364 Unclassified 1629
10 Ga0070659_100205839 3300005366 Bacteria 1621
11 Ga0070659_100266480 3300005366 Bacteria 1422
12 Ga0070667_101136388 3300005367 Bacteria 730
13 Ga0070709_10185452 3300005434 Unclassified 1464
14 Ga0070714_100010356 3300005435 Bacteria 7368
15 Ga0070713_100001199 3300005436 Bacteria 16556
16 Ga0070711_100002634 3300005439 Bacteria 10269
17 Ga0070708_100240928 3300005445 Unclassified 1698
18 Ga0070678_100325036 3300005456 Unclassified 1315
19 Ga0070662_100252699 3300005457 Unclassified 1418
20 Ga0070662_100721471 3300005457 Bacteria 844
21 Ga0070681_10203066 3300005458 Bacteria 1900
22 Ga0070681_10414094 3300005458 Bacteria 1259
23 Ga0070706_100177431 3300005467 Bacteria 1989
24 Ga0070706_100425227 3300005467 Bacteria 1236
25 Ga0070699_100074337 3300005518 Bacteria 2957
26 Ga0070679_100044927 3300005530 Bacteria 4402
27 Ga0070679_100116371 3300005530 Unclassified 2658
28 Ga0070679_100174867 3300005530 Bacteria 2119
29 Ga0070679_100176312 3300005530 Bacteria 2110
30 Ga0070679_100508993 3300005530 Bacteria 1148
31 Ga0070684_100000128 3300005535 Bacteria 50079
32 Ga0070684_100120616 3300005535 Bacteria 2359
33 Ga0070684_100166505 3300005535 Bacteria 2001
34 Ga0070684_100474663 3300005535 Bacteria 1157
35 Ga0070697_100044745 3300005536 Bacteria 3586
36 Ga0070697_100260751 3300005536 Bacteria 1484
37 Ga0068853_100003832 3300005539 Bacteria 11518
38 Ga0068853_100003928 3300005539 Bacteria 11414
39 Ga0068853_100005196 3300005539 Bacteria 10178
40 Ga0068853_100120680 3300005539 Unclassified 2338
41 Ga0070696_100034364 3300005546 Bacteria 3487
42 Ga0070696_100370063 3300005546 Unclassified 1114
43 Ga0070696_100391678 3300005546 Bacteria 1085
44 Ga0070665_100056506 3300005548 Bacteria 3935
45 Ga0070665_100379962 3300005548 Unclassified 1420
46 Ga0070704_100611629 3300005549 Unclassified 959
47 Ga0068855_100003186 3300005563 Bacteria 20093
48 Ga0068855_100072578 3300005563 Unclassified 4000
49 Ga0068855_100159440 3300005563 Bacteria 2562
50 Ga0068855_100391752 3300005563 Bacteria 1524
51 Ga0068855_100655270 3300005563 Unclassified 1127
52 Ga0070664_100032220 3300005564 Unclassified 4383
53 Ga0070664_100521161 3300005564 Unclassified 1097
54 Ga0068857_100403014 3300005577 Bacteria 1273
55 Ga0068852_100053593 3300005616 Unclassified 3473
56 Ga0068859_100666254 3300005617 Bacteria 1132
57 Ga0068861_100369892 3300005719 Bacteria 1263
58 Ga0068861_100540446 3300005719 Bacteria 1060
59 Ga0068861_100603368 3300005719 Bacteria 1008
60 Ga0068858_100495558 3300005842 Bacteria 1180
61 Ga0070717_10022133 3300006028 Bacteria 5020
62 Ga0070717_10052487 3300006028 Unclassified 3359
63 Ga0075368_10072553 3300006042 Bacteria 1392
64 Ga0075363_100355472 3300006048 Unclassified 856
65 Ga0075367_10077275 3300006178 Unclassified 2010
66 Ga0075367_10586721 3300006178 Bacteria 708
67 Ga0075366_10021599 3300006195 Bacteria 3741
68 Ga0075370_10290358 3300006353 Bacteria 972
69 Ga0075428_100001368 3300006844 Bacteria 25918
70 Ga0075428_100827966 3300006844 Bacteria 983
71 Ga0075430_100027346 3300006846 Bacteria 4847
72 Ga0075431_100596160 3300006847 Unclassified 1089
73 Ga0075431_101155244 3300006847 Bacteria 738
