F393488

General Info

Members Datasets Scaffolds Average Seq Length
296 243 260 293

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056060235|8056064639
Length 320
Sequence ILAGGSGTRLHPITKGVSKQLLPVYDKPMIYYPLSVLMLSGIREILVISTPRDLPAFRRLLGDGSSLGLGIDYAEQDEPRGLADAFRIGARHIGADPSALVLGDNIFHGPGLSSLLYHHARAVDGCTLFGYPVSDPERYGVAEADAEGRLLSLEEKPAHPRSDRAVTGLYFYDEQVVDIAAGLRPSARGELEITDVNRVYLEQGRARLVDLGRGFAWLDTGTHDSLLEAGEFVRILERRQGVRIACVEEVALRMGFIGAEACHRLGELQAGSGYGRYLMELAAAFDRDGSSGFDARADLEPPFRGAPGEGAEPAALGAAR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
13 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
14 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
15 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
16 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
17 2808606448 Streptomyces sp. 193411 Isolate Unclassified
18 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
19 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
20 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
21 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
22 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
23 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
24 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
25 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
26 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
27 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
28 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
29 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
147 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
173 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
205 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
206 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
207 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
208 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
218 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
219 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
220 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
221 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
225 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
226 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
236 649633069 Micromonospora sp. L5 Isolate Unclassified
237 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
238 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
239 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
240 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
241 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
242 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
243 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.16
Metatranscriptomes 0.68
Isolates 12.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0.34
Rhizoplane 3.72
Rhizosphere 82.77
Stem 0
Stem Tuber 0.34
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1006401 3300001976 Bacteria 1540
2 JGI25406J46586_10000837 3300003203 Bacteria 14462
3 JGI25153J46596_10000325 3300003215 Bacteria 34505
4 Ga0055526_1000200 3300003771 Bacteria 51514
5 Ga0070676_10105648 3300005328 Bacteria 1746
6 Ga0070670_100006150 3300005331 Bacteria 10148
7 Ga0068869_100000879 3300005334 Bacteria 17295
8 Ga0070666_10326237 3300005335 Bacteria 1096
9 Ga0070682_100325823 3300005337 Bacteria 1136
10 Ga0070660_100003828 3300005339 Bacteria 10392
11 Ga0070691_10002087 3300005341 Bacteria 8836
12 Ga0070692_10136166 3300005345 Bacteria 1385
13 Ga0070668_100002153 3300005347 Bacteria 14423
14 Ga0070668_100086831 3300005347 Bacteria 2460
15 Ga0070675_100003936 3300005354 Bacteria 11254
16 Ga0070674_100245171 3300005356 Bacteria 1405
17 Ga0070659_100063164 3300005366 Bacteria 2929
18 Ga0070709_10097061 3300005434 Bacteria 1955
19 Ga0070714_100001273 3300005435 Bacteria 18222
20 Ga0070714_100286230 3300005435 Bacteria 1532
21 Ga0070713_100005038 3300005436 Bacteria 8983
22 Ga0070713_100020054 3300005436 Bacteria 5118
23 Ga0070710_10001326 3300005437 Bacteria 11677
24 Ga0070700_100009855 3300005441 Bacteria 5255
25 Ga0070700_100158689 3300005441 Bacteria 1555
26 Ga0070663_100007038 3300005455 Bacteria 6816
27 Ga0070678_100076572 3300005456 Bacteria 2520
28 Ga0070685_10087252 3300005466 Bacteria 1882
29 Ga0070679_100009168 3300005530 Bacteria 9343
