F393164

General Info

Members Datasets Scaffolds Average Seq Length
296 239 592 124

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10642868|Ga0105237_106428682
Length 144
Sequence MFLICSYREMTDRPASWRMPTPKQMEKMAALVGGKASPAHGLAPSDDLPREYWESLLRDAGADETVNRGEAVPGTRLQLNQIAEHVLRVACSRCGRTVEIQRLDAVRLYGPNAVWKVVGQRLLDNTCQQRTGRHEEDGCWPQFE

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
21 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
24 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
41 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
42 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
43 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
61 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
62 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
86 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
87 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
88 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
89 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
119 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
169 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
172 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
179 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
180 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
183 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
186 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
190 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
191 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
192 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
193 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
194 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
195 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
196 2643221651 Afipia sp. Root123D2 Isolate Unclassified
197 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
198 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
199 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
200 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
201 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
202 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
203 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
204 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
205 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
206 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
207 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
208 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
209 2906610324
210 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
211 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
212 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
213 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
214 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
215 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
216 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
217 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
218 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
219 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
220 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
221 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
222 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
223 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
224 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
225 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
226 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
227 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
228 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
229 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
230 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
231 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
232 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
233 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
234 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
235 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
236 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
237 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
238 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
239 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.69
Metatranscriptomes 0
Isolates 18.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.85
Nodule 19.59
Rhizoplane 3.38
Rhizosphere 52.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10642868 3300009545 Bacteria 1068
2 JGI25153J46596_10035413 3300003215 Bacteria 1617
3 JGI25160J50197_1007797 3300003354 Bacteria 4147
4 Ga0065165_1016157 3300005262 Bacteria 2809
5 Ga0070676_10542007 3300005328 Bacteria 832
6 Ga0070691_10530760 3300005341 Bacteria 685
7 Ga0070668_100021620 3300005347 Bacteria 4860
8 Ga0070668_100048762 3300005347 Bacteria 3257
9 Ga0070668_100206959 3300005347 Bacteria 1612
10 Ga0070668_102069889 3300005347 Bacteria 525
11 Ga0070668_102218117 3300005347 Bacteria 507
12 Ga0070713_100067045 3300005436 Bacteria 3020
13 Ga0070713_100069608 3300005436 Bacteria 2968
14 Ga0070694_100543078 3300005444 Bacteria 930
15 Ga0070663_100659557 3300005455 Bacteria 886
16 Ga0070663_101374981 3300005455 Bacteria 625
17 Ga0068867_101021165 3300005459 Bacteria 751
18 Ga0070672_100411964 3300005543 Bacteria 1160
19 Ga0070686_100669263 3300005544 Bacteria 825
20 Ga0070695_100781303 3300005545 Bacteria 764
21 Ga0070665_100440146 3300005548 Bacteria 1313
22 Ga0070665_100629535 3300005548 Bacteria 1086
23 Ga0070665_100672310 3300005548 Bacteria 1048
24 Ga0068861_100391645 3300005719 Bacteria 1231
25 Ga0068858_100960588 3300005842 Bacteria 837
26 Ga0081540_1058268 3300005983 Bacteria 1862
27 Ga0075364_10475819 3300006051 Bacteria 854
28 Ga0099824_1028895 3300006942 Bacteria 2442
29 Ga0099823_1007279 3300006944 Bacteria 11223
30 Ga0099823_1007577 3300006944 Bacteria 11027
31 Ga0099794_10200210 3300007265 Bacteria 1023
32 Ga0099795_10380362 3300007788 Bacteria 637
33 Ga0105250_10228033 3300009092 Bacteria 792
34 Ga0105240_10000601 3300009093 Bacteria 66871
35 Ga0105243_12912939 3300009148 Bacteria 519
36 Ga0105248_10511513 3300009177 Bacteria 1354
37 Ga0105237_10920287 3300009545 Bacteria 881
38 Ga0105238_11697087 3300009551 Bacteria 663
39 Ga0105239_10185397 3300010375 Bacteria 2329
40 Ga0105239_11208571 3300010375 Bacteria 871
41 Ga0105239_13346262 3300010375 Bacteria 522
42 Ga0105246_10169272 3300011119 Bacteria 1672
43 Ga0157369_11065705 3300013105 Bacteria 827