74 Ga0075434_100768119 3300006871 Bacteria 980
75 Ga0075436_100004302 3300006914 Bacteria 9777
76 Ga0075436_100284674 3300006914 Bacteria 1182
77 Ga0075436_100296625 3300006914 Unclassified 1158
78 Ga0097620_100666369 3300006931 Bacteria 1132
79 Ga0105240_10005943 3300009093 Bacteria 18083
80 Ga0105240_10011514 3300009093 Bacteria 12311
81 Ga0105240_10062223 3300009093 Bacteria 4647
82 Ga0105240_10261187 3300009093 Unclassified 1997
83 Ga0105240_10400499 3300009093 Bacteria 1546
84 Ga0111539_10017849 3300009094 Bacteria 8786
85 Ga0111539_10476313 3300009094 Bacteria 1454
86 Ga0114129_10274605 3300009147 Bacteria 2254
87 Ga0114129_10324731 3300009147 Bacteria 2045
88 Ga0105248_10185153 3300009177 Bacteria 2347
89 Ga0105248_10543523 3300009177 Bacteria 1311
90 Ga0105237_10003017 3300009545 Bacteria 20310
91 Ga0105237_10022769 3300009545 Bacteria 6428
92 Ga0105237_10169018 3300009545 Bacteria 2186
93 Ga0105237_10198282 3300009545 Bacteria 2007
94 Ga0105237_10437816 3300009545 Bacteria 1313
95 Ga0105239_10084305 3300010375 Unclassified 3500
96 Ga0105239_11205220 3300010375 Bacteria 872
97 Ga0157370_10005215 3300013104 Bacteria 14649
98 Ga0157369_10010885 3300013105 Bacteria 10362
99 Ga0157369_10036576 3300013105 Bacteria 5378
100 Ga0157369_10116008 3300013105 Bacteria 2844
101 Ga0157369_10566256 3300013105 Bacteria 1174
102 Ga0157374_10323248 3300013296 Unclassified 1529
103 Ga0157374_11072523 3300013296 Bacteria 826
104 Ga0157378_10307818 3300013297 Bacteria 1536
105 Ga0163162_10212926 3300013306 Unclassified 2062
106 Ga0163162_10514789 3300013306 Unclassified 1326
107 Ga0157372_10024602 3300013307 Bacteria 6544
108 Ga0157372_10268835 3300013307 Bacteria 1981
109 Ga0157372_10281122 3300013307 Bacteria 1935
110 Ga0157372_10908968 3300013307 Bacteria 1021
111 Ga0157375_10135636 3300013308 Bacteria 2584
112 Ga0163163_10008057 3300014325 Bacteria 9334
113 Ga0163163_10206413 3300014325 Bacteria 2013
114 Ga0157380_10574173 3300014326 Bacteria 1111
115 Ga0157379_10239459 3300014968 Bacteria 1646
116 Ga0157376_10088273 3300014969 Bacteria 2678
117 Ga0157376_10218163 3300014969 Unclassified 1765
118 Ga0206349_1436499 3300020075 Unclassified 893
119 Ga0207699_10007765 3300025906 Bacteria 5253
120 Ga0207699_10259485 3300025906 Bacteria 1201
121 Ga0207699_10458041 3300025906 Bacteria 916
122 Ga0207645_10519219 3300025907 Bacteria 807
123 Ga0207684_10358157 3300025910 Unclassified 1255
124 Ga0207684_10399225 3300025910 Bacteria 1182
125 Ga0207707_10051741 3300025912 Bacteria 3577
126 Ga0207707_10408961 3300025912 Bacteria 1164
127 Ga0207695_10216904 3300025913 Bacteria 1822
128 Ga0207695_10388638 3300025913 Bacteria 1280
129 Ga0207671_10034635 3300025914 Unclassified 3751
130 Ga0207671_10036131 3300025914 Unclassified 3663
131 Ga0207671_10223814 3300025914 Bacteria 1474
132 Ga0207663_10199618 3300025916 Unclassified 1442
133 Ga0207660_10017789 3300025917 Bacteria 4730
134 Ga0207660_10143786 3300025917 Unclassified 1826
135 Ga0207660_10181054 3300025917 Bacteria 1637
136 Ga0207657_10053690 3300025919 Unclassified 3490
137 Ga0207652_10067840 3300025921 Bacteria 3093
138 Ga0207652_10253638 3300025921 Unclassified 1586
139 Ga0207700_10000916 3300025928 Bacteria 16916