30 Ga0070684_100216563 3300005535 Bacteria 1746
31 Ga0068853_100101492 3300005539 Bacteria 2545
32 Ga0068853_100322700 3300005539 Bacteria 1432
33 Ga0070693_100000597 3300005547 Bacteria 16009
34 Ga0070665_100427370 3300005548 Bacteria 1333
35 Ga0070664_100068305 3300005564 Bacteria 3038
36 Ga0068854_100021494 3300005578 Bacteria 4380
37 Ga0068856_100132701 3300005614 Bacteria 2495
38 Ga0068856_100185066 3300005614 Bacteria 2097
39 Ga0070702_100006290 3300005615 Bacteria 5609
40 Ga0068852_100168278 3300005616 Bacteria 2052
41 Ga0068864_100169230 3300005618 Bacteria 1991
42 Ga0068866_10081825 3300005718 Bacteria 1736
43 Ga0068861_100117188 3300005719 Bacteria 2143
44 Ga0068851_10006096 3300005834 Bacteria 5500
45 Ga0068851_10064587 3300005834 Bacteria 1882
46 Ga0068858_100008068 3300005842 Bacteria 10140
47 Ga0068862_100109346 3300005844 Bacteria 2425
48 Ga0081455_10035426 3300005937 Bacteria 4460
49 Ga0081540_1045527 3300005983 Bacteria 2226
50 Ga0081539_10000132 3300005985 Bacteria 175454
51 Ga0070717_10260228 3300006028 Bacteria 1535
52 Ga0075432_10009775 3300006058 Bacteria 3262
53 Ga0070712_100065369 3300006175 Bacteria 2582
54 Ga0075428_100000138 3300006844 Bacteria 64487
55 Ga0075433_10066262 3300006852 Bacteria 3168
56 Ga0075434_100050542 3300006871 Bacteria 4130
57 Ga0075429_100051781 3300006880 Bacteria 3571
58 Ga0075436_100008915 3300006914 Bacteria 6866
59 Ga0099826_10100471 3300006948 Bacteria 1746
60 Ga0075435_100020382 3300007076 Bacteria 5080
61 Ga0105251_10011819 3300009011 Bacteria 4969
62 Ga0111539_10056121 3300009094 Bacteria 4682
63 Ga0105247_10029750 3300009101 Bacteria 3311
64 Ga0105247_10374828 3300009101 Bacteria 1007
65 Ga0114129_10057751 3300009147 Bacteria 5429
66 Ga0114129_10122786 3300009147 Bacteria 3573
67 Ga0105243_10151157 3300009148 Bacteria 1992
68 Ga0105241_10011823 3300009174 Bacteria 6411
69 Ga0105248_10150471 3300009177 Bacteria 2626
70 Ga0105237_10116605 3300009545 Bacteria 2664
71 Ga0105238_10039331 3300009551 Bacteria 4796
72 Ga0105238_10064636 3300009551 Bacteria 3658
73 Ga0105249_10268946 3300009553 Bacteria 1697
74 Ga0105239_10051378 3300010375 Bacteria 4519
75 Ga0105239_10173201 3300010375 Bacteria 2414
76 Ga0105246_10008501 3300011119 Bacteria 6311
77 Ga0157373_10033472 3300013100 Bacteria 3697
78 Ga0157369_10012854 3300013105 Bacteria 9488
79 Ga0157374_10004351 3300013296 Bacteria 11923
80 Ga0157372_10010042 3300013307 Bacteria 10066
81 Ga0157377_10001471 3300014745 Bacteria 10198
82 Ga0157377_10030663 3300014745 Bacteria 2915
83 Ga0206354_10914270 3300020081 Bacteria 2443
84 Ga0213872_10000954 3300021361 Bacteria 20225
85 Ga0213872_10004386 3300021361 Bacteria 7509
86 Ga0213872_10008894 3300021361 Bacteria 4835
87 Ga0213872_10011852 3300021361 Bacteria 4118
88 Ga0213872_10014916 3300021361 Bacteria 3617
89 Ga0213872_10019652 3300021361 Bacteria 3111
90 Ga0213872_10024217 3300021361 Bacteria 2791
91 Ga0213872_10096291 3300021361 Bacteria 1321
92 Ga0213875_10001297 3300021388 Bacteria 16615
93 Ga0224712_10011116 3300022467 Bacteria 2778
94 Ga0209564_1000043 3300025295 Bacteria 388153
95 Ga0209758_1000060 3300025297 Bacteria 324326
96 Ga0207692_10003788 3300025898 Bacteria 5942
97 Ga0207688_10000331 3300025901 Bacteria 21938
98 Ga0207688_10045072 3300025901 Bacteria 2459
99 Ga0207647_10119298 3300025904 Bacteria 1556
100 Ga0207645_10159354 3300025907 Bacteria 1476
101 Ga0207643_10000104 3300025908 Bacteria 57260
102 Ga0207643_10226759 3300025908 Bacteria 1145
103 Ga0207705_10051573 3300025909 Bacteria 2961
104 Ga0207705_10188375 3300025909 Bacteria 1559
105 Ga0207654_10004395 3300025911 Bacteria 7104
106 Ga0207671_10054781 3300025914 Bacteria 2954
107 Ga0207660_10025272 3300025917 Bacteria 4030
108 Ga0207657_10049172 3300025919 Bacteria 3677
109 Ga0207657_10158280 3300025919 Bacteria 1841
110 Ga0207649_10085949 3300025920 Bacteria 2048
111 Ga0207694_10215841 3300025924 Bacteria 1563
112 Ga0207650_10013711 3300025925 Bacteria 5620
113 Ga0207659_10080796 3300025926 Bacteria 2402
114 Ga0207687_10087043 3300025927 Bacteria 2270
115 Ga0207700_10117651 3300025928 Bacteria 2150
116 Ga0207664_10003057 3300025929 Bacteria 11123
117 Ga0207664_10231695 3300025929 Bacteria 1606
118 Ga0207664_10236254 3300025929 Bacteria 1590
119 Ga0207644_10012297 3300025931 Bacteria 5682