44 Ga0157369_12148501 3300013105 Bacteria 566
45 Ga0157378_11195886 3300013297 Bacteria 799
46 Ga0163162_10026477 3300013306 Bacteria 5731
47 Ga0163162_10847334 3300013306 Bacteria 1029
48 Ga0157375_10592155 3300013308 Bacteria 1269
49 Ga0157375_12798886 3300013308 Bacteria 583
50 Ga0163163_11854391 3300014325 Bacteria 663
51 Ga0163163_12928005 3300014325 Bacteria 533
52 Ga0157380_10428063 3300014326 Bacteria 1264
53 Ga0157379_10023906 3300014968 Bacteria 5425
54 Ga0157379_10628158 3300014968 Bacteria 1004
55 Ga0157376_11866541 3300014969 Bacteria 638
56 Ga0157376_11872470 3300014969 Bacteria 637
57 Ga0163161_10898880 3300017792 Bacteria 750
58 Ga0214544_1001612 3300021320 Bacteria 47417
59 Ga0214544_1002635 3300021320 Bacteria 37597
60 Ga0214542_1001530 3300021321 Bacteria 47452
61 Ga0214542_1003206 3300021321 Bacteria 33676
62 Ga0214545_1009095 3300021324 Bacteria 15349
63 Ga0214545_1044889 3300021324 Bacteria 1034
64 Ga0214543_1001715 3300021327 Bacteria 42878
65 Ga0213876_10000511 3300021384 Bacteria 29990
66 Ga0209233_1011363 3300025261 Bacteria 2625
67 Ga0209233_1018739 3300025261 Bacteria 1855
68 Ga0209758_1001287 3300025297 Bacteria 30893
69 Ga0207426_1000653 3300025302 Bacteria 42624
70 Ga0207426_1006725 3300025302 Bacteria 4928
71 Ga0207695_10000006 3300025913 Bacteria 1135309
72 Ga0207671_10545833 3300025914 Bacteria 924
73 Ga0207693_10177256 3300025915 Bacteria 1677
74 Ga0207700_10015808 3300025928 Bacteria 4992
75 Ga0207709_11314714 3300025935 Bacteria 598
76 Ga0207709_11816066 3300025935 Bacteria 507
77 Ga0207711_10163498 3300025941 Bacteria 2016
78 Ga0207712_10173544 3300025961 Bacteria 1687
79 Ga0207668_10010599 3300025972 Bacteria 5576
80 Ga0207668_10254299 3300025972 Bacteria 1428
81 Ga0207668_11523827 3300025972 Bacteria 603
82 Ga0207678_10371911 3300026067 Bacteria 1235
83 Ga0207708_10691332 3300026075 Bacteria 871
84 Ga0207675_100087141 3300026118 Bacteria 2932
85 Ga0207675_100234880 3300026118 Bacteria 1770
86 Ga0207683_10223410 3300026121 Bacteria 1716
87 Ga0209389_1000045 3300027296 Bacteria 118598
88 Ga0209389_1000132 3300027296 Bacteria 66230
89 Ga0209489_107025 3300027361 Bacteria 17337
90 Ga0209588_1217687 3300027671 Bacteria 591
91 Ga0268266_10104594 3300028379 Bacteria 2500
92 Ga0268266_10525859 3300028379 Bacteria 1131
93 Ga0268266_10569775 3300028379 Bacteria 1086
94 Ga0268265_10107765 3300028380 Bacteria 2266
95 Ga0265334_10088353 3300028573 Bacteria 1134
96 Ga0307517_10493058 3300028786 Bacteria 625
97 Ga0265340_10143214 3300031247 Bacteria 1093
98 Ga0265339_10422292 3300031249 Bacteria 621
99 Ga0265331_10096955 3300031250 Bacteria 1360
100 Ga0307509_10334352 3300031507 Bacteria 1245
101 Ga0307509_10619671 3300031507 Bacteria 753
102 Ga0307408_101098310 3300031548 Bacteria 738
103 Ga0307516_10000457 3300031730 Bacteria 54103
104 Ga0307516_10087867 3300031730 Bacteria 2942
105 Ga0307516_10272881 3300031730 Bacteria 1376
106 Ga0307405_10240347 3300031731 Bacteria 1341
107 Ga0307413_11906333 3300031824 Bacteria 534
108 Ga0307410_10750303 3300031852 Bacteria 826
109 Ga0307406_11032113 3300031901 Bacteria 707
110 Ga0307406_11234452 3300031901 Bacteria 650
111 Ga0307409_100156971 3300031995 Bacteria 1984