140 Ga0207664_10012907 3300025929 Bacteria 5987
141 Ga0207706_10048272 3300025933 Bacteria 3765
142 Ga0207706_10182762 3300025933 Unclassified 1842
143 Ga0207706_10188877 3300025933 Bacteria 1809
144 Ga0207670_10288733 3300025936 Bacteria 1281
145 Ga0207711_10436820 3300025941 Bacteria 1218
146 Ga0207661_10000073 3300025944 Bacteria 68550
147 Ga0207679_10043805 3300025945 Unclassified 3225
148 Ga0207679_10401231 3300025945 Unclassified 1206
149 Ga0207667_10043031 3300025949 Unclassified 4795
150 Ga0207667_10065146 3300025949 Bacteria 3802
151 Ga0207667_10200552 3300025949 Bacteria 2047
152 Ga0207667_10843499 3300025949 Unclassified 911
153 Ga0207667_10953798 3300025949 Bacteria 847
154 Ga0207651_10010642 3300025960 Bacteria 5108
155 Ga0207712_10084677 3300025961 Bacteria 2317
156 Ga0207658_10074681 3300025986 Bacteria 2577
157 Ga0207703_10514457 3300026035 Bacteria 1125
158 Ga0207639_10203711 3300026041 Unclassified 1699
159 Ga0207639_10736228 3300026041 Unclassified 916
160 Ga0207678_10332927 3300026067 Bacteria 1307
161 Ga0207702_10229433 3300026078 Bacteria 1734
162 Ga0207641_10133554 3300026088 Bacteria 2231
163 Ga0207674_10411001 3300026116 Bacteria 1308
164 Ga0207675_100335296 3300026118 Bacteria 1479
165 Ga0207683_10323894 3300026121 Bacteria 1412
166 Ga0265338_10028763 3300028800 Bacteria 5533
167 Ga0265324_10012184 3300029957 Bacteria 3251
168 Ga0265330_10167193 3300031235 Bacteria 933
169 Ga0265325_10010381 3300031241 Bacteria 5397
170 Ga0265325_10076708 3300031241 Bacteria 1667
171 Ga0265329_10005063 3300031242 Bacteria 5380
172 Ga0265339_10067432 3300031249 Bacteria 1914
173 Ga0265316_10011567 3300031344 Bacteria 7947
174 Ga0265316_10014381 3300031344 Bacteria 6969
175 Ga0265316_10017984 3300031344 Bacteria 6090
176 Ga0265316_10065402 3300031344 Bacteria 2816
177 Ga0265316_10120721 3300031344 Unclassified 1979
178 Ga0265314_10005585 3300031711 Bacteria 11308
179 Ga0265342_10020737 3300031712 Bacteria 4208
180 Ga0307516_10014805 3300031730 Bacteria 8234
181 Ga0307406_10338560 3300031901 Bacteria 1171
182 Ga0373926_0012108 3300035083 Bacteria 2913
183 Ga0373923_0085771 3300035111 Bacteria 1371
184 Ga0373953_0152265 3300035117 Bacteria 992
185 Ga0373954_0119684 3300035118 Bacteria 1278
186 Ga0373957_0036755 3300035120 Bacteria 1826
187 Ga0373943_0036544 3300035170 Bacteria 2353
188 Ga0373943_0040376 3300035170 Bacteria 2253
189 Ga0373955_0286752 3300035172 Bacteria 991
190 Ga0373935_0009556 3300035692 Bacteria 5806
191 Ga0373935_0063047 3300035692 Bacteria 2375
192 Ga0373935_0097062 3300035692 Bacteria 1938
193 Ga0373927_0002896 3300035695 Bacteria 12476
194 Ga0373927_0017570 3300035695 Bacteria 4707
195 Ga0373927_0021572 3300035695 Unclassified 4221
196 Ga0373927_0139203 3300035695 Bacteria 1587
197 Ga0373927_0429419 3300035695 Bacteria 872
198 Ga0373947_0001299 3300035725 Bacteria 15363
199 Ga0373947_0017254 3300035725 Bacteria 4152
200 Ga0373947_0198404 3300035725 Bacteria 1312
201 Ga0373937_0010018 3300036401 Bacteria 8266
202 Ga0373937_0066536 3300036401 Unclassified 3319
203 Ga0373937_0269023 3300036401 Bacteria 1608
204 Ga0373937_0311407 3300036401 Unclassified 1489
205 Ga0373925_0000265 3300037068 Bacteria 54652