120 Ga0207709_10106125 3300025935 Bacteria 1868
121 Ga0207669_10465117 3300025937 Bacteria 1005
122 Ga0207711_10185260 3300025941 Bacteria 1895
123 Ga0207689_10002741 3300025942 Bacteria 16291
124 Ga0207661_10004177 3300025944 Bacteria 10104
125 Ga0207679_10010857 3300025945 Bacteria 5872
126 Ga0207679_10173942 3300025945 Bacteria 1775
127 Ga0207712_10389785 3300025961 Bacteria 1168
128 Ga0207640_10204630 3300025981 Bacteria 1499
129 Ga0207703_10068942 3300026035 Bacteria 2915
130 Ga0207678_10000105 3300026067 Bacteria 68804
131 Ga0207678_10000264 3300026067 Bacteria 47439
132 Ga0207708_10016732 3300026075 Bacteria 5518
133 Ga0207708_10060416 3300026075 Bacteria 2893
134 Ga0207702_10002074 3300026078 Bacteria 19382
135 Ga0207702_10048977 3300026078 Bacteria 3564
136 Ga0207641_10142310 3300026088 Bacteria 2165
137 Ga0207676_10000838 3300026095 Bacteria 23866
138 Ga0207676_10444041 3300026095 Bacteria 1221
139 Ga0207674_10178521 3300026116 Bacteria 2075
140 Ga0207675_100426145 3300026118 Bacteria 1311
141 Ga0207683_10000092 3300026121 Bacteria 72389
142 Ga0207683_10090923 3300026121 Bacteria 2719
143 Ga0207683_10187975 3300026121 Bacteria 1874
144 Ga0207698_10043691 3300026142 Bacteria 3360
145 Ga0207428_10187771 3300027907 Bacteria 1559
146 Ga0268266_10102349 3300028379 Bacteria 2526
147 Ga0268264_10178126 3300028381 Bacteria 1928
148 Ga0307515_10165126 3300028794 Bacteria 2236
149 Ga0307511_10042303 3300030521 Bacteria 3828
150 Ga0316176_1189435 3300030732 Bacteria 7441
151 Ga0314311_1021057 3300030733 Bacteria 5174
152 Ga0265320_10001814 3300031240 Bacteria 15142
153 Ga0307513_10014835 3300031456 Bacteria 9479
154 Ga0307509_10163858 3300031507 Bacteria 2116
155 Ga0265313_10000194 3300031595 Bacteria 65054
156 Ga0307413_10001375 3300031824 Bacteria 9145
157 Ga0307518_10001375 3300031838 Bacteria 18082
158 Ga0307507_10047174 3300033179 Bacteria 4212
159 Ga0373934_0069131 3300035086 Bacteria 1411
160 Ga0373956_0004581 3300035119 Bacteria 5523
161 Ga0373943_0338005 3300035170 Bacteria 861
162 Ga0373955_0082972 3300035172 Bacteria 1815
163 Ga0373937_0185854 3300036401 Bacteria 1952
164 Ga0395900_0283373 3300037418 Bacteria 1648
165 Ga0395898_0205012 3300037466 Bacteria 1882
166 Ga0395905_0001050 3300037471 Bacteria 34941
167 Ga0436364_0145178 3300037853 Bacteria 26239
168 Ga0436364_1186806 3300037853 Bacteria 6579
169 Ga0395901_0224784 3300038443 Bacteria 1961
170 Ga0395901_0659152 3300038443 Bacteria 1049
171 Ga0436365_1508967 3300039437 Bacteria 3634
172 Ga0436361_0044538 3300039447 Bacteria 2077
173 Ga0436361_0151690 3300039447 Bacteria 6260
174 Ga0436361_0451336 3300039447 Bacteria 2142
175 Ga0436361_0735288 3300039447 Bacteria 6733
176 Ga0436361_1065122 3300039447 Bacteria 2626
177 Ga0436362_0358937 3300039453 Bacteria 43996
178 Ga0439433_0010652 3300041999 Bacteria 2010
179 Ga0439448_0008139 3300042005 Bacteria 3062
180 Ga0439449_0043914 3300042007 Bacteria 1658
181 Ga0439457_000254 3300042014 Bacteria 14535
182 Ga0450902_001151 3300042137 Bacteria 3529
183 Ga0439459_0002057 3300042438 Bacteria 3065
184 Ga0466969_0001865 3300044656 Bacteria 11270
185 Ga0466972_0002803 3300044658 Bacteria 8634
186 Ga0466972_0017050 3300044658 Bacteria 3633
187 Ga0466965_0010428 3300044683 Bacteria 4335
188 Ga0466965_0024316 3300044683 Bacteria 2929
189 Ga0466965_0148541 3300044683 Bacteria 1224
190 Ga0466966_0010267 3300044684 Bacteria 6213
191 Ga0466961_0003845 3300044693 Bacteria 9393
192 Ga0453684_0090976 3300044712 Bacteria 3768
193 Ga0466968_0000188 3300044735 Bacteria 18761
194 Ga0466968_0001865 3300044735 Bacteria 7625
195 Ga0466968_0004633 3300044735 Bacteria 5145
196 Ga0466970_0020936 3300044765 Bacteria 3404
197 Ga0466970_0024412 3300044765 Bacteria 3161
198 Ga0466970_0025224 3300044765 Bacteria 3113
199 Ga0466957_0004713 3300044842 Bacteria 7633
200 Ga0466957_0029703 3300044842 Bacteria 3261
201 Ga0466960_0008579 3300044901 Bacteria 4188
202 Ga0466960_0016806 3300044901 Bacteria 3181
203 Ga0466960_0028142 3300044901 Bacteria 2570
204 Ga0466959_0060297 3300045049 Bacteria 2760
205 Ga0466958_0000283 3300045836 Bacteria 19727
206 Ga0466967_0041809 3300045976 Bacteria 3956
207 Ga0466967_0119792 3300045976 Bacteria 2430
208 Ga0495638_0000293 3300046460 Bacteria 65718
209 Ga0495606_0061888 3300046507 Bacteria 2391
