F392858

General Info

Members Datasets Scaffolds Average Seq Length
295 192 280 309

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0000199|Ga0496122_0000199_58724_59701
Length 325
Sequence MNFEFPFDELPAVMRGPRVERRRVLVGGSAFWGTVVEEGADAGKLRLDDERLLDAEGQACLPPVSPSKIIAVHISYSSRSHETRNKPKPTETPTYFTKPPTALNGHGGQILKPADVKYLNYEGEYAVVIGKTCRNVTPDEAWDFIEGFCPALDMGLQDFRDTDQGSMLRVKGADTLLPIGPGIVRGVDLFAQTLRTTVNGLVVQEASIGDETIWGPHYVIADIARHITLVPGDVILMGTPCHSRSVDAGDVVACEITGIGRVEGTVVAIDAPRASALGVGHAPTDTPEVRRVALGFDERVPERFKDNLRRAKGERAAKGEGITAP

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221596 Acidovorax sp. Root70 Isolate Unclassified
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221717 Acidovorax sp. Root267 Isolate Unclassified
7 2738543012 Acidovorax sp. CF301 Isolate Unclassified
8 2816332133 Acidovorax radicis 2721A Isolate Unclassified
9 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
10 2842733646 Variovorax sp. R-72446 Isolate Unclassified
11 2842747753 Variovorax sp. R-72060 Isolate Unclassified
12 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
13 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
14 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
28 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
29 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
30 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
183 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
191 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 0.34
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.9
Nodule 0.34
Rhizoplane 1.02
Rhizosphere 64.41
Stem 0
Stem Tuber 0
Unclassified 20.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000107 3300001904 Bacteria 13974
2 JGI24741J21665_1001796 3300001915 Bacteria 5891
3 JGI24740J21852_10000073 3300001979 Bacteria 33544
4 JGI24740J21852_10000225 3300001979 Bacteria 23975
5 JGI24740J21852_10009300 3300001979 Bacteria 3857
6 JGI24740J21852_10009377 3300001979 Bacteria 3835
7 JGI24739J22299_10000098 3300001989 Bacteria 25916
8 JGI24739J22299_10001680 3300001989 Bacteria 8404
9 JGI24735J21928_10003353 3300002067 Bacteria 5464
10 JGI24738J21930_10000165 3300002075 Bacteria 16719
11 JGI25152J39213_1001325 3300002773 Bacteria 10968
12 JGI25151J46595_10002013 3300003187 Bacteria 12719
13 JGI25151J46595_10004222 3300003187 Bacteria 7645
14 JGI25153J46596_10001798 3300003215 Bacteria 12719
15 rootH1_10015038 3300003316 Bacteria 4584
16 rootH1_10033302 3300003316 Bacteria 27746
17 rootH1_10071634 3300003323 Bacteria 8035
18 JGI25160J50197_1023424 3300003354 Bacteria 1780
19 Ga0006562J51391_1061767 3300003578 Bacteria 9500
20 Ga0055538_1000010 3300003751 Bacteria 376599
21 Ga0055539_1000015 3300003752 Bacteria 376599
22 Ga0055533_1000018 3300003756 Bacteria 376599
23 Ga0055525_1000020 3300003759 Bacteria 376599
24 Ga0055526_1002677 3300003771 Bacteria 11897
25 Ga0055536_1001094 3300003781 Bacteria 17041
26 Ga0055530_10002212 3300003791 Bacteria 12851
27 Ga0055540_1000833 3300003792 Bacteria 20742
28 Ga0055531_10001120 3300003794 Bacteria 20754
29 Ga0055541_1000011 3300003841 Bacteria 376599
30 Ga0065165_1003222 3300005262 Bacteria 11881
31 Ga0070658_10000180 3300005327 Bacteria 55242
32 Ga0070670_100077200 3300005331 Bacteria 2862
33 Ga0068869_100014577 3300005334 Bacteria 5255
34 Ga0068868_100115255 3300005338 Bacteria 2187
35 Ga0070708_100240746 3300005445 Bacteria 1699
36 Ga0070663_100017852 3300005455 Bacteria 4638
37 Ga0070662_100000952 3300005457 Bacteria 17734
38 Ga0070662_100011207 3300005457 Bacteria 5907
39 Ga0068853_100003584 3300005539 Bacteria 11887
40 Ga0068853_100013401 3300005539 Bacteria 6693
41 Ga0068853_100032125 3300005539 Bacteria 4445
42 Ga0068853_100244776 3300005539 Bacteria 1644
43 Ga0068853_100266210 3300005539 Bacteria 1577
44 Ga0068855_100008273 3300005563 Bacteria 12578
45 Ga0068855_100056544 3300005563 Bacteria 4603
46 Ga0068855_100066765 3300005563 Bacteria 4193
47 Ga0068855_100086222 3300005563 Bacteria 3631
48 Ga0070664_100007556 3300005564 Bacteria 8776
49 Ga0068857_100002717 3300005577 Bacteria 14524
50 Ga0068857_100069240 3300005577 Bacteria 3142
51 Ga0068857_100075101 3300005577 Bacteria 3013
52 Ga0068854_100013948 3300005578 Bacteria 5286
53 Ga0068854_100018197 3300005578 Bacteria 4714
54 Ga0068856_100002651 3300005614 Bacteria 18355