206 Ga0373925_0147228 3300037068 Bacteria 1847
207 Ga0373925_0341395 3300037068 Bacteria 1215
208 Ga0373925_0357692 3300037068 Unclassified 1186
209 Ga0373925_0390434 3300037068 Bacteria 1134
210 Ga0373925_0636474 3300037068 Bacteria 879
211 Ga0395900_0555884 3300037418 Bacteria 1092
212 Ga0395898_0388297 3300037466 Bacteria 1331
213 Ga0395898_0753217 3300037466 Bacteria 915
214 Ga0436364_0914804 3300037853 Bacteria 1380
215 Ga0436364_1065682 3300037853 Bacteria 6455
216 Ga0436364_1381996 3300037853 Bacteria 1522
217 Ga0395901_0182096 3300038443 Bacteria 2204
218 Ga0436365_0208695 3300039437 Bacteria 1209
219 Ga0436361_0760852 3300039447 Bacteria 817
220 Ga0436363_0502508 3300039450 Bacteria 729
221 Ga0436363_1454409 3300039450 Bacteria 834
222 Ga0436362_0007386 3300039453 Bacteria 756
223 Ga0451853_0459874 3300041512 Bacteria 790
224 Ga0451577_0413960 3300042876 Bacteria 1224
225 Ga0453684_0599593 3300044712 Bacteria 1207
226 Ga0453684_0716714 3300044712 Bacteria 1086
227 Ga0451576_0018667 3300045051 Bacteria 7588
228 Ga0451576_0357047 3300045051 Bacteria 1530
229 Ga0451576_0603850 3300045051 Unclassified 1153
230 Ga0495651_0091935 3300046462 Unclassified 2273
231 Ga0495651_0391431 3300046462 Unclassified 909
232 Ga0495580_0007261 3300046472 Bacteria 8913
233 Ga0495580_0031954 3300046472 Bacteria 3801
234 Ga0495580_0502268 3300046472 Bacteria 809
235 Ga0495639_0084044 3300046475 Bacteria 1486
236 Ga0495662_0084033 3300046476 Unclassified 1549
237 Ga0495594_0399045 3300046499 Unclassified 782
238 Ga0495608_0066592 3300046511 Bacteria 2358
239 Ga0495628_0142923 3300046516 Unclassified 1826
240 Ga0495630_0194727 3300046517 Unclassified 1546
241 Ga0495630_0385971 3300046517 Bacteria 1073
242 Ga0495652_0041341 3300046529 Unclassified 3980
243 Ga0495665_0066751 3300046531 Unclassified 1898
244 Ga0495587_0059437 3300046536 Bacteria 2244
245 Ga0495645_0009177 3300046543 Bacteria 6909
246 Ga0495645_0064032 3300046543 Bacteria 2661
247 Ga0495645_0458227 3300046543 Bacteria 803
248 Ga0495634_0341041 3300046642 Unclassified 899
249 Ga0495657_0043617 3300046675 Unclassified 3057
250 Ga0495657_0219447 3300046675 Bacteria 1153
251 Ga0495599_0011099 3300046678 Bacteria 5528
252 Ga0495623_0055751 3300046679 Bacteria 2490
253 Ga0495623_0086793 3300046679 Unclassified 1928
254 Ga0495613_0161241 3300046689 Unclassified 1595
255 Ga0495624_0030039 3300046690 Bacteria 3542
256 Ga0495674_0007107 3300047319 Bacteria 10710
257 Ga0495674_0099622 3300047319 Unclassified 2474
258 Ga0495674_0207384 3300047319 Unclassified 1624
259 Ga0495674_0401759 3300047319 Bacteria 1106
260 Ga0495675_0089313 3300047444 Bacteria 1935
261 Ga0495675_0263746 3300047444 Unclassified 1031
262 Ga0495684_0001149 3300047471 Bacteria 21314
263 Ga0495602_0021089 3300048088 Bacteria 6422
264 Ga0495602_0094741 3300048088 Bacteria 2467
265 Ga0496112_0371464 3300048915 Bacteria 1372
266 Ga0501033_0107321 3300049570 Bacteria 2034
267 Ga0501034_0178453 3300049571 Bacteria 2089
268 Ga0501034_0360234 3300049571 Unclassified 1382
269 Ga0501040_0279989 3300049576 Bacteria 1191
270 Ga0501043_0029982 3300049579 Unclassified 4274
271 Ga0501047_0017725 3300049581 Bacteria 6821