112 Ga0307416_100738180 3300032002 Bacteria 1076
113 Ga0307416_101520608 3300032002 Bacteria 775
114 Ga0307414_10700917 3300032004 Bacteria 917
115 Ga0307415_100137436 3300032126 Bacteria 1861
116 Ga0315911_1000006 3300033442 Bacteria 414563
117 Ga0315911_1000012 3300033442 Bacteria 248988
118 Ga0373931_0276758 3300035691 Bacteria 1029
119 Ga0373935_0644873 3300035692 Bacteria 777
120 Ga0436365_1380188 3300039437 Bacteria 31102
121 Ga0439465_0422841 3300041413 Bacteria 509
122 Ga0451804_0837676 3300041463 Bacteria 832
123 Ga0451837_0325445 3300041494 Bacteria 620
124 Ga0451841_0615128 3300041498 Bacteria 514
125 Ga0451845_0518151 3300041501 Bacteria 534
126 Ga0466972_0013186 3300044658 Bacteria 4151
127 Ga0466972_0141930 3300044658 Bacteria 1130
128 Ga0466966_0000594 3300044684 Bacteria 22979
129 Ga0466961_0120470 3300044693 Bacteria 1648
130 Ga0466961_0434666 3300044693 Bacteria 795
131 Ga0466963_0111928 3300044694 Bacteria 1875
132 Ga0466970_0277825 3300044765 Bacteria 942
133 Ga0466960_0153326 3300044901 Bacteria 1233
134 Ga0495617_071976 3300046452 Bacteria 1137
135 Ga0495603_0481785 3300046455 Bacteria 710
136 Ga0495629_0570502 3300046459 Bacteria 758
137 Ga0495638_0061488 3300046460 Bacteria 2321
138 Ga0495638_0192466 3300046460 Bacteria 1157
139 Ga0495638_0610288 3300046460 Bacteria 535
140 Ga0495664_0229849 3300046477 Bacteria 1123
141 Ga0495610_0208884 3300046512 Bacteria 795
142 Ga0495610_0313765 3300046512 Bacteria 601
143 Ga0495620_0216737 3300046515 Bacteria 733
144 Ga0495631_0171801 3300046518 Bacteria 929
145 Ga0495643_0111752 3300046522 Bacteria 1389
146 Ga0495644_0198650 3300046523 Bacteria 773
147 Ga0495648_0130033 3300046524 Bacteria 1340
148 Ga0495659_0258402 3300046664 Bacteria 727
149 Ga0495661_0449476 3300046665 Bacteria 620
150 Ga0495658_0454112 3300046683 Bacteria 819
151 Ga0495670_0379277 3300046691 Bacteria 763
152 Ga0495671_0253917 3300046692 Bacteria 848
153 Ga0495660_0109791 3300046810 Bacteria 1409
154 Ga0495581_0288267 3300047315 Bacteria 960
155 Ga0495604_0551469 3300047317 Bacteria 743
156 Ga0495677_0217118 3300047445 Bacteria 745
157 Ga0495686_0415745 3300047472 Bacteria 719
158 Ga0495614_0404521 3300048089 Bacteria 642
159 Ga0495615_0235104 3300048090 Bacteria 576
160 Ga0495626_0254914 3300048091 Bacteria 703
161 Ga0496101_0465404 3300048904 Bacteria 998
162 Ga0496102_0116572 3300048905 Bacteria 2492
163 Ga0496104_1257130 3300048907 Bacteria 643
164 Ga0496106_0682425 3300048909 Bacteria 819
165 Ga0496109_1091715 3300048912 Bacteria 735
166 Ga0496110_0160524 3300048913 Bacteria 2038
167 Ga0496112_0261343 3300048915 Bacteria 1680
168 Ga0496113_0961149 3300048916 Bacteria 674
169 Ga0496115_0136048 3300048918 Bacteria 2026
170 Ga0496120_0339949 3300048923 Bacteria 677
171 Ga0496121_0311272 3300048924 Bacteria 1064
172 Ga0496121_0638464 3300048924 Bacteria 651
173 Ga0496122_0058007 3300048925 Bacteria 2870
174 Ga0496124_0348915 3300048927 Bacteria 1048
175 Ga0496125_0165694 3300048928 Bacteria 1494
176 Ga0496126_0132850 3300048929 Bacteria 2149
177 Ga0496126_0134665 3300048929 Bacteria 2132
178 Ga0496126_0331096 3300048929 Bacteria 1250
179 Ga0501031_0035093 3300049568 Bacteria 3271
180 Ga0501032_0000069 3300049569 Bacteria 86501
181 Ga0501033_0000062 3300049570 Bacteria 102791