210 Ga0495610_0000179 3300046512 Bacteria 70587
211 Ga0495625_0007108 3300046660 Bacteria 9831
212 Ga0495671_0087146 3300046692 Bacteria 1529
213 Ga0495589_0029479 3300046794 Bacteria 2766
214 Ga0495660_0017275 3300046810 Bacteria 4156
215 Ga0495636_0009193 3300047318 Bacteria 3888
216 Ga0496101_0022182 3300048904 Bacteria 4369
217 Ga0496103_0034055 3300048906 Bacteria 3114
218 Ga0496104_0004795 3300048907 Bacteria 11781
219 Ga0496107_0013533 3300048910 Bacteria 5704
220 Ga0496108_0112767 3300048911 Bacteria 2326
221 Ga0496109_0009738 3300048912 Bacteria 8202
222 Ga0496109_0490342 3300048912 Bacteria 1160
223 Ga0496110_0003376 3300048913 Bacteria 12191
224 Ga0496111_0012488 3300048914 Bacteria 5752
225 Ga0496113_0046502 3300048916 Bacteria 3221
226 Ga0501290_000009 3300049513 Bacteria 34459
227 Ga0501290_002076 3300049513 Bacteria 2622
228 Ga0501293_001871 3300049516 Bacteria 1587
229 Ga0501297_002079 3300049520 Bacteria 1912
230 Ga0501300_000003 3300049523 Bacteria 46003
231 Ga0501301_000089 3300049524 Bacteria 4442
232 Ga0501033_0082536 3300049570 Bacteria 2356
233 Ga0501034_0010829 3300049571 Bacteria 9473
234 Ga0501036_0004419 3300049572 Bacteria 11351
235 Ga0501038_0622851 3300049574 Bacteria 815
236 Ga0501039_0035788 3300049575 Bacteria 3832
237 Ga0501043_0000604 3300049579 Bacteria 31726
238 Ga0501070_0013543 3300049586 Bacteria 6875
239 Ga0501074_0002448 3300049590 Bacteria 12946
240 Ga0501206_000046 3300049653 Bacteria 11101
241 Ga0501222_000060 3300049662 Bacteria 34902
242 Ga0501222_004233 3300049662 Bacteria 1950
243 Ga0501223_000173 3300049663 Bacteria 16862
244 Ga0501224_001012 3300049664 Bacteria 3640
245 Ga0501228_002253 3300049666 Bacteria 1494
246 Ga0501235_006251 3300049669 Bacteria 2595
247 Ga0501225_0043035 3300049705 Bacteria 1247
248 Ga0501280_000050 3300049776 Bacteria 34773
249 Ga0501281_02539 3300049777 Bacteria 1331
250 Ga0501282_000009 3300049778 Bacteria 33597
251 Ga0501035_0009280 3300049822 Bacteria 9144
252 nmdc:mga05p37_684139_c1 3300050507 Bacteria 1143
253 nmdc:mga06r32_136671_c1 3300050510 Bacteria 2425
254 nmdc:mga08y16_225141_c1 3300050511 Bacteria 1941
255 nmdc:mga08y16_4945_c1 3300050511 Bacteria 13924
256 nmdc:mga0n895_14038_c1 3300050512 Bacteria 7259
257 nmdc:mga0a205_224199_c1 3300050515 Bacteria 1765
258 Ga0500658_0005738 3300053134 Bacteria 4624
259 Ga0500559_0019006 3300053136 Bacteria 2904
260 Ga0500570_091833 3300053724 Bacteria 1318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0622851 Ga0501038_0622851_11_799 254
2 3300038443 Ga0395901_0659152 Ga0395901_0659152_12_788 258
3 3300048912 Ga0496109_0490342 Ga0496109_0490342_278_1093 267
4 3300035170 Ga0373943_0338005 Ga0373943_0338005_10_843 275
5 3300048904 Ga0496101_0022182 Ga0496101_0022182_3526_4353 275
6 3300050507 nmdc:mga05p37_684139_c1 nmdc:mga05p37_684139_c1_276_1103 275
7 3300031838 Ga0307518_10001375 Ga0307518_1000137521 276
8 iso_pu_bacteria 2501939600 2501944792 286
9 iso_pu_bacteria 2515154129 2515719408 286
10 iso_pu_bacteria 2515154202 2516083747 286
11 iso_pu_bacteria 2547132111 2547412706 286
12 iso_pu_bacteria 2751185734 2753069870 286
13 iso_pu_bacteria 2856858025 2856863707 286
14 iso_pu_bacteria 2870721527 2870727619 286
15 iso_pu_bacteria 649633069 649814535 286
16 3300046810 Ga0495660_0017275 Ga0495660_0017275_2019_2882 287
17 iso_pu_bacteria 2675903060 2676488543 287
18 iso_pu_bacteria 2816332139 2816506425 287
19 3300005435 Ga0070714_100001273 Ga0070714_1000012735 288
20 3300005436 Ga0070713_100020054 Ga0070713_1000200544 288
21 3300025928 Ga0207700_10117651 Ga0207700_101176513 288
22 3300025929 Ga0207664_10003057 Ga0207664_100030579 288
23 3300021361 Ga0213872_10011852 Ga0213872_100118522 289
24 3300031240 Ga0265320_10001814 Ga0265320_100018148 289
25 3300037418 Ga0395900_0283373 Ga0395900_0283373_322_1191 289
26 3300037471 Ga0395905_0001050 Ga0395905_0001050_14068_14937 289
27 3300038443 Ga0395901_0224784 Ga0395901_0224784_20_889 289
28 3300039447 Ga0436361_0735288 Ga0436361_0735288_3626_4495 289
29 3300049513 Ga0501290_000009 Ga0501290_000009_33324_34193 289
30 3300049513 Ga0501290_002076 Ga0501290_002076_910_1779 289
31 3300049516 Ga0501293_001871 Ga0501293_001871_16_885 289
32 3300049520 Ga0501297_002079 Ga0501297_002079_686_1555 289
33 3300049523 Ga0501300_000003 Ga0501300_000003_785_1654 289