55 Ga0068856_100002673 3300005614 Bacteria 18281
56 Ga0068852_100000291 3300005616 Bacteria 33593
57 Ga0068852_100002952 3300005616 Bacteria 11810
58 Ga0068852_100009833 3300005616 Bacteria 7115
59 Ga0068852_100012328 3300005616 Bacteria 6485
60 Ga0068852_100178456 3300005616 Bacteria 1995
61 Ga0068859_100026333 3300005617 Bacteria 5831
62 Ga0068859_100211440 3300005617 Bacteria 2026
63 Ga0068864_100002689 3300005618 Bacteria 14651
64 Ga0068851_10008489 3300005834 Bacteria 4752
65 Ga0068851_10028894 3300005834 Bacteria 2741
66 Ga0068863_100000338 3300005841 Bacteria 47691
67 Ga0068858_100000098 3300005842 Bacteria 90747
68 Ga0068860_100001126 3300005843 Bacteria 29403
69 Ga0068862_100002005 3300005844 Bacteria 18468
70 Ga0097620_100026332 3300006931 Bacteria 5831
71 Ga0097620_100211430 3300006931 Bacteria 2026
72 Ga0099826_10045152 3300006948 Bacteria 3015
73 Ga0105244_10000510 3300009036 Bacteria 34754
74 Ga0105250_10015830 3300009092 Bacteria 3082
75 Ga0105240_10026576 3300009093 Bacteria 7595
76 Ga0105240_10032011 3300009093 Bacteria 6811
77 Ga0105245_10032397 3300009098 Bacteria 4626
78 Ga0105247_10033340 3300009101 Bacteria 3132
79 Ga0105243_10025713 3300009148 Bacteria 4502
80 Ga0105241_10007469 3300009174 Bacteria 8045
81 Ga0105241_10028467 3300009174 Bacteria 4165
82 Ga0105248_10004132 3300009177 Bacteria 16063
83 Ga0105237_10002793 3300009545 Bacteria 21209
84 Ga0105237_10023806 3300009545 Bacteria 6268
85 Ga0105238_10002534 3300009551 Bacteria 18257
86 Ga0105238_10015425 3300009551 Bacteria 7731
87 Ga0105238_10028498 3300009551 Bacteria 5689
88 Ga0105238_10057972 3300009551 Bacteria 3882
89 Ga0105249_10000543 3300009553 Bacteria 34906
90 Ga0105239_10007537 3300010375 Bacteria 12483
91 Ga0105239_10020177 3300010375 Bacteria 7352
92 Ga0105239_10069018 3300010375 Bacteria 3884
93 Ga0105239_10637244 3300010375 Bacteria 1217
94 Ga0157373_10002873 3300013100 Bacteria 13030
95 Ga0157370_10001632 3300013104 Bacteria 27690
96 Ga0157370_10003887 3300013104 Bacteria 17402
97 Ga0157370_10005756 3300013104 Bacteria 13856
98 Ga0157369_10001112 3300013105 Bacteria 33599
99 Ga0157369_10001594 3300013105 Bacteria 27783
100 Ga0157369_10004186 3300013105 Bacteria 17094
101 Ga0157378_10144532 3300013297 Bacteria 2211
102 Ga0157372_10000732 3300013307 Bacteria 35785
103 Ga0157372_10010817 3300013307 Bacteria 9714
104 Ga0163163_10124081 3300014325 Bacteria 2619
105 Ga0182008_10001106 3300014497 Bacteria 18562
106 Ga0157376_10000620 3300014969 Bacteria 22978
107 Ga0209784_100025 3300025224 Bacteria 376681
108 Ga0209566_100025 3300025225 Bacteria 376681
109 Ga0209674_100042 3300025226 Bacteria 376681
110 Ga0209563_100046 3300025230 Bacteria 376681
111 Ga0207425_1000910 3300025245 Bacteria 14190
112 Ga0209677_100027 3300025253 Bacteria 376681
113 Ga0209129_1001408 3300025258 Bacteria 13464
114 Ga0209130_1001777 3300025284 Bacteria 12694
115 Ga0209675_1030909 3300025291 Bacteria 1271
116 Ga0209676_1000004 3300025292 Bacteria 1138360
117 Ga0209025_1000291 3300025294 Bacteria 112755
118 Ga0209025_1004413 3300025294 Bacteria 12242
119 Ga0209564_1000621 3300025295 Bacteria 54266
120 Ga0209758_1003534 3300025297 Bacteria 14084
121 Ga0209050_1000002 3300025298 Bacteria 1792849
122 Ga0207426_1002303 3300025302 Bacteria 12560
123 Ga0209051_1000002 3300025303 Bacteria 1631846
124 Ga0209257_1000002 3300025304 Bacteria 1767052
125 Ga0207656_10008068 3300025321 Bacteria 3862
126 Ga0207656_10010019 3300025321 Bacteria 3534
127 Ga0207655_1004190 3300025728 Bacteria 10347
128 Ga0207710_10002770 3300025900 Bacteria 8011
129 Ga0207647_10000657 3300025904 Bacteria 26990
130 Ga0207647_10001113 3300025904 Bacteria 20682
131 Ga0207647_10007684 3300025904 Bacteria 7767
132 Ga0207705_10000228 3300025909 Bacteria 55776
133 Ga0207654_10000588 3300025911 Bacteria 20498
134 Ga0207654_10016311 3300025911 Bacteria 3866
135 Ga0207695_10001282 3300025913 Bacteria 42704
136 Ga0207695_10003877 3300025913 Bacteria 20702
137 Ga0207695_10042778 3300025913 Bacteria 4833
138 Ga0207671_10002268 3300025914 Bacteria 20795
139 Ga0207671_10005793 3300025914 Bacteria 11244
140 Ga0207649_10068238 3300025920 Bacteria 2260
141 Ga0207694_10004354 3300025924 Bacteria 11062
142 Ga0207694_10006476 3300025924 Bacteria 8910
143 Ga0207694_10225313 3300025924 Bacteria 1530