182 Ga0501034_0000496 3300049571 Bacteria 63793
183 Ga0501036_0000086 3300049572 Bacteria 58349
184 Ga0501037_0000087 3300049573 Bacteria 85372
185 Ga0501038_0000067 3300049574 Bacteria 85978
186 Ga0501039_0000059 3300049575 Bacteria 85852
187 Ga0501041_0327678 3300049577 Bacteria 966
188 Ga0501042_0114271 3300049578 Bacteria 1944
189 Ga0501043_0000392 3300049579 Bacteria 39423
190 Ga0501046_0008174 3300049580 Bacteria 9141
191 Ga0501047_0000146 3300049581 Bacteria 85790
192 Ga0501048_0000034 3300049582 Bacteria 64683
193 Ga0501067_0000060 3300049583 Bacteria 63335
194 Ga0501068_0002609 3300049584 Bacteria 9546
195 Ga0501069_0000046 3300049585 Bacteria 74811
196 Ga0501070_0000073 3300049586 Bacteria 85801
197 Ga0501071_0228470 3300049587 Bacteria 1401
198 Ga0501072_0004128 3300049588 Bacteria 10992
199 Ga0501073_0000253 3300049589 Bacteria 35227
200 Ga0501074_0000025 3300049590 Bacteria 68500
201 Ga0501076_0119998 3300049592 Bacteria 2129
202 Ga0501080_0000037 3300049742 Bacteria 82435
203 Ga0501083_0000082 3300049744 Bacteria 64305
204 Ga0501035_0000141 3300049822 Bacteria 87831
205 Ga0501044_0000151 3300049823 Bacteria 85867
206 Ga0501045_0058622 3300049824 Bacteria 2820
207 nmdc:mga0yw44_1120830_c1 3300050492 Bacteria 531
208 nmdc:mga0yw44_21592_c1 3300050492 Bacteria 3594
209 nmdc:mga0yw44_77377_c1 3300050492 Bacteria 2078
210 Ga0495655_0081746 3300053083 Bacteria 925
211 Ga0500578_0275717 3300053086 Bacteria 1005
212 Ga0500578_0712631 3300053086 Bacteria 539
213 Ga0500643_036947 3300053087 Bacteria 1457
214 Ga0500644_0037104 3300053088 Bacteria 1591
215 Ga0500650_0137250 3300053098 Bacteria 1135
216 Ga0500594_0251561 3300053118 Bacteria 588
217 Ga0500595_002028 3300053119 Bacteria 10347
218 Ga0500595_005290 3300053119 Bacteria 5656
219 Ga0500595_059518 3300053119 Bacteria 1158
220 Ga0500607_166392 3300053121 Bacteria 1000
221 Ga0500614_015836 3300053123 Bacteria 1685
222 Ga0500642_0114427 3300053130 Bacteria 1260
223 Ga0500658_0186638 3300053134 Bacteria 945
224 Ga0500658_0347627 3300053134 Bacteria 681
225 Ga0500559_0108167 3300053136 Bacteria 1286
226 Ga0500568_0119708 3300053139 Bacteria 981
227 Ga0500577_0032211 3300053142 Bacteria 1841
228 Ga0500588_0316304 3300053146 Bacteria 592
229 Ga0500589_267884 3300053147 Bacteria 619
230 Ga0500604_0128613 3300053151 Bacteria 851
231 Ga0500616_0014048 3300053153 Bacteria 4617
232 Ga0500633_0039258 3300053160 Bacteria 1582
233 Ga0500637_0349049 3300053178 Bacteria 788
234 Ga0500637_0386377 3300053178 Bacteria 732
235 Ga0500637_0434260 3300053178 Bacteria 671
236 Ga0500645_034969 3300053730 Bacteria 1499
237 Ga0500645_081285 3300053730 Bacteria 924
238 Ga0500596_078172 3300053735 Bacteria 573
239 Ga0500599_003215 3300053736 Bacteria 1989
240 Ga0501084_0004949 3300054114 Bacteria 10890
241 Ga0501082_0002309 3300060353 Bacteria 16686
242 2508693182 2508501042 Bacteria 8719808
243 2513622126 2513237092 Bacteria 8341956
244 2513642687 2513237094 Bacteria 8789602
245 2513920463 2513237145 Bacteria 8979722
246 2514014310 2513237161 Bacteria 8871253
247 2517890236 2517572143 Bacteria 9484767
248 2517894976 2517572143 Bacteria 9484767
249 2617350360 2617270735 Bacteria 9163226
250 2644290383 2643221651 Bacteria 4798932