34 3300049524 Ga0501301_000089 Ga0501301_000089_558_1427 289
35 3300049570 Ga0501033_0082536 Ga0501033_0082536_536_1408 289
36 3300049571 Ga0501034_0010829 Ga0501034_0010829_3012_3884 289
37 3300049572 Ga0501036_0004419 Ga0501036_0004419_1186_2058 289
38 3300049575 Ga0501039_0035788 Ga0501039_0035788_1740_2612 289
39 3300049579 Ga0501043_0000604 Ga0501043_0000604_15977_16849 289
40 3300049586 Ga0501070_0013543 Ga0501070_0013543_4832_5704 289
41 3300049590 Ga0501074_0002448 Ga0501074_0002448_4455_5327 289
42 3300049653 Ga0501206_000046 Ga0501206_000046_1139_2008 289
43 3300049662 Ga0501222_000060 Ga0501222_000060_33324_34193 289
44 3300049662 Ga0501222_004233 Ga0501222_004233_729_1598 289
45 3300049663 Ga0501223_000173 Ga0501223_000173_15727_16596 289
46 3300049664 Ga0501224_001012 Ga0501224_001012_2150_3019 289
47 3300049666 Ga0501228_002253 Ga0501228_002253_482_1351 289
48 3300049669 Ga0501235_006251 Ga0501235_006251_749_1618 289
49 3300049705 Ga0501225_0043035 Ga0501225_0043035_362_1231 289
50 3300049776 Ga0501280_000050 Ga0501280_000050_33046_33915 289
51 3300049777 Ga0501281_02539 Ga0501281_02539_157_1026 289
52 3300049778 Ga0501282_000009 Ga0501282_000009_703_1572 289
53 3300049822 Ga0501035_0009280 Ga0501035_0009280_7229_8101 289
54 iso_pu_bacteria 2585427649 2586064625 289
55 iso_pu_bacteria 2643221587 2643943190 289
56 iso_pu_bacteria 2643221677 2644430649 289
57 iso_pu_bacteria 2791354901 2791913182 289
58 iso_pu_bacteria 2795385472 2795793327 289
59 iso_pu_bacteria 2808606522 2809586151 289
60 iso_pu_bacteria 2899359706 2899364739 289
61 iso_pu_bacteria 8003314358 8003316459 289
62 iso_pu_bacteria 8047710418 8047717831 289
63 3300003215 JGI25153J46596_10000325 JGI25153J46596_1000032512 290
64 3300005437 Ga0070710_10001326 Ga0070710_100013263 290
65 3300025297 Ga0209758_1000060 Ga0209758_1000060172 290
66 3300025898 Ga0207692_10003788 Ga0207692_100037887 290
67 3300030732 Ga0316176_1189435 Ga0316176_11894358 290
68 3300030733 Ga0314311_1021057 Ga0314311_10210577 290
69 3300031507 Ga0307509_10163858 Ga0307509_101638582 290
70 3300031595 Ga0265313_10000194 Ga0265313_1000019440 290
71 3300042007 Ga0439449_0043914 Ga0439449_0043914_633_1505 290
72 3300044658 Ga0466972_0017050 Ga0466972_0017050_626_1498 290
73 3300044683 Ga0466965_0010428 Ga0466965_0010428_1877_2749 290
74 3300044683 Ga0466965_0024316 Ga0466965_0024316_1048_1920 290
75 3300044712 Ga0453684_0090976 Ga0453684_0090976_366_1238 290
76 3300044735 Ga0466968_0000188 Ga0466968_0000188_17838_18710 290
77 3300044735 Ga0466968_0001865 Ga0466968_0001865_1985_2857 290
78 3300044735 Ga0466968_0004633 Ga0466968_0004633_2600_3472 290
79 3300044842 Ga0466957_0029703 Ga0466957_0029703_56_931 290
80 3300044901 Ga0466960_0008579 Ga0466960_0008579_1201_2073 290
81 3300045976 Ga0466967_0041809 Ga0466967_0041809_2721_3593 290
82 3300046460 Ga0495638_0000293 Ga0495638_0000293_47065_47940 290
83 3300046507 Ga0495606_0061888 Ga0495606_0061888_399_1274 290
84 3300046512 Ga0495610_0000179 Ga0495610_0000179_48201_49076 290
85 3300046660 Ga0495625_0007108 Ga0495625_0007108_897_1772 290
86 3300046692 Ga0495671_0087146 Ga0495671_0087146_365_1240 290
87 3300053134 Ga0500658_0005738 Ga0500658_0005738_2262_3137 290
88 3300053724 Ga0500570_091833 Ga0500570_091833_183_1058 290
89 iso_pu_bacteria 2643221578 2643904213 290
90 iso_pu_bacteria 2643221673 2644402568 290
91 iso_pu_bacteria 2643221714 2644627998 290
92 iso_pu_bacteria 2891326441 2891331568 290
93 iso_pu_bacteria 2899370129 2899373814 290
94 iso_pu_bacteria 2946045630 2946047185 290
95 iso_pu_bacteria 2946072368 2946076801 290
96 3300003771 Ga0055526_1000200 Ga0055526_100020049 291
97 3300005337 Ga0070682_100325823 Ga0070682_1003258231 291
98 3300005347 Ga0070668_100086831 Ga0070668_1000868312 291
99 3300005366 Ga0070659_100063164 Ga0070659_1000631641 291
100 3300005441 Ga0070700_100158689 Ga0070700_1001586892 291
101 3300005466 Ga0070685_10087252 Ga0070685_100872522 291
102 3300005535 Ga0070684_100216563 Ga0070684_1002165632 291
103 3300005548 Ga0070665_100427370 Ga0070665_1004273701 291
104 3300005564 Ga0070664_100068305 Ga0070664_1000683053 291
105 3300005614 Ga0068856_100185066 Ga0068856_1001850662 291
106 3300005618 Ga0068864_100169230 Ga0068864_1001692301 291