144 Ga0207650_10090259 3300025925 Bacteria 2340
145 Ga0207687_10018515 3300025927 Bacteria 4599
146 Ga0207706_10020791 3300025933 Bacteria 5895
147 Ga0207706_10050072 3300025933 Bacteria 3692
148 Ga0207709_10011663 3300025935 Bacteria 4844
149 Ga0207679_10004047 3300025945 Bacteria 9107
150 Ga0207667_10002278 3300025949 Bacteria 24132
151 Ga0207667_10025395 3300025949 Bacteria 6484
152 Ga0207667_10054541 3300025949 Bacteria 4204
153 Ga0207667_10220249 3300025949 Bacteria 1944
154 Ga0207712_10000388 3300025961 Bacteria 38208
155 Ga0207640_10002194 3300025981 Bacteria 10494
156 Ga0207640_10045913 3300025981 Bacteria 2808
157 Ga0207703_10000086 3300026035 Bacteria 107307
158 Ga0207639_10006604 3300026041 Bacteria 7888
159 Ga0207639_10007846 3300026041 Bacteria 7291
160 Ga0207639_10027128 3300026041 Bacteria 4168
161 Ga0207639_10137852 3300026041 Bacteria 2029
162 Ga0207639_10524785 3300026041 Bacteria 1085
163 Ga0207678_10090176 3300026067 Bacteria 2620
164 Ga0207702_10001600 3300026078 Bacteria 22401
165 Ga0207702_10012046 3300026078 Bacteria 7191
166 Ga0207641_10000395 3300026088 Bacteria 51273
167 Ga0207641_10002050 3300026088 Bacteria 19167
168 Ga0207676_10002070 3300026095 Bacteria 14565
169 Ga0207674_10004009 3300026116 Bacteria 17885
170 Ga0207674_10083018 3300026116 Bacteria 3204
171 Ga0207698_10000797 3300026142 Bacteria 18332
172 Ga0207698_10006706 3300026142 Bacteria 7194
173 Ga0207698_10027761 3300026142 Bacteria 4024
174 Ga0207698_10146001 3300026142 Bacteria 2046
175 Ga0268265_10000121 3300028380 Bacteria 97688
176 Ga0268264_10005300 3300028381 Bacteria 10920
177 Ga0268264_10267731 3300028381 Bacteria 1595
178 Ga0307517_10066298 3300028786 Bacteria 3324
179 Ga0307515_10000047 3300028794 Bacteria 291475
180 Ga0307515_10000178 3300028794 Bacteria 157107
181 Ga0307515_10000672 3300028794 Bacteria 78835
182 Ga0307515_10001013 3300028794 Bacteria 64205
183 Ga0307515_10001836 3300028794 Bacteria 47333
184 Ga0307515_10003361 3300028794 Bacteria 33757
185 Ga0307515_10045647 3300028794 Bacteria 6723
186 Ga0307515_10065808 3300028794 Bacteria 5034
187 Ga0307515_10127061 3300028794 Bacteria 2838
188 Ga0307512_10194178 3300030522 Bacteria 1113
189 Ga0307513_10041072 3300031456 Bacteria 5109
190 Ga0307513_10071530 3300031456 Bacteria 3619
191 Ga0307513_10084654 3300031456 Bacteria 3256
192 Ga0307509_10002620 3300031507 Bacteria 28791
193 Ga0307509_10003530 3300031507 Bacteria 23571
194 Ga0307408_100018968 3300031548 Bacteria 4625
195 Ga0307508_10000130 3300031616 Bacteria 89085
196 Ga0307508_10000155 3300031616 Bacteria 82771
197 Ga0307514_10001174 3300031649 Bacteria 35389
198 Ga0307514_10002433 3300031649 Bacteria 19409
199 Ga0307516_10000286 3300031730 Bacteria 65447
200 Ga0307516_10031704 3300031730 Bacteria 5327
201 Ga0307516_10057808 3300031730 Bacteria 3777
202 Ga0307406_10057855 3300031901 Bacteria 2489
203 Ga0307406_10199853 3300031901 Bacteria 1470
204 Ga0307412_10089788 3300031911 Bacteria 2146
205 Ga0307416_100208623 3300032002 Bacteria 1861
206 Ga0307416_100291747 3300032002 Bacteria 1615
207 Ga0307411_10209029 3300032005 Bacteria 1505
208 Ga0307507_10118147 3300033179 Bacteria 2133
209 Ga0307507_10171488 3300033179 Bacteria 1575
210 Ga0307510_10200101 3300033180 Bacteria 1533
211 Ga0307510_10255320 3300033180 Unclassified 1237
212 Ga0373925_0065294 3300037068 Bacteria 2741
213 Ga0395900_0024753 3300037418 Bacteria 6144
214 Ga0395900_0037320 3300037418 Bacteria 5011
215 Ga0395900_0072945 3300037418 Bacteria 3528
216 Ga0395898_0005387 3300037466 Bacteria 13829
217 Ga0395898_0067627 3300037466 Bacteria 3458
218 Ga0395905_0079917 3300037471 Bacteria 3064
219 Ga0395905_0101962 3300037471 Bacteria 2694
220 Ga0395905_0145777 3300037471 Bacteria 2227
221 Ga0395905_0146965 3300037471 Bacteria 2218
222 Ga0395901_0000009 3300038443 Bacteria 479396
223 Ga0395901_0000034 3300038443 Bacteria 230365
224 Ga0395901_0000432 3300038443 Bacteria 49091
225 Ga0395901_0056641 3300038443 Bacteria 4078
226 Ga0436361_0348172 3300039447 Bacteria 5455
227 Ga0436361_0883190 3300039447 Bacteria 11458
228 Ga0451855_1027104 3300041511 Bacteria 1351
229 Ga0439462_0040822 3300042015 Bacteria 1238
230 Ga0450911_000097 3300042115 Bacteria 35730
231 Ga0451577_0007642 3300042876 Bacteria 10601
