F392858
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 295 | 192 | 280 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300048925|Ga0496122_0000199|Ga0496122_0000199_58724_59701 |
| Length | 325 |
| Sequence | MNFEFPFDELPAVMRGPRVERRRVLVGGSAFWGTVVEEGADAGKLRLDDERLLDAEGQACLPPVSPSKIIAVHISYSSRSHETRNKPKPTETPTYFTKPPTALNGHGGQILKPADVKYLNYEGEYAVVIGKTCRNVTPDEAWDFIEGFCPALDMGLQDFRDTDQGSMLRVKGADTLLPIGPGIVRGVDLFAQTLRTTVNGLVVQEASIGDETIWGPHYVIADIARHITLVPGDVILMGTPCHSRSVDAGDVVACEITGIGRVEGTVVAIDAPRASALGVGHAPTDTPEVRRVALGFDERVPERFKDNLRRAKGERAAKGEGITAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 4 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 5 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 6 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 7 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 8 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 9 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 10 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 11 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 12 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 13 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 14 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 15 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 16 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 27 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 28 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 128 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 129 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 134 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 135 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 148 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 149 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 150 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 151 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 152 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 153 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 173 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 174 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 175 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 178 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 183 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 184 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 185 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 186 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 187 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 188 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 189 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 191 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 192 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.58 |
| Metatranscriptomes | 0.34 |
| Isolates | 5.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.9 |
| Nodule | 0.34 |
| Rhizoplane | 1.02 |
| Rhizosphere | 64.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000107 | 3300001904 | Bacteria | 13974 |
| 2 | JGI24741J21665_1001796 | 3300001915 | Bacteria | 5891 |
| 3 | JGI24740J21852_10000073 | 3300001979 | Bacteria | 33544 |
| 4 | JGI24740J21852_10000225 | 3300001979 | Bacteria | 23975 |
| 5 | JGI24740J21852_10009300 | 3300001979 | Bacteria | 3857 |
| 6 | JGI24740J21852_10009377 | 3300001979 | Bacteria | 3835 |
| 7 | JGI24739J22299_10000098 | 3300001989 | Bacteria | 25916 |
| 8 | JGI24739J22299_10001680 | 3300001989 | Bacteria | 8404 |
| 9 | JGI24735J21928_10003353 | 3300002067 | Bacteria | 5464 |