107 3300005718 Ga0068866_10081825 Ga0068866_100818252 291
108 3300005834 Ga0068851_10064587 Ga0068851_100645871 291
109 3300005844 Ga0068862_100109346 Ga0068862_1001093462 291
110 3300009094 Ga0111539_10056121 Ga0111539_100561214 291
111 3300009101 Ga0105247_10374828 Ga0105247_103748281 291
112 3300009148 Ga0105243_10151157 Ga0105243_101511572 291
113 3300009553 Ga0105249_10268946 Ga0105249_102689462 291
114 3300010375 Ga0105239_10173201 Ga0105239_101732012 291
115 3300014745 Ga0157377_10030663 Ga0157377_100306633 291
116 3300025295 Ga0209564_1000043 Ga0209564_100004369 291
117 3300025901 Ga0207688_10045072 Ga0207688_100450722 291
118 3300025904 Ga0207647_10119298 Ga0207647_101192982 291
119 3300025908 Ga0207643_10226759 Ga0207643_102267591 291
120 3300025909 Ga0207705_10188375 Ga0207705_101883752 291
121 3300025919 Ga0207657_10158280 Ga0207657_101582802 291
122 3300025926 Ga0207659_10080796 Ga0207659_100807962 291
123 3300025935 Ga0207709_10106125 Ga0207709_101061252 291
124 3300025945 Ga0207679_10173942 Ga0207679_101739423 291
125 3300025981 Ga0207640_10204630 Ga0207640_102046302 291
126 3300026075 Ga0207708_10060416 Ga0207708_100604163 291
127 3300026095 Ga0207676_10444041 Ga0207676_104440412 291
128 3300026116 Ga0207674_10178521 Ga0207674_101785213 291
129 3300026121 Ga0207683_10090923 Ga0207683_100909231 291
130 3300026121 Ga0207683_10187975 Ga0207683_101879752 291
131 3300026142 Ga0207698_10043691 Ga0207698_100436912 291
132 3300027907 Ga0207428_10187771 Ga0207428_101877712 291
133 3300028381 Ga0268264_10178126 Ga0268264_101781262 291
134 3300031456 Ga0307513_10014835 Ga0307513_100148352 291
135 3300036401 Ga0373937_0185854 Ga0373937_0185854_722_1609 291
136 3300037853 Ga0436364_1186806 Ga0436364_1186806_646_1521 291
137 3300039437 Ga0436365_1508967 Ga0436365_1508967_157_1032 291
138 3300039453 Ga0436362_0358937 Ga0436362_0358937_34703_35578 291
139 3300045976 Ga0466967_0119792 Ga0466967_0119792_845_1732 291
140 3300050511 nmdc:mga08y16_225141_c1 nmdc:mga08y16_225141_c1_934_1821 291
141 iso_pu_bacteria 2515154203 2516088110 291
142 iso_pu_bacteria 2784746763 2785343632 291
143 iso_pu_bacteria 2868088558 2868090929 291
144 iso_pu_bacteria 8047893842 8047903938 291
145 iso_pu_bacteria 8048369669 8048379558 291
146 iso_pu_bacteria 8048379754 8048389720 291
147 iso_pu_bacteria 8048406513 8048408312 291
148 iso_pu_bacteria 8056060235 8056064639 291
149 3300007076 Ga0075435_100020382 Ga0075435_1000203822 292
150 3300035086 Ga0373934_0069131 Ga0373934_0069131_257_1135 292
151 3300035119 Ga0373956_0004581 Ga0373956_0004581_1180_2058 292
152 3300035172 Ga0373955_0082972 Ga0373955_0082972_603_1481 292
153 3300003203 JGI25406J46586_10000837 JGI25406J46586_100008377 293
154 3300005347 Ga0070668_100002153 Ga0070668_10000215312 293
155 3300005356 Ga0070674_100245171 Ga0070674_1002451712 293
156 3300005455 Ga0070663_100007038 Ga0070663_1000070387 293
157 3300005719 Ga0068861_100117188 Ga0068861_1001171882 293
158 3300005983 Ga0081540_1045527 Ga0081540_10455272 293
159 3300005985 Ga0081539_10000132 Ga0081539_10000132183 293
160 3300006844 Ga0075428_100000138 Ga0075428_10000013852 293
161 3300006948 Ga0099826_10100471 Ga0099826_101004712 293
162 3300021388 Ga0213875_10001297 Ga0213875_1000129713 293
163 3300025929 Ga0207664_10236254 Ga0207664_102362542 293
164 3300025961 Ga0207712_10389785 Ga0207712_103897852 293
165 3300026067 Ga0207678_10000264 Ga0207678_1000026442 293
166 3300026118 Ga0207675_100426145 Ga0207675_1004261451 293
167 3300028794 Ga0307515_10165126 Ga0307515_101651264 293
168 3300037853 Ga0436364_0145178 Ga0436364_0145178_7551_8432 293
169 3300044658 Ga0466972_0002803 Ga0466972_0002803_5649_6530 293
170 3300044765 Ga0466970_0020936 Ga0466970_0020936_851_1732 293
171 3300044765 Ga0466970_0024412 Ga0466970_0024412_395_1276 293
172 3300044901 Ga0466960_0016806 Ga0466960_0016806_322_1203 293
173 3300044901 Ga0466960_0028142 Ga0466960_0028142_676_1557 293
174 3300053136 Ga0500559_0019006 Ga0500559_0019006_1117_1998 293
175 iso_pu_bacteria 2915768154 2915768467 293
176 3300005616 Ga0068852_100168278 Ga0068852_1001682782 294
177 3300005937 Ga0081455_10035426 Ga0081455_100354263 294
178 3300009551 Ga0105238_10064636 Ga0105238_100646362 294
179 3300025924 Ga0207694_10215841 Ga0207694_102158412 294