232 Ga0466977_0001549 3300044666 Bacteria 9615
233 Ga0466965_0013056 3300044683 Bacteria 3914
234 Ga0466961_0001031 3300044693 Bacteria 17198
235 Ga0466963_0001017 3300044694 Bacteria 14520
236 Ga0466964_0006006 3300044706 Bacteria 4526
237 Ga0466971_0000224 3300044719 Bacteria 21717
238 Ga0466970_0008629 3300044765 Bacteria 5134
239 Ga0466959_0000620 3300045049 Bacteria 20592
240 Ga0451576_0020496 3300045051 Bacteria 7198
241 Ga0466958_0001219 3300045836 Bacteria 12015
242 Ga0495650_0003261 3300046471 Bacteria 12028
243 Ga0495610_0058569 3300046512 Bacteria 1842
244 Ga0495632_0003077 3300046519 Bacteria 12111
245 Ga0495654_0000307 3300046530 Bacteria 43179
246 Ga0495625_0001839 3300046660 Bacteria 24238
247 Ga0495661_0001271 3300046665 Bacteria 21687
248 Ga0495677_0023455 3300047445 Bacteria 2240
249 Ga0495686_0026354 3300047472 Bacteria 3803
250 Ga0496102_0180945 3300048905 Bacteria 1986
251 Ga0496103_0090276 3300048906 Bacteria 1933
252 Ga0496106_0064015 3300048909 Bacteria 2797
253 Ga0496116_0011975 3300048919 Bacteria 7125
254 Ga0496117_0002257 3300048920 Bacteria 24885
255 Ga0496118_0002464 3300048921 Bacteria 24866
256 Ga0496118_0002674 3300048921 Bacteria 23560
257 Ga0496121_0000257 3300048924 Bacteria 112257
258 Ga0496121_0014575 3300048924 Bacteria 8327
259 Ga0496122_0000199 3300048925 Bacteria 133898
260 Ga0496123_0000102 3300048926 Bacteria 169327
261 Ga0496124_0160125 3300048927 Bacteria 1755
262 Ga0496125_0005965 3300048928 Bacteria 13335
263 Ga0496125_0009217 3300048928 Bacteria 10197
264 Ga0496125_0009870 3300048928 Bacteria 9712
265 Ga0496125_0072960 3300048928 Bacteria 2672
266 Ga0496126_0028163 3300048929 Bacteria 5357
267 Ga0496126_0061836 3300048929 Bacteria 3362
268 Ga0496126_0108606 3300048929 Bacteria 2419
269 Ga0501206_000803 3300049653 Bacteria 3841
270 Ga0501223_006747 3300049663 Bacteria 2364
271 Ga0501249_012011 3300049679 Bacteria 1827
272 Ga0501257_045347 3300049686 Bacteria 1087
273 Ga0500658_0011694 3300053134 Bacteria 3234
274 Ga0500559_0002982 3300053136 Bacteria 8490
275 Ga0500559_0016612 3300053136 Bacteria 3108
276 Ga0500573_0035786 3300053140 Bacteria 2866
277 Ga0500627_0000726 3300053158 Bacteria 8755
278 Ga0500570_072063 3300053724 Bacteria 1606
279 Ga0500587_004098 3300053739 Bacteria 2013
280 Ga0466962_0001465 3300061719 Bacteria 11008

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10028467 Ga0105241_100284675 250
2 3300046512 Ga0495610_0058569 Ga0495610_0058569_1037_1828 261
3 3300042015 Ga0439462_0040822 Ga0439462_0040822_398_1219 268
4 3300044693 Ga0466961_0001031 Ga0466961_0001031_6873_7754 287
5 3300044694 Ga0466963_0001017 Ga0466963_0001017_8070_8951 287
6 3300044719 Ga0466971_0000224 Ga0466971_0000224_13667_14548 287
7 3300045049 Ga0466959_0000620 Ga0466959_0000620_12546_13427 287
8 3300045836 Ga0466958_0001219 Ga0466958_0001219_8435_9316 287
9 3300061719 Ga0466962_0001465 Ga0466962_0001465_1533_2414 287
10 iso_pu_bacteria 2919138771 2919142922 295
11 3300003187 JGI25151J46595_10004222 JGI25151J46595_100042227 297
12 3300005334 Ga0068869_100014577 Ga0068869_1000145772 297
13 3300005338 Ga0068868_100115255 Ga0068868_1001152552 297
14 3300005539 Ga0068853_100266210 Ga0068853_1002662101 297
15 3300025294 Ga0209025_1000291 Ga0209025_100029190 297
16 3300002773 JGI25152J39213_1001325 JGI25152J39213_10013258 298
17 3300003187 JGI25151J46595_10002013 JGI25151J46595_1000201310 298
18 3300003215 JGI25153J46596_10001798 JGI25153J46596_1000179810 298
19 3300003354 JGI25160J50197_1023424 JGI25160J50197_10234242 298
20 3300003578 Ga0006562J51391_1061767 Ga0006562J51391_10617677 298
21 3300003781 Ga0055536_1001094 Ga0055536_10010948 298
22 3300003791 Ga0055530_10002212 Ga0055530_100022124 298
23 3300003792 Ga0055540_1000833 Ga0055540_100083312 298
24 3300003794 Ga0055531_10001120 Ga0055531_1000112012 298
25 3300005262 Ga0065165_1003222 Ga0065165_10032223 298
26 3300005445 Ga0070708_100240746 Ga0070708_1002407462 298
27 3300005616 Ga0068852_100009833 Ga0068852_1000098335 298
28 3300025245 Ga0207425_1000910 Ga0207425_10009104 298
29 3300025258 Ga0209129_1001408 Ga0209129_10014085 298
30 3300025284 Ga0209130_1001777 Ga0209130_100177710 298
31 3300025292 Ga0209676_1000004 Ga0209676_100000462 298
32 3300025294 Ga0209025_1004413 Ga0209025_10044139 298