251 2824669970 2824661429 Bacteria 9877870
252 2824746214 2824746037 Bacteria 7911610
253 2838131108 2838122688 Bacteria 8803140
254 2841982560 2841974524 Bacteria 8931498
255 2847932629 2847930680 Bacteria 9342022
256 2874625528 2874620515 Bacteria 8290088
257 2879084052 2879083081 Bacteria 8587928
258 2879127895 2879127579 Bacteria 8294491
259 2879143788 2879142872 Bacteria 8267021
260 2889038599 2889033259 Bacteria 9099371
261 2903774421 2903768456 Bacteria 9749579
262 2904670512 2904666416 Bacteria 8226587
263 2906618893
264 2906664893 2906660503 Bacteria 8595048
265 2932801583 2932794094 Bacteria 7915132
266 2932816149 2932809354 Bacteria 9135765
267 2932825028 2932818245 Bacteria 9955613
268 2933582148 2933577622 Bacteria 9116884
269 2935647895 2935638405 Bacteria 10015038
270 2935694183 2935684952 Bacteria 9590419
271 2935713272 2935703347 Bacteria 10242284
272 2935722798 2935713505 Bacteria 9608509
273 2935732079 2935722832 Bacteria 9608746
274 2935739377 2935732158 Bacteria 9706831
275 2935741468 2935732158 Bacteria 9706831
276 2935748415 2935741537 Bacteria 9707219
277 2935750871 2935741537 Bacteria 9707219
278 2935760168 2935750917 Bacteria 9590372
279 2935775772 2935769743 Bacteria 7878163
280 2935777324 2935769743 Bacteria 7878163
281 2935810348 2935801545 Bacteria 9301974
282 2935837379 2935827899 Bacteria 10038562
283 2935873400 2935864058 Bacteria 9784707
284 2935915362 2935908558 Bacteria 8568796
285 2935933706 2935926038 Bacteria 8601059
286 2935941349 2935934488 Bacteria 8602579
287 2935949592 2935942939 Bacteria 8599779
288 2935958233 2935951376 Bacteria 8602333
289 2935975148 2935967501 Bacteria 8603075
290 2940566101 2940556831 Bacteria 9590747
291 8006994067 8006984368 Bacteria 9651211
292 8019594666 8019586578 Bacteria 10212056
293 8019610521 8019608314 Bacteria 10042931
294 8019651107 8019648815 Bacteria 10014479
295 8019695910 8019687851 Bacteria 8712826
296 8056974264 8056967851 Bacteria 9038162
297 Ga0105237_10642868
298 JGI25153J46596_10035413
299 JGI25160J50197_1007797
300 Ga0065165_1016157
301 Ga0070676_10542007
302 Ga0070691_10530760
303 Ga0070668_100021620
304 Ga0070668_100048762
305 Ga0070668_100206959
306 Ga0070668_102069889
307 Ga0070668_102218117
308 Ga0070713_100067045
309 Ga0070713_100069608
310 Ga0070694_100543078
311 Ga0070663_100659557
312 Ga0070663_101374981
313 Ga0068867_101021165
314 Ga0070672_100411964
315 Ga0070686_100669263
316 Ga0070695_100781303
317 Ga0070665_100440146
318 Ga0070665_100629535
319 Ga0070665_100672310
320 Ga0068861_100391645
321 Ga0068858_100960588
322 Ga0081540_1058268
323 Ga0075364_10475819
324 Ga0099824_1028895
325 Ga0099823_1007279
326 Ga0099823_1007577
327 Ga0099794_10200210
328 Ga0099795_10380362
329 Ga0105250_10228033
330 Ga0105240_10000601
331 Ga0105243_12912939
332 Ga0105248_10511513
333 Ga0105237_10920287
334 Ga0105238_11697087
335 Ga0105239_10185397
336 Ga0105239_11208571
337 Ga0105239_13346262
338 Ga0105246_10169272
339 Ga0157369_11065705
340 Ga0157369_12148501
341 Ga0157378_11195886
342 Ga0163162_10026477
343 Ga0163162_10847334
344 Ga0157375_10592155
345 Ga0157375_12798886
346 Ga0163163_11854391
347 Ga0163163_12928005
348 Ga0157380_10428063
349 Ga0157379_10023906
350 Ga0157379_10628158