272 Ga0501073_0061054 3300049589 Bacteria 2631
273 Ga0501073_0303120 3300049589 Bacteria 1102
274 Ga0501035_0024001 3300049822 Bacteria 5596
275 Ga0501044_0630721 3300049823 Bacteria 962
276 nmdc:mga03n38_302323_c1 3300050490 Unclassified 859
277 nmdc:mga0k408_39410_c1 3300050493 Unclassified 2714
278 nmdc:mga0k408_82360_c1 3300050493 Bacteria 1885
279 nmdc:mga06z11_120676_c1 3300050494 Unclassified 1462
280 nmdc:mga06z11_217149_c1 3300050494 Bacteria 1116
281 nmdc:mga06z11_458293_c1 3300050494 Unclassified 771
282 nmdc:mga07m45_301888_c1 3300050496 Bacteria 931
283 nmdc:mga05p37_524603_c1 3300050507 Bacteria 1354
284 nmdc:mga05p37_786238_c1 3300050507 Bacteria 1043
285 nmdc:mga09592_332475_c1 3300050508 Bacteria 1315
286 nmdc:mga09592_815748_c1 3300050508 Bacteria 788
287 nmdc:mga0qj67_46933_c1 3300050509 Bacteria 3411
288 nmdc:mga06r32_4480_c1 3300050510 Bacteria 12511
289 nmdc:mga08y16_456060_c1 3300050511 Bacteria 1303
290 nmdc:mga08y16_6614_c1 3300050511 Bacteria 12156
291 nmdc:mga08x19_3162_c1 3300050514 Bacteria 9885
292 nmdc:mga08x19_583271_c1 3300050514 Unclassified 792
293 nmdc:mga08x19_589075_c1 3300050514 Unclassified 788
294 Ga0500619_061346 3300053154 Bacteria 1237
295 Ga0500645_006279 3300053730 Bacteria 4263
296 Ga0500645_032045 3300053730 Bacteria 1577
297 2687237184 2684623219 Bacteria 8442773
298 Ga0070713_100134419
299 Ga0070658_10215217
300 Ga0068869_100817983
301 Ga0070680_100218493
302 Ga0070680_100405607
303 Ga0070689_100139078
304 Ga0070661_100038791
305 Ga0070675_100121417
306 Ga0070673_100223898
307 Ga0070659_100205839
308 Ga0070659_100266480
309 Ga0070667_101136388
310 Ga0070709_10185452
311 Ga0070714_100010356
312 Ga0070713_100001199
313 Ga0070711_100002634
314 Ga0070708_100240928
315 Ga0070678_100325036
316 Ga0070662_100252699
317 Ga0070662_100721471
318 Ga0070681_10203066
319 Ga0070681_10414094
320 Ga0070706_100177431
321 Ga0070706_100425227
322 Ga0070699_100074337
323 Ga0070679_100044927
324 Ga0070679_100116371
325 Ga0070679_100174867
326 Ga0070679_100176312
327 Ga0070679_100508993
328 Ga0070684_100000128
329 Ga0070684_100120616
330 Ga0070684_100166505
331 Ga0070684_100474663
332 Ga0070697_100044745
333 Ga0070697_100260751
334 Ga0068853_100003832
335 Ga0068853_100003928
336 Ga0068853_100005196
337 Ga0068853_100120680
338 Ga0070696_100034364
339 Ga0070696_100370063
340 Ga0070696_100391678
341 Ga0070665_100056506
342 Ga0070665_100379962
343 Ga0070704_100611629
344 Ga0068855_100003186
345 Ga0068855_100072578
346 Ga0068855_100159440
347 Ga0068855_100391752
348 Ga0068855_100655270
349 Ga0070664_100032220
350 Ga0070664_100521161
351 Ga0068857_100403014
352 Ga0068852_100053593
353 Ga0068859_100666254
354 Ga0068861_100369892
355 Ga0068861_100540446
356 Ga0068861_100603368
357 Ga0068858_100495558
358 Ga0070717_10022133
359 Ga0070717_10052487
360 Ga0075368_10072553
361 Ga0075363_100355472
362 Ga0075367_10077275
363 Ga0075367_10586721
364 Ga0075366_10021599
365 Ga0075370_10290358
366 Ga0075428_100001368
367 Ga0075428_100827966
368 Ga0075430_100027346
369 Ga0075431_100596160
370 Ga0075431_101155244
371 Ga0075434_100768119
372 Ga0075436_100004302
373 Ga0075436_100284674
374 Ga0075436_100296625