180 3300025937 Ga0207669_10465117 Ga0207669_104651172 294
181 3300030521 Ga0307511_10042303 Ga0307511_100423036 294
182 3300031824 Ga0307413_10001375 Ga0307413_100013758 294
183 3300001976 JGI24752J21851_1006401 JGI24752J21851_10064012 295
184 3300005328 Ga0070676_10105648 Ga0070676_101056482 295
185 3300005331 Ga0070670_100006150 Ga0070670_1000061508 295
186 3300005334 Ga0068869_100000879 Ga0068869_10000087914 295
187 3300005335 Ga0070666_10326237 Ga0070666_103262371 295
188 3300005339 Ga0070660_100003828 Ga0070660_1000038282 295
189 3300005341 Ga0070691_10002087 Ga0070691_100020876 295
190 3300005345 Ga0070692_10136166 Ga0070692_101361661 295
191 3300005354 Ga0070675_100003936 Ga0070675_1000039365 295
192 3300005434 Ga0070709_10097061 Ga0070709_100970611 295
193 3300005435 Ga0070714_100286230 Ga0070714_1002862301 295
194 3300005436 Ga0070713_100005038 Ga0070713_1000050384 295
195 3300005441 Ga0070700_100009855 Ga0070700_1000098554 295
196 3300005456 Ga0070678_100076572 Ga0070678_1000765722 295
197 3300005530 Ga0070679_100009168 Ga0070679_1000091688 295
198 3300005539 Ga0068853_100101492 Ga0068853_1001014922 295
199 3300005539 Ga0068853_100322700 Ga0068853_1003227002 295
200 3300005547 Ga0070693_100000597 Ga0070693_1000005974 295
201 3300005578 Ga0068854_100021494 Ga0068854_1000214941 295
202 3300005614 Ga0068856_100132701 Ga0068856_1001327012 295
203 3300005615 Ga0070702_100006290 Ga0070702_1000062904 295
204 3300005834 Ga0068851_10006096 Ga0068851_100060965 295
205 3300005842 Ga0068858_100008068 Ga0068858_1000080681 295
206 3300006028 Ga0070717_10260228 Ga0070717_102602282 295
207 3300006058 Ga0075432_10009775 Ga0075432_100097753 295
208 3300006175 Ga0070712_100065369 Ga0070712_1000653694 295
209 3300006852 Ga0075433_10066262 Ga0075433_100662622 295
210 3300006871 Ga0075434_100050542 Ga0075434_1000505424 295
211 3300006880 Ga0075429_100051781 Ga0075429_1000517815 295
212 3300006914 Ga0075436_100008915 Ga0075436_1000089155 295
213 3300009011 Ga0105251_10011819 Ga0105251_100118192 295
214 3300009101 Ga0105247_10029750 Ga0105247_100297503 295
215 3300009147 Ga0114129_10057751 Ga0114129_100577512 295
216 3300009147 Ga0114129_10122786 Ga0114129_101227863 295
217 3300009174 Ga0105241_10011823 Ga0105241_100118235 295
218 3300009177 Ga0105248_10150471 Ga0105248_101504714 295
219 3300009545 Ga0105237_10116605 Ga0105237_101166053 295
220 3300009551 Ga0105238_10039331 Ga0105238_100393315 295
221 3300010375 Ga0105239_10051378 Ga0105239_100513784 295
222 3300011119 Ga0105246_10008501 Ga0105246_100085015 295
223 3300013100 Ga0157373_10033472 Ga0157373_100334722 295
224 3300013105 Ga0157369_10012854 Ga0157369_100128548 295
225 3300013296 Ga0157374_10004351 Ga0157374_1000435111 295
226 3300013307 Ga0157372_10010042 Ga0157372_100100422 295
227 3300014745 Ga0157377_10001471 Ga0157377_100014719 295
228 3300020081 Ga0206354_10914270 Ga0206354_109142704 295
229 3300021361 Ga0213872_10000954 Ga0213872_100009548 295
230 3300021361 Ga0213872_10004386 Ga0213872_100043865 295
231 3300021361 Ga0213872_10008894 Ga0213872_100088945 295
232 3300021361 Ga0213872_10014916 Ga0213872_100149164 295
233 3300021361 Ga0213872_10019652 Ga0213872_100196523 295
234 3300021361 Ga0213872_10024217 Ga0213872_100242172 295
235 3300021361 Ga0213872_10096291 Ga0213872_100962912 295
236 3300022467 Ga0224712_10011116 Ga0224712_100111162 295
237 3300025901 Ga0207688_10000331 Ga0207688_1000033111 295
238 3300025907 Ga0207645_10159354 Ga0207645_101593542 295
239 3300025908 Ga0207643_10000104 Ga0207643_1000010423 295
240 3300025909 Ga0207705_10051573 Ga0207705_100515733 295
241 3300025911 Ga0207654_10004395 Ga0207654_100043955 295
242 3300025914 Ga0207671_10054781 Ga0207671_100547812 295
243 3300025917 Ga0207660_10025272 Ga0207660_100252724 295
244 3300025919 Ga0207657_10049172 Ga0207657_100491725 295
245 3300025920 Ga0207649_10085949 Ga0207649_100859493 295
246 3300025925 Ga0207650_10013711 Ga0207650_100137115 295
247 3300025927 Ga0207687_10087043 Ga0207687_100870434 295
248 3300025929 Ga0207664_10231695 Ga0207664_102316952 295
249 3300025931 Ga0207644_10012297 Ga0207644_100122974 295
250 3300025941 Ga0207711_10185260 Ga0207711_101852602 295
251 3300025942 Ga0207689_10002741 Ga0207689_100027418 295
252 3300025944 Ga0207661_10004177 Ga0207661_100041772 295