33 3300025297 Ga0209758_1003534 Ga0209758_10035349 298
34 3300025298 Ga0209050_1000002 Ga0209050_1000002572 298
35 3300025302 Ga0207426_1002303 Ga0207426_10023039 298
36 3300025303 Ga0209051_1000002 Ga0209051_1000002340 298
37 3300025304 Ga0209257_1000002 Ga0209257_1000002481 298
38 3300026142 Ga0207698_10006706 Ga0207698_100067063 298
39 3300028794 Ga0307515_10000047 Ga0307515_10000047189 298
40 3300028794 Ga0307515_10001836 Ga0307515_1000183623 298
41 3300028794 Ga0307515_10045647 Ga0307515_100456479 298
42 3300031730 Ga0307516_10031704 Ga0307516_100317043 298
43 3300038443 Ga0395901_0000009 Ga0395901_0000009_170863_171810 298
44 3300041511 Ga0451855_1027104 Ga0451855_1027104_204_1148 298
45 3300042876 Ga0451577_0007642 Ga0451577_0007642_4736_5680 298
46 3300045051 Ga0451576_0020496 Ga0451576_0020496_716_1648 298
47 3300046660 Ga0495625_0001839 Ga0495625_0001839_5581_6525 298
48 3300053134 Ga0500658_0011694 Ga0500658_0011694_541_1485 298
49 3300053724 Ga0500570_072063 Ga0500570_072063_495_1439 298
50 3300053739 Ga0500587_004098 Ga0500587_004098_271_1215 298
51 iso_pu_bacteria 2547132374 2548498996 298
52 iso_pu_bacteria 2585428062 2587754715 298
53 iso_pu_bacteria 2643221609 2644062167 298
54 iso_pu_bacteria 2643221611 2644071355 298
55 iso_pu_bacteria 2643221717 2644648453 298
56 iso_pu_bacteria 2738543012 2739245778 298
57 iso_pu_bacteria 2816332133 2816470472 298
58 iso_pu_bacteria 2831265667 2831267545 298
59 iso_pu_bacteria 2928115317 2928117523 298
60 3300003323 rootH1_10071634 rootH1_100716347 299
61 3300003771 Ga0055526_1002677 Ga0055526_10026776 299
62 3300014497 Ga0182008_10001106 Ga0182008_1000110617 299
63 3300025291 Ga0209675_1030909 Ga0209675_10309092 299
64 3300025295 Ga0209564_1000621 Ga0209564_100062124 299
65 3300028786 Ga0307517_10066298 Ga0307517_100662982 299
66 3300028794 Ga0307515_10065808 Ga0307515_100658083 299
67 3300028794 Ga0307515_10127061 Ga0307515_101270612 299
68 3300031456 Ga0307513_10084654 Ga0307513_100846543 299
69 3300031507 Ga0307509_10003530 Ga0307509_1000353013 299
70 3300031901 Ga0307406_10057855 Ga0307406_100578552 299
71 3300031901 Ga0307406_10199853 Ga0307406_101998531 299
72 3300032002 Ga0307416_100208623 Ga0307416_1002086232 299
73 3300037068 Ga0373925_0065294 Ga0373925_0065294_29_976 299
74 3300042115 Ga0450911_000097 Ga0450911_000097_15212_16159 299
75 3300046471 Ga0495650_0003261 Ga0495650_0003261_5069_6016 299
76 3300047472 Ga0495686_0026354 Ga0495686_0026354_1018_1917 299
77 3300048924 Ga0496121_0014575 Ga0496121_0014575_1732_2679 299
78 3300048927 Ga0496124_0160125 Ga0496124_0160125_88_1035 299
79 3300048928 Ga0496125_0009217 Ga0496125_0009217_3389_4336 299
80 3300048928 Ga0496125_0009870 Ga0496125_0009870_7957_8904 299
81 3300048929 Ga0496126_0108606 Ga0496126_0108606_990_1937 299
82 3300049653 Ga0501206_000803 Ga0501206_000803_1578_2525 299
83 3300049679 Ga0501249_012011 Ga0501249_012011_207_1154 299
84 3300049686 Ga0501257_045347 Ga0501257_045347_79_1026 299
85 3300053136 Ga0500559_0002982 Ga0500559_0002982_5591_6553 299
86 3300053140 Ga0500573_0035786 Ga0500573_0035786_1169_2131 299
87 3300001989 JGI24739J22299_10001680 JGI24739J22299_100016805 300
88 3300003316 rootH1_10015038 rootH1_100150383 300
89 3300003316 rootH1_10033302 rootH1_1003330221 300
90 3300003751 Ga0055538_1000010 Ga0055538_1000010279 300
91 3300003752 Ga0055539_1000015 Ga0055539_1000015279 300
92 3300003756 Ga0055533_1000018 Ga0055533_1000018279 300
93 3300003759 Ga0055525_1000020 Ga0055525_1000020279 300
94 3300003841 Ga0055541_1000011 Ga0055541_1000011279 300
95 3300005331 Ga0070670_100077200 Ga0070670_1000772003 300
96 3300005457 Ga0070662_100000952 Ga0070662_1000009523 300
97 3300005563 Ga0068855_100066765 Ga0068855_1000667653 300
98 3300005563 Ga0068855_100086222 Ga0068855_1000862222 300
99 3300005564 Ga0070664_100007556 Ga0070664_1000075563 300
100 3300005577 Ga0068857_100069240 Ga0068857_1000692403 300
101 3300005616 Ga0068852_100178456 Ga0068852_1001784562 300
102 3300005617 Ga0068859_100026333 Ga0068859_1000263334 300
103 3300005617 Ga0068859_100211440 Ga0068859_1002114402 300
104 3300005843 Ga0068860_100001126 Ga0068860_10000112622 300
105 3300005844 Ga0068862_100002005 Ga0068862_10000200524 300
106 3300006931 Ga0097620_100026332 Ga0097620_1000263324 300
107 3300006931 Ga0097620_100211430 Ga0097620_1002114302 300