351 Ga0157376_11866541
352 Ga0157376_11872470
353 Ga0163161_10898880
354 Ga0214544_1001612
355 Ga0214544_1002635
356 Ga0214542_1001530
357 Ga0214542_1003206
358 Ga0214545_1009095
359 Ga0214545_1044889
360 Ga0214543_1001715
361 Ga0213876_10000511
362 Ga0209233_1011363
363 Ga0209233_1018739
364 Ga0209758_1001287
365 Ga0207426_1000653
366 Ga0207426_1006725
367 Ga0207695_10000006
368 Ga0207671_10545833
369 Ga0207693_10177256
370 Ga0207700_10015808
371 Ga0207709_11314714
372 Ga0207709_11816066
373 Ga0207711_10163498
374 Ga0207712_10173544
375 Ga0207668_10010599
376 Ga0207668_10254299
377 Ga0207668_11523827
378 Ga0207678_10371911
379 Ga0207708_10691332
380 Ga0207675_100087141
381 Ga0207675_100234880
382 Ga0207683_10223410
383 Ga0209389_1000045
384 Ga0209389_1000132
385 Ga0209489_107025
386 Ga0209588_1217687
387 Ga0268266_10104594
388 Ga0268266_10525859
389 Ga0268266_10569775
390 Ga0268265_10107765
391 Ga0265334_10088353
392 Ga0307517_10493058
393 Ga0265340_10143214
394 Ga0265339_10422292
395 Ga0265331_10096955
396 Ga0307509_10334352
397 Ga0307509_10619671
398 Ga0307408_101098310
399 Ga0307516_10000457
400 Ga0307516_10087867
401 Ga0307516_10272881
402 Ga0307405_10240347
403 Ga0307413_11906333
404 Ga0307410_10750303
405 Ga0307406_11032113
406 Ga0307406_11234452
407 Ga0307409_100156971
408 Ga0307416_100738180
409 Ga0307416_101520608
410 Ga0307414_10700917
411 Ga0307415_100137436
412 Ga0315911_1000006
413 Ga0315911_1000012
414 Ga0373931_0276758
415 Ga0373935_0644873
416 Ga0436365_1380188
417 Ga0439465_0422841
418 Ga0451804_0837676
419 Ga0451837_0325445
420 Ga0451841_0615128
421 Ga0451845_0518151
422 Ga0466972_0013186
423 Ga0466972_0141930
424 Ga0466966_0000594
425 Ga0466961_0120470
426 Ga0466961_0434666
427 Ga0466963_0111928
428 Ga0466970_0277825
429 Ga0466960_0153326
430 Ga0495617_071976
431 Ga0495603_0481785
432 Ga0495629_0570502
433 Ga0495638_0061488
434 Ga0495638_0192466
435 Ga0495638_0610288
436 Ga0495664_0229849
437 Ga0495610_0208884
438 Ga0495610_0313765
439 Ga0495620_0216737
440 Ga0495631_0171801
441 Ga0495643_0111752
442 Ga0495644_0198650
443 Ga0495648_0130033
444 Ga0495659_0258402
445 Ga0495661_0449476
446 Ga0495658_0454112
447 Ga0495670_0379277
448 Ga0495671_0253917
449 Ga0495660_0109791
450 Ga0495581_0288267
451 Ga0495604_0551469
452 Ga0495677_0217118
453 Ga0495686_0415745
454 Ga0495614_0404521
455 Ga0495615_0235104
456 Ga0495626_0254914
457 Ga0496101_0465404
458 Ga0496102_0116572
459 Ga0496104_1257130
460 Ga0496106_0682425
461 Ga0496109_1091715
462 Ga0496110_0160524
463 Ga0496112_0261343
464 Ga0496113_0961149
465 Ga0496115_0136048
466 Ga0496120_0339949
467 Ga0496121_0311272
468 Ga0496121_0638464
469 Ga0496122_0058007
470 Ga0496124_0348915
471 Ga0496125_0165694
472 Ga0496126_0132850
473 Ga0496126_0134665
474 Ga0496126_0331096
475 Ga0501031_0035093
476 Ga0501032_0000069
477 Ga0501033_0000062
478 Ga0501034_0000496
479 Ga0501036_0000086
480 Ga0501037_0000087
481 Ga0501038_0000067
482 Ga0501039_0000059
483 Ga0501041_0327678
484 Ga0501042_0114271
485 Ga0501043_0000392
486 Ga0501046_0008174
487 Ga0501047_0000146
488 Ga0501048_0000034
489 Ga0501067_0000060
490 Ga0501068_0002609
491 Ga0501069_0000046
492 Ga0501070_0000073
493 Ga0501071_0228470
494 Ga0501072_0004128