375 Ga0097620_100666369
376 Ga0105240_10005943
377 Ga0105240_10011514
378 Ga0105240_10062223
379 Ga0105240_10261187
380 Ga0105240_10400499
381 Ga0111539_10017849
382 Ga0111539_10476313
383 Ga0114129_10274605
384 Ga0114129_10324731
385 Ga0105248_10185153
386 Ga0105248_10543523
387 Ga0105237_10003017
388 Ga0105237_10022769
389 Ga0105237_10169018
390 Ga0105237_10198282
391 Ga0105237_10437816
392 Ga0105239_10084305
393 Ga0105239_11205220
394 Ga0157370_10005215
395 Ga0157369_10010885
396 Ga0157369_10036576
397 Ga0157369_10116008
398 Ga0157369_10566256
399 Ga0157374_10323248
400 Ga0157374_11072523
401 Ga0157378_10307818
402 Ga0163162_10212926
403 Ga0163162_10514789
404 Ga0157372_10024602
405 Ga0157372_10268835
406 Ga0157372_10281122
407 Ga0157372_10908968
408 Ga0157375_10135636
409 Ga0163163_10008057
410 Ga0163163_10206413
411 Ga0157380_10574173
412 Ga0157379_10239459
413 Ga0157376_10088273
414 Ga0157376_10218163
415 Ga0206349_1436499
416 Ga0207699_10007765
417 Ga0207699_10259485
418 Ga0207699_10458041
419 Ga0207645_10519219
420 Ga0207684_10358157
421 Ga0207684_10399225
422 Ga0207707_10051741
423 Ga0207707_10408961
424 Ga0207695_10216904
425 Ga0207695_10388638
426 Ga0207671_10034635
427 Ga0207671_10036131
428 Ga0207671_10223814
429 Ga0207663_10199618
430 Ga0207660_10017789
431 Ga0207660_10143786
432 Ga0207660_10181054
433 Ga0207657_10053690
434 Ga0207652_10067840
435 Ga0207652_10253638
436 Ga0207700_10000916
437 Ga0207664_10012907
438 Ga0207706_10048272
439 Ga0207706_10182762
440 Ga0207706_10188877
441 Ga0207670_10288733
442 Ga0207711_10436820
443 Ga0207661_10000073
444 Ga0207679_10043805
445 Ga0207679_10401231
446 Ga0207667_10043031
447 Ga0207667_10065146
448 Ga0207667_10200552
449 Ga0207667_10843499
450 Ga0207667_10953798
451 Ga0207651_10010642
452 Ga0207712_10084677
453 Ga0207658_10074681
454 Ga0207703_10514457
455 Ga0207639_10203711
456 Ga0207639_10736228
457 Ga0207678_10332927
458 Ga0207702_10229433
459 Ga0207641_10133554
460 Ga0207674_10411001
461 Ga0207675_100335296
462 Ga0207683_10323894
463 Ga0265338_10028763
464 Ga0265324_10012184
465 Ga0265330_10167193
466 Ga0265325_10010381
467 Ga0265325_10076708
468 Ga0265329_10005063
469 Ga0265339_10067432
470 Ga0265316_10011567
471 Ga0265316_10014381
472 Ga0265316_10017984
473 Ga0265316_10065402
474 Ga0265316_10120721
475 Ga0265314_10005585
476 Ga0265342_10020737
477 Ga0307516_10014805
478 Ga0307406_10338560
479 Ga0373926_0012108
480 Ga0373923_0085771
481 Ga0373953_0152265
482 Ga0373954_0119684
483 Ga0373957_0036755
484 Ga0373943_0036544
485 Ga0373943_0040376
486 Ga0373955_0286752
487 Ga0373935_0009556
488 Ga0373935_0063047
489 Ga0373935_0097062
490 Ga0373927_0002896
491 Ga0373927_0017570
492 Ga0373927_0021572
493 Ga0373927_0139203
494 Ga0373927_0429419
495 Ga0373947_0001299
496 Ga0373947_0017254
497 Ga0373947_0198404
498 Ga0373937_0010018
499 Ga0373937_0066536
500 Ga0373937_0269023
501 Ga0373937_0311407
502 Ga0373925_0000265
503 Ga0373925_0147228
504 Ga0373925_0341395
505 Ga0373925_0357692
506 Ga0373925_0390434
507 Ga0373925_0636474
508 Ga0395900_0555884
509 Ga0395898_0388297
510 Ga0395898_0753217
511 Ga0436364_0914804
512 Ga0436364_1065682
513 Ga0436364_1381996
514 Ga0395901_0182096