108 3300006948 Ga0099826_10045152 Ga0099826_100451523 300
109 3300009036 Ga0105244_10000510 Ga0105244_1000051034 300
110 3300009098 Ga0105245_10032397 Ga0105245_100323974 300
111 3300009101 Ga0105247_10033340 Ga0105247_100333402 300
112 3300009148 Ga0105243_10025713 Ga0105243_100257133 300
113 3300009551 Ga0105238_10028498 Ga0105238_100284982 300
114 3300009553 Ga0105249_10000543 Ga0105249_1000054321 300
115 3300010375 Ga0105239_10637244 Ga0105239_106372442 300
116 3300013297 Ga0157378_10144532 Ga0157378_101445322 300
117 3300014325 Ga0163163_10124081 Ga0163163_101240812 300
118 3300014969 Ga0157376_10000620 Ga0157376_1000062019 300
119 3300025224 Ga0209784_100025 Ga0209784_100025276 300
120 3300025225 Ga0209566_100025 Ga0209566_100025276 300
121 3300025226 Ga0209674_100042 Ga0209674_100042276 300
122 3300025230 Ga0209563_100046 Ga0209563_100046276 300
123 3300025253 Ga0209677_100027 Ga0209677_100027276 300
124 3300025728 Ga0207655_1004190 Ga0207655_10041905 300
125 3300025900 Ga0207710_10002770 Ga0207710_100027707 300
126 3300025904 Ga0207647_10007684 Ga0207647_100076845 300
127 3300025924 Ga0207694_10225313 Ga0207694_102253132 300
128 3300025925 Ga0207650_10090259 Ga0207650_100902592 300
129 3300025927 Ga0207687_10018515 Ga0207687_100185152 300
130 3300025933 Ga0207706_10020791 Ga0207706_100207914 300
131 3300025935 Ga0207709_10011663 Ga0207709_100116634 300
132 3300025945 Ga0207679_10004047 Ga0207679_100040476 300
133 3300025949 Ga0207667_10054541 Ga0207667_100545413 300
134 3300025949 Ga0207667_10220249 Ga0207667_102202491 300
135 3300025961 Ga0207712_10000388 Ga0207712_1000038822 300
136 3300026041 Ga0207639_10524785 Ga0207639_105247851 300
137 3300026088 Ga0207641_10002050 Ga0207641_1000205016 300
138 3300026116 Ga0207674_10083018 Ga0207674_100830182 300
139 3300028380 Ga0268265_10000121 Ga0268265_1000012124 300
140 3300028381 Ga0268264_10005300 Ga0268264_100053002 300
141 3300028381 Ga0268264_10267731 Ga0268264_102677312 300
142 3300028794 Ga0307515_10000178 Ga0307515_10000178107 300
143 3300028794 Ga0307515_10000672 Ga0307515_1000067225 300
144 3300028794 Ga0307515_10001013 Ga0307515_1000101312 300
145 3300028794 Ga0307515_10003361 Ga0307515_1000336130 300
146 3300030522 Ga0307512_10194178 Ga0307512_101941782 300
147 3300031456 Ga0307513_10041072 Ga0307513_100410723 300
148 3300031456 Ga0307513_10071530 Ga0307513_100715302 300
149 3300031507 Ga0307509_10002620 Ga0307509_1000262012 300
150 3300031548 Ga0307408_100018968 Ga0307408_1000189683 300
151 3300031616 Ga0307508_10000130 Ga0307508_1000013055 300
152 3300031616 Ga0307508_10000155 Ga0307508_1000015524 300
153 3300031649 Ga0307514_10001174 Ga0307514_100011743 300
154 3300031649 Ga0307514_10002433 Ga0307514_1000243312 300
155 3300031730 Ga0307516_10000286 Ga0307516_1000028647 300
156 3300031730 Ga0307516_10057808 Ga0307516_100578082 300
157 3300031911 Ga0307412_10089788 Ga0307412_100897882 300
158 3300032002 Ga0307416_100291747 Ga0307416_1002917472 300
159 3300032005 Ga0307411_10209029 Ga0307411_102090292 300
160 3300033179 Ga0307507_10118147 Ga0307507_101181472 300
161 3300033179 Ga0307507_10171488 Ga0307507_101714882 300
162 3300033180 Ga0307510_10200101 Ga0307510_102001012 300
163 3300033180 Ga0307510_10255320 Ga0307510_102553202 300
164 3300037418 Ga0395900_0024753 Ga0395900_0024753_4210_5175 300
165 3300037418 Ga0395900_0037320 Ga0395900_0037320_1451_2422 300
166 3300037418 Ga0395900_0072945 Ga0395900_0072945_2050_2994 300
167 3300037466 Ga0395898_0005387 Ga0395898_0005387_11130_12101 300
168 3300037466 Ga0395898_0067627 Ga0395898_0067627_1652_2596 300
169 3300037471 Ga0395905_0079917 Ga0395905_0079917_1537_2487 300
170 3300037471 Ga0395905_0101962 Ga0395905_0101962_1552_2502 300
171 3300037471 Ga0395905_0145777 Ga0395905_0145777_933_1898 300
172 3300037471 Ga0395905_0146965 Ga0395905_0146965_79_1044 300
173 3300038443 Ga0395901_0000034 Ga0395901_0000034_13003_13974 300
174 3300038443 Ga0395901_0000432 Ga0395901_0000432_20377_21348 300
175 3300038443 Ga0395901_0056641 Ga0395901_0056641_2674_3639 300
176 3300039447 Ga0436361_0348172 Ga0436361_0348172_3463_4416 300
177 3300039447 Ga0436361_0883190 Ga0436361_0883190_7482_8435 300
178 3300044666 Ga0466977_0001549 Ga0466977_0001549_4153_5103 300