253 3300025945 Ga0207679_10010857 Ga0207679_100108572 295
254 3300026035 Ga0207703_10068942 Ga0207703_100689422 295
255 3300026067 Ga0207678_10000105 Ga0207678_1000010560 295
256 3300026075 Ga0207708_10016732 Ga0207708_100167324 295
257 3300026078 Ga0207702_10002074 Ga0207702_100020748 295
258 3300026078 Ga0207702_10048977 Ga0207702_100489773 295
259 3300026088 Ga0207641_10142310 Ga0207641_101423101 295
260 3300026095 Ga0207676_10000838 Ga0207676_1000083823 295
261 3300026121 Ga0207683_10000092 Ga0207683_100000922 295
262 3300028379 Ga0268266_10102349 Ga0268266_101023493 295
263 3300033179 Ga0307507_10047174 Ga0307507_100471745 295
264 3300037466 Ga0395898_0205012 Ga0395898_0205012_453_1340 295
265 3300039447 Ga0436361_0044538 Ga0436361_0044538_949_1842 295
266 3300039447 Ga0436361_0151690 Ga0436361_0151690_5260_6153 295
267 3300039447 Ga0436361_0451336 Ga0436361_0451336_1142_2035 295
268 3300039447 Ga0436361_1065122 Ga0436361_1065122_1214_2107 295
269 3300041999 Ga0439433_0010652 Ga0439433_0010652_299_1246 295
270 3300042005 Ga0439448_0008139 Ga0439448_0008139_1222_2109 295
271 3300042014 Ga0439457_000254 Ga0439457_000254_11041_11988 295
272 3300042137 Ga0450902_001151 Ga0450902_001151_836_1723 295
273 3300042438 Ga0439459_0002057 Ga0439459_0002057_1768_2655 295
274 3300044656 Ga0466969_0001865 Ga0466969_0001865_7207_8100 295
275 3300044683 Ga0466965_0148541 Ga0466965_0148541_178_1071 295
276 3300044684 Ga0466966_0010267 Ga0466966_0010267_1741_2634 295
277 3300044693 Ga0466961_0003845 Ga0466961_0003845_3361_4254 295
278 3300044765 Ga0466970_0025224 Ga0466970_0025224_479_1372 295
279 3300044842 Ga0466957_0004713 Ga0466957_0004713_5616_6509 295
280 3300045049 Ga0466959_0060297 Ga0466959_0060297_1792_2685 295
281 3300045836 Ga0466958_0000283 Ga0466958_0000283_5558_6451 295
282 3300046794 Ga0495589_0029479 Ga0495589_0029479_1411_2313 295
283 3300047318 Ga0495636_0009193 Ga0495636_0009193_472_1374 295
284 3300048906 Ga0496103_0034055 Ga0496103_0034055_2154_3041 295
285 3300048907 Ga0496104_0004795 Ga0496104_0004795_2087_2974 295
286 3300048910 Ga0496107_0013533 Ga0496107_0013533_4161_5048 295
287 3300048911 Ga0496108_0112767 Ga0496108_0112767_332_1219 295
288 3300048912 Ga0496109_0009738 Ga0496109_0009738_2856_3743 295
289 3300048913 Ga0496110_0003376 Ga0496110_0003376_311_1198 295
290 3300048914 Ga0496111_0012488 Ga0496111_0012488_4513_5400 295
291 3300048916 Ga0496113_0046502 Ga0496113_0046502_610_1497 295
292 3300050510 nmdc:mga06r32_136671_c1 nmdc:mga06r32_136671_c1_1206_2093 295
293 3300050511 nmdc:mga08y16_4945_c1 nmdc:mga08y16_4945_c1_11271_12158 295
294 3300050512 nmdc:mga0n895_14038_c1 nmdc:mga0n895_14038_c1_4837_5724 295
295 3300050515 nmdc:mga0a205_224199_c1 nmdc:mga0a205_224199_c1_483_1370 295
296 iso_pu_bacteria 2808606448 2809230246 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

1

235

0.98

PF12804

NTP_transf_3

MobA-like NTP transferase domain

1

166

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mc3-assembly1.cif.gz_A crystal structure of rffh 0.9842 1 284
3pkq-assembly3.cif.gz_C q83d variant of s. enterica rmla with dgtp 0.9832 1 285
3pkq-assembly3.cif.gz_D q83d variant of s. enterica rmla with dgtp 0.983 1 285
3pkq-assembly2.cif.gz_B q83d variant of s. enterica rmla with dgtp 0.9826 2 285
4hoc-assembly1.cif.gz_A crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n-acetylglucosamine 0.9824 1 286
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9762 2 286 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9467 2 286 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9464 2 237 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9078 1 222 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8979 2 237 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V9PIY8-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1 2 116 GO:0008879
GO:0045226
AF-A0A351VA12-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1 1 111 GO:0008879
GO:0045226
AF-A0A7Z8ZF85-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9963 1 106 GO:0008879
GO:0045226
AF-A0A7X5WD99-F1-model_v4 deleted 0.9946 2 208
AF-A0A2V8EYQ2-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9944 1 144 GO:0008879
GO:0045226

Feature Viewer

pLDDT pTM Quality
94.62 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map