495 Ga0501073_0000253
496 Ga0501074_0000025
497 Ga0501076_0119998
498 Ga0501080_0000037
499 Ga0501083_0000082
500 Ga0501035_0000141
501 Ga0501044_0000151
502 Ga0501045_0058622
503 nmdc:mga0yw44_1120830_c1
504 nmdc:mga0yw44_21592_c1
505 nmdc:mga0yw44_77377_c1
506 Ga0495655_0081746
507 Ga0500578_0275717
508 Ga0500578_0712631
509 Ga0500643_036947
510 Ga0500644_0037104
511 Ga0500650_0137250
512 Ga0500594_0251561
513 Ga0500595_002028
514 Ga0500595_005290
515 Ga0500595_059518
516 Ga0500607_166392
517 Ga0500614_015836
518 Ga0500642_0114427
519 Ga0500658_0186638
520 Ga0500658_0347627
521 Ga0500559_0108167
522 Ga0500568_0119708
523 Ga0500577_0032211
524 Ga0500588_0316304
525 Ga0500589_267884
526 Ga0500604_0128613
527 Ga0500616_0014048
528 Ga0500633_0039258
529 Ga0500637_0349049
530 Ga0500637_0386377
531 Ga0500637_0434260
532 Ga0500645_034969
533 Ga0500645_081285
534 Ga0500596_078172
535 Ga0500599_003215
536 Ga0501084_0004949
537 Ga0501082_0002309
538 2508693182
539 2513622126
540 2513642687
541 2513920463
542 2514014310
543 2517890236
544 2517894976
545 2617350360
546 2644290383
547 2824669970
548 2824746214
549 2838131108
550 2841982560
551 2847932629
552 2874625528
553 2879084052
554 2879127895
555 2879143788
556 2889038599
557 2903774421
558 2904670512
559 2906618893
560 2906664893
561 2932801583
562 2932816149
563 2932825028
564 2933582148
565 2935647895
566 2935694183
567 2935713272
568 2935722798
569 2935732079
570 2935739377
571 2935741468
572 2935748415
573 2935750871
574 2935760168
575 2935775772
576 2935777324
577 2935810348
578 2935837379
579 2935873400
580 2935915362
581 2935933706
582 2935941349
583 2935949592
584 2935958233
585 2935975148
586 2940566101
587 8006994067
588 8019594666
589 8019610521
590 8019651107
591 8019695910
592 8056974264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ay2-assembly1.cif.gz_B crystal structure of truncated usp1-uaf1 reacted with ubiquitin-prg 0.8761 62 77
7ay2-assembly2.cif.gz_E crystal structure of truncated usp1-uaf1 reacted with ubiquitin-prg 0.8376 62 77
7ay1-assembly1.cif.gz_D cryo-em structure of usp1-uaf1 bound to mono-ubiquitinated fancd2, and fanci 0.8331 62 76
7w1y-assembly1.cif.gz_B human mcm double hexamer bound to natural dna duplex (polyat/polyta) 0.7879 62 77
4ywl-assembly1.cif.gz_A pyrococcus furiosus mcm n-terminal domain f179a point mutant pentameric ring 0.7393 61 77
ID Description Score Start End Superfamily
af_Q9BPP2_137_233_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8248 62 77 2.60.40.10
4dohR02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8166 62 76 2.60.40.10
af_B6HY54_277_356_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8051 62 76 2.60.40.10
af_A0A1D8PFU3_415_811_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8047 62 76 3.90.70.10
af_A0A2R8QQQ6_14_319_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7977 62 76 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A2V8UMX8-F1-model_v4 Uncharacterized protein 0.9171 49 90
AF-A0A4V2E8Q4-F1-model_v4 Uncharacterized protein 0.8912 50 122
AF-A0A809ZGE7-F1-model_v4 Uncharacterized protein 0.871 53 119
AF-A0A512E4I3-F1-model_v4 Uncharacterized protein 0.8601 52 119
AF-A0A2R4WGI4-F1-model_v4 Uncharacterized protein 0.8581 53 119

Map