179 3300044683 Ga0466965_0013056 Ga0466965_0013056_1888_2859 300
180 3300044706 Ga0466964_0006006 Ga0466964_0006006_731_1702 300
181 3300044765 Ga0466970_0008629 Ga0466970_0008629_4061_5032 300
182 3300046519 Ga0495632_0003077 Ga0495632_0003077_6940_7884 300
183 3300046530 Ga0495654_0000307 Ga0495654_0000307_5894_6850 300
184 3300046665 Ga0495661_0001271 Ga0495661_0001271_12185_13129 300
185 3300047445 Ga0495677_0023455 Ga0495677_0023455_287_1231 300
186 3300048919 Ga0496116_0011975 Ga0496116_0011975_166_1119 300
187 3300048920 Ga0496117_0002257 Ga0496117_0002257_9393_10346 300
188 3300048921 Ga0496118_0002464 Ga0496118_0002464_14421_15374 300
189 3300048924 Ga0496121_0000257 Ga0496121_0000257_18531_19481 300
190 3300048925 Ga0496122_0000199 Ga0496122_0000199_58724_59701 300
191 3300048926 Ga0496123_0000102 Ga0496123_0000102_92920_93897 300
192 3300048928 Ga0496125_0005965 Ga0496125_0005965_9760_10698 300
193 3300048928 Ga0496125_0072960 Ga0496125_0072960_547_1500 300
194 3300048929 Ga0496126_0028163 Ga0496126_0028163_2351_3289 300
195 3300048929 Ga0496126_0061836 Ga0496126_0061836_203_1180 300
196 3300049663 Ga0501223_006747 Ga0501223_006747_1327_2286 300
197 3300053136 Ga0500559_0016612 Ga0500559_0016612_578_1555 300
198 3300053158 Ga0500627_0000726 Ga0500627_0000726_3384_4286 300
199 iso_pu_bacteria 2643221596 2643992009 300
200 iso_pu_bacteria 2842733646 2842739007 300
201 iso_pu_bacteria 2842747753 2842748699 300
202 iso_pu_bacteria 2842747753 2842751777 300
203 iso_pu_bacteria 2900634093 2900643278 300
204 3300001904 JGI24736J21556_1000107 JGI24736J21556_10001076 302
205 3300001915 JGI24741J21665_1001796 JGI24741J21665_10017964 302
206 3300001979 JGI24740J21852_10000073 JGI24740J21852_1000007323 302
207 3300001979 JGI24740J21852_10000225 JGI24740J21852_1000022515 302
208 3300001979 JGI24740J21852_10009300 JGI24740J21852_100093003 302
209 3300001979 JGI24740J21852_10009377 JGI24740J21852_100093774 302
210 3300001989 JGI24739J22299_10000098 JGI24739J22299_1000009814 302
211 3300002067 JGI24735J21928_10003353 JGI24735J21928_100033531 302
212 3300002075 JGI24738J21930_10000165 JGI24738J21930_1000016513 302
213 3300005327 Ga0070658_10000180 Ga0070658_1000018027 302
214 3300005455 Ga0070663_100017852 Ga0070663_1000178523 302
215 3300005457 Ga0070662_100011207 Ga0070662_1000112073 302
216 3300005539 Ga0068853_100003584 Ga0068853_10000358410 302
217 3300005539 Ga0068853_100013401 Ga0068853_1000134017 302
218 3300005539 Ga0068853_100032125 Ga0068853_1000321254 302
219 3300005539 Ga0068853_100244776 Ga0068853_1002447762 302
220 3300005563 Ga0068855_100008273 Ga0068855_1000082738 302
221 3300005563 Ga0068855_100056544 Ga0068855_1000565443 302
222 3300005577 Ga0068857_100002717 Ga0068857_10000271712 302
223 3300005577 Ga0068857_100075101 Ga0068857_1000751013 302
224 3300005578 Ga0068854_100013948 Ga0068854_1000139486 302
225 3300005578 Ga0068854_100018197 Ga0068854_1000181973 302
226 3300005614 Ga0068856_100002651 Ga0068856_1000026514 302
227 3300005614 Ga0068856_100002673 Ga0068856_10000267312 302
228 3300005616 Ga0068852_100000291 Ga0068852_10000029121 302
229 3300005616 Ga0068852_100002952 Ga0068852_1000029529 302
230 3300005616 Ga0068852_100012328 Ga0068852_1000123284 302
231 3300005618 Ga0068864_100002689 Ga0068864_1000026896 302
232 3300005834 Ga0068851_10008489 Ga0068851_100084893 302
233 3300005834 Ga0068851_10028894 Ga0068851_100288942 302
234 3300005841 Ga0068863_100000338 Ga0068863_10000033841 302
235 3300005842 Ga0068858_100000098 Ga0068858_1000000987 302
236 3300009092 Ga0105250_10015830 Ga0105250_100158303 302
237 3300009093 Ga0105240_10026576 Ga0105240_100265762 302
238 3300009093 Ga0105240_10032011 Ga0105240_100320115 302
239 3300009174 Ga0105241_10007469 Ga0105241_100074694 302
240 3300009177 Ga0105248_10004132 Ga0105248_1000413210 302
241 3300009545 Ga0105237_10002793 Ga0105237_100027935 302
242 3300009545 Ga0105237_10023806 Ga0105237_100238063 302
243 3300009551 Ga0105238_10002534 Ga0105238_1000253410 302
244 3300009551 Ga0105238_10015425 Ga0105238_100154254 302
245 3300009551 Ga0105238_10057972 Ga0105238_100579724 302
246 3300010375 Ga0105239_10007537 Ga0105239_1000753712 302
247 3300010375 Ga0105239_10020177 Ga0105239_100201773 302
248 3300010375 Ga0105239_10069018 Ga0105239_100690184 302