515 Ga0436365_0208695
516 Ga0436361_0760852
517 Ga0436363_0502508
518 Ga0436363_1454409
519 Ga0436362_0007386
520 Ga0451853_0459874
521 Ga0451577_0413960
522 Ga0453684_0599593
523 Ga0453684_0716714
524 Ga0451576_0018667
525 Ga0451576_0357047
526 Ga0451576_0603850
527 Ga0495651_0091935
528 Ga0495651_0391431
529 Ga0495580_0007261
530 Ga0495580_0031954
531 Ga0495580_0502268
532 Ga0495639_0084044
533 Ga0495662_0084033
534 Ga0495594_0399045
535 Ga0495608_0066592
536 Ga0495628_0142923
537 Ga0495630_0194727
538 Ga0495630_0385971
539 Ga0495652_0041341
540 Ga0495665_0066751
541 Ga0495587_0059437
542 Ga0495645_0009177
543 Ga0495645_0064032
544 Ga0495645_0458227
545 Ga0495634_0341041
546 Ga0495657_0043617
547 Ga0495657_0219447
548 Ga0495599_0011099
549 Ga0495623_0055751
550 Ga0495623_0086793
551 Ga0495613_0161241
552 Ga0495624_0030039
553 Ga0495674_0007107
554 Ga0495674_0099622
555 Ga0495674_0207384
556 Ga0495674_0401759
557 Ga0495675_0089313
558 Ga0495675_0263746
559 Ga0495684_0001149
560 Ga0495602_0021089
561 Ga0495602_0094741
562 Ga0496112_0371464
563 Ga0501033_0107321
564 Ga0501034_0178453
565 Ga0501034_0360234
566 Ga0501040_0279989
567 Ga0501043_0029982
568 Ga0501047_0017725
569 Ga0501073_0061054
570 Ga0501073_0303120
571 Ga0501035_0024001
572 Ga0501044_0630721
573 nmdc:mga03n38_302323_c1
574 nmdc:mga0k408_39410_c1
575 nmdc:mga0k408_82360_c1
576 nmdc:mga06z11_120676_c1
577 nmdc:mga06z11_217149_c1
578 nmdc:mga06z11_458293_c1
579 nmdc:mga07m45_301888_c1
580 nmdc:mga05p37_524603_c1
581 nmdc:mga05p37_786238_c1
582 nmdc:mga09592_332475_c1
583 nmdc:mga09592_815748_c1
584 nmdc:mga0qj67_46933_c1
585 nmdc:mga06r32_4480_c1
586 nmdc:mga08y16_456060_c1
587 nmdc:mga08y16_6614_c1
588 nmdc:mga08x19_3162_c1
589 nmdc:mga08x19_583271_c1
590 nmdc:mga08x19_589075_c1
591 Ga0500619_061346
592 Ga0500645_006279
593 Ga0500645_032045
594 2687237184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

38

234

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.9652 8 212
8szz-assembly1.cif.gz_J cryoem structure of computationally designed nanocage o32-zl4 0.9609 8 212
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.9604 7 212
8cus-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9601 8 211
6p6f-assembly1.cif.gz_A bg505 sosip-i53-50np 0.9581 6 212
ID Description Score Start End Superfamily
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9697 43 209 3.20.20.70
af_K7LFS0_36_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9605 3 213 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9601 3 213 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9512 15 215 3.20.20.70
af_A0A0P0X3V0_19_98_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9421 5 69 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7Y8I1Q4-F1-model_v4 Bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14, EC 4.1.3.16) 0.9999 1 217 GO:0008675
GO:0008700
AF-A0A6L8HPM7-F1-model_v4 deleted 0.994 1 215
AF-A0A2V8S183-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9923 1 215 GO:0016829
AF-A0A359M527-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.992 1 149 GO:0016829
AF-A0A2V8GAB8-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9908 1 216 GO:0016829

Map