| 10 | JGI24738J21930_10000165 | 3300002075 | Bacteria | 16719 |
| 11 | JGI25152J39213_1001325 | 3300002773 | Bacteria | 10968 |
| 12 | JGI25151J46595_10002013 | 3300003187 | Bacteria | 12719 |
| 13 | JGI25151J46595_10004222 | 3300003187 | Bacteria | 7645 |
| 14 | JGI25153J46596_10001798 | 3300003215 | Bacteria | 12719 |
| 15 | rootH1_10015038 | 3300003316 | Bacteria | 4584 |
| 16 | rootH1_10033302 | 3300003316 | Bacteria | 27746 |
| 17 | rootH1_10071634 | 3300003323 | Bacteria | 8035 |
| 18 | JGI25160J50197_1023424 | 3300003354 | Bacteria | 1780 |
| 19 | Ga0006562J51391_1061767 | 3300003578 | Bacteria | 9500 |
| 20 | Ga0055538_1000010 | 3300003751 | Bacteria | 376599 |
| 21 | Ga0055539_1000015 | 3300003752 | Bacteria | 376599 |
| 22 | Ga0055533_1000018 | 3300003756 | Bacteria | 376599 |
| 23 | Ga0055525_1000020 | 3300003759 | Bacteria | 376599 |
| 24 | Ga0055526_1002677 | 3300003771 | Bacteria | 11897 |
| 25 | Ga0055536_1001094 | 3300003781 | Bacteria | 17041 |
| 26 | Ga0055530_10002212 | 3300003791 | Bacteria | 12851 |
| 27 | Ga0055540_1000833 | 3300003792 | Bacteria | 20742 |
| 28 | Ga0055531_10001120 | 3300003794 | Bacteria | 20754 |
| 29 | Ga0055541_1000011 | 3300003841 | Bacteria | 376599 |
| 30 | Ga0065165_1003222 | 3300005262 | Bacteria | 11881 |
| 31 | Ga0070658_10000180 | 3300005327 | Bacteria | 55242 |
| 32 | Ga0070670_100077200 | 3300005331 | Bacteria | 2862 |
| 33 | Ga0068869_100014577 | 3300005334 | Bacteria | 5255 |
| 34 | Ga0068868_100115255 | 3300005338 | Bacteria | 2187 |
| 35 | Ga0070708_100240746 | 3300005445 | Bacteria | 1699 |
| 36 | Ga0070663_100017852 | 3300005455 | Bacteria | 4638 |
| 37 | Ga0070662_100000952 | 3300005457 | Bacteria | 17734 |
| 38 | Ga0070662_100011207 | 3300005457 | Bacteria | 5907 |
| 39 | Ga0068853_100003584 | 3300005539 | Bacteria | 11887 |
| 40 | Ga0068853_100013401 | 3300005539 | Bacteria | 6693 |
| 41 | Ga0068853_100032125 | 3300005539 | Bacteria | 4445 |
| 42 | Ga0068853_100244776 | 3300005539 | Bacteria | 1644 |
| 43 | Ga0068853_100266210 | 3300005539 | Bacteria | 1577 |
| 44 | Ga0068855_100008273 | 3300005563 | Bacteria | 12578 |
| 45 | Ga0068855_100056544 | 3300005563 | Bacteria | 4603 |
| 46 | Ga0068855_100066765 | 3300005563 | Bacteria | 4193 |
| 47 | Ga0068855_100086222 | 3300005563 | Bacteria | 3631 |
| 48 | Ga0070664_100007556 | 3300005564 | Bacteria | 8776 |
| 49 | Ga0068857_100002717 | 3300005577 | Bacteria | 14524 |
| 50 | Ga0068857_100069240 | 3300005577 | Bacteria | 3142 |
| 51 | Ga0068857_100075101 | 3300005577 | Bacteria | 3013 |
| 52 | Ga0068854_100013948 | 3300005578 | Bacteria | 5286 |
| 53 | Ga0068854_100018197 | 3300005578 | Bacteria | 4714 |
| 54 | Ga0068856_100002651 | 3300005614 | Bacteria | 18355 |
| 55 | Ga0068856_100002673 | 3300005614 | Bacteria | 18281 |
| 56 | Ga0068852_100000291 | 3300005616 | Bacteria | 33593 |
| 57 | Ga0068852_100002952 | 3300005616 | Bacteria | 11810 |
| 58 | Ga0068852_100009833 | 3300005616 | Bacteria | 7115 |
| 59 | Ga0068852_100012328 | 3300005616 | Bacteria | 6485 |
| 60 | Ga0068852_100178456 | 3300005616 | Bacteria | 1995 |
| 61 | Ga0068859_100026333 | 3300005617 | Bacteria | 5831 |
| 62 | Ga0068859_100211440 | 3300005617 | Bacteria | 2026 |
| 63 | Ga0068864_100002689 | 3300005618 | Bacteria | 14651 |
| 64 | Ga0068851_10008489 | 3300005834 | Bacteria | 4752 |
| 65 | Ga0068851_10028894 | 3300005834 | Bacteria | 2741 |
| 66 | Ga0068863_100000338 | 3300005841 | Bacteria | 47691 |
| 67 | Ga0068858_100000098 | 3300005842 | Bacteria | 90747 |
| 68 | Ga0068860_100001126 | 3300005843 | Bacteria | 29403 |
| 69 | Ga0068862_100002005 | 3300005844 | Bacteria | 18468 |
| 70 | Ga0097620_100026332 | 3300006931 | Bacteria | 5831 |
| 71 | Ga0097620_100211430 | 3300006931 | Bacteria | 2026 |
| 72 | Ga0099826_10045152 | 3300006948 | Bacteria | 3015 |
| 73 | Ga0105244_10000510 | 3300009036 | Bacteria | 34754 |
| 74 | Ga0105250_10015830 | 3300009092 | Bacteria | 3082 |
| 75 | Ga0105240_10026576 | 3300009093 | Bacteria | 7595 |
| 76 | Ga0105240_10032011 | 3300009093 | Bacteria | 6811 |
| 77 | Ga0105245_10032397 | 3300009098 | Bacteria | 4626 |
| 78 | Ga0105247_10033340 | 3300009101 | Bacteria | 3132 |
| 79 | Ga0105243_10025713 | 3300009148 | Bacteria | 4502 |
| 80 | Ga0105241_10007469 | 3300009174 | Bacteria | 8045 |
| 81 | Ga0105241_10028467 | 3300009174 | Bacteria | 4165 |
| 82 | Ga0105248_10004132 | 3300009177 | Bacteria | 16063 |
| 83 | Ga0105237_10002793 | 3300009545 | Bacteria | 21209 |
| 84 | Ga0105237_10023806 | 3300009545 | Bacteria | 6268 |
| 85 | Ga0105238_10002534 | 3300009551 | Bacteria | 18257 |
| 86 | Ga0105238_10015425 | 3300009551 | Bacteria | 7731 |
| 87 | Ga0105238_10028498 | 3300009551 | Bacteria | 5689 |
| 88 | Ga0105238_10057972 | 3300009551 | Bacteria | 3882 |
| 89 | Ga0105249_10000543 | 3300009553 | Bacteria | 34906 |
| 90 | Ga0105239_10007537 | 3300010375 | Bacteria | 12483 |
| 91 | Ga0105239_10020177 | 3300010375 | Bacteria | 7352 |
| 92 | Ga0105239_10069018 | 3300010375 | Bacteria | 3884 |
| 93 | Ga0105239_10637244 | 3300010375 | Bacteria | 1217 |
| 94 | Ga0157373_10002873 | 3300013100 | Bacteria | 13030 |
| 95 | Ga0157370_10001632 | 3300013104 | Bacteria | 27690 |
| 96 | Ga0157370_10003887 | 3300013104 | Bacteria | 17402 |
| 97 | Ga0157370_10005756 | 3300013104 | Bacteria | 13856 |
| 98 | Ga0157369_10001112 | 3300013105 | Bacteria | 33599 |
| 99 | Ga0157369_10001594 | 3300013105 | Bacteria | 27783 |
| 100 | Ga0157369_10004186 | 3300013105 | Bacteria | 17094 |
| 101 | Ga0157378_10144532 | 3300013297 | Bacteria | 2211 |
| 102 | Ga0157372_10000732 | 3300013307 | Bacteria | 35785 |
| 103 | Ga0157372_10010817 | 3300013307 | Bacteria | 9714 |
| 104 | Ga0163163_10124081 | 3300014325 | Bacteria | 2619 |
| 105 | Ga0182008_10001106 | 3300014497 | Bacteria | 18562 |
| 106 | Ga0157376_10000620 | 3300014969 | Bacteria | 22978 |
| 107 | Ga0209784_100025 | 3300025224 | Bacteria | 376681 |
| 108 | Ga0209566_100025 | 3300025225 | Bacteria | 376681 |
| 109 | Ga0209674_100042 | 3300025226 | Bacteria | 376681 |
| 110 | Ga0209563_100046 | 3300025230 | Bacteria | 376681 |
| 111 | Ga0207425_1000910 | 3300025245 | Bacteria | 14190 |
| 112 | Ga0209677_100027 | 3300025253 | Bacteria | 376681 |
| 113 | Ga0209129_1001408 | 3300025258 | Bacteria | 13464 |
| 114 | Ga0209130_1001777 | 3300025284 | Bacteria | 12694 |
| 115 | Ga0209675_1030909 | 3300025291 | Bacteria | 1271 |
| 116 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 117 | Ga0209025_1000291 | 3300025294 | Bacteria | 112755 |
| 118 | Ga0209025_1004413 | 3300025294 | Bacteria | 12242 |
| 119 | Ga0209564_1000621 | 3300025295 | Bacteria | 54266 |
| 120 | Ga0209758_1003534 | 3300025297 | Bacteria | 14084 |
| 121 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 122 | Ga0207426_1002303 | 3300025302 | Bacteria | 12560 |
| 123 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 124 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 125 | Ga0207656_10008068 | 3300025321 | Bacteria | 3862 |
| 126 | Ga0207656_10010019 | 3300025321 | Bacteria | 3534 |
| 127 | Ga0207655_1004190 | 3300025728 | Bacteria | 10347 |
| 128 | Ga0