249 3300013100 Ga0157373_10002873 Ga0157373_100028738 302
250 3300013104 Ga0157370_10001632 Ga0157370_1000163216 302
251 3300013104 Ga0157370_10003887 Ga0157370_100038878 302
252 3300013104 Ga0157370_10005756 Ga0157370_100057567 302
253 3300013105 Ga0157369_10001112 Ga0157369_1000111222 302
254 3300013105 Ga0157369_10001594 Ga0157369_1000159415 302
255 3300013105 Ga0157369_10004186 Ga0157369_1000418612 302
256 3300013307 Ga0157372_10000732 Ga0157372_1000073221 302
257 3300013307 Ga0157372_10010817 Ga0157372_100108175 302
258 3300025321 Ga0207656_10008068 Ga0207656_100080683 302
259 3300025321 Ga0207656_10010019 Ga0207656_100100192 302
260 3300025904 Ga0207647_10000657 Ga0207647_1000065710 302
261 3300025904 Ga0207647_10001113 Ga0207647_100011138 302
262 3300025909 Ga0207705_10000228 Ga0207705_1000022828 302
263 3300025911 Ga0207654_10000588 Ga0207654_100005887 302
264 3300025911 Ga0207654_10016311 Ga0207654_100163112 302
265 3300025913 Ga0207695_10001282 Ga0207695_1000128215 302
266 3300025913 Ga0207695_10003877 Ga0207695_100038777 302
267 3300025913 Ga0207695_10042778 Ga0207695_100427783 302
268 3300025914 Ga0207671_10002268 Ga0207671_100022688 302
269 3300025914 Ga0207671_10005793 Ga0207671_100057939 302
270 3300025920 Ga0207649_10068238 Ga0207649_100682382 302
271 3300025924 Ga0207694_10004354 Ga0207694_100043546 302
272 3300025924 Ga0207694_10006476 Ga0207694_100064767 302
273 3300025933 Ga0207706_10050072 Ga0207706_100500723 302
274 3300025949 Ga0207667_10002278 Ga0207667_1000227812 302
275 3300025949 Ga0207667_10025395 Ga0207667_100253954 302
276 3300025981 Ga0207640_10002194 Ga0207640_100021944 302
277 3300025981 Ga0207640_10045913 Ga0207640_100459132 302
278 3300026035 Ga0207703_10000086 Ga0207703_1000008624 302
279 3300026041 Ga0207639_10006604 Ga0207639_100066046 302
280 3300026041 Ga0207639_10007846 Ga0207639_100078464 302
281 3300026041 Ga0207639_10027128 Ga0207639_100271284 302
282 3300026041 Ga0207639_10137852 Ga0207639_101378522 302
283 3300026067 Ga0207678_10090176 Ga0207678_100901763 302
284 3300026078 Ga0207702_10001600 Ga0207702_100016008 302
285 3300026078 Ga0207702_10012046 Ga0207702_100120463 302
286 3300026088 Ga0207641_10000395 Ga0207641_1000039547 302
287 3300026095 Ga0207676_10002070 Ga0207676_100020706 302
288 3300026116 Ga0207674_10004009 Ga0207674_100040099 302
289 3300026142 Ga0207698_10000797 Ga0207698_100007977 302
290 3300026142 Ga0207698_10027761 Ga0207698_100277612 302
291 3300026142 Ga0207698_10146001 Ga0207698_101460012 302
292 3300048905 Ga0496102_0180945 Ga0496102_0180945_937_1851 302
293 3300048906 Ga0496103_0090276 Ga0496103_0090276_157_1071 302
294 3300048909 Ga0496106_0064015 Ga0496106_0064015_16_930 302
295 3300048921 Ga0496118_0002674 Ga0496118_0002674_8049_8963 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

68

267

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.9418 10 256
1wzo-assembly1.cif.gz_D crystal structure of the hpce from thermus thermophilus hb8 0.9365 10 258
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.9304 10 258
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.9303 10 256
1wzo-assembly1.cif.gz_D crystal structure of the hpce from thermus thermophilus hb8 0.9289 10 258
ID Description Score Start End Superfamily
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9417 53 256 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9277 53 256 3.90.850.10
1gttA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9271 50 256 3.90.850.10
af_Q96GK7_51_314_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.918 36 255 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9149 56 255 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A645IJT5-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9672 84 254 GO:0018773
GO:0046872
AF-A0A661JR96-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.962 92 257 GO:0018773
GO:0046872
AF-A0A0Q9CK13-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9604 3 295 GO:0016853
GO:0046872
AF-A0A661JR96-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9564 92 257 GO:0018773
GO:0046872
AF-A0A833NRL5-F1-model_v4 5-oxopent-3-ene-1 2 5-tricarboxylate decarboxylase 0.9526 54 255 GO:0018773
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.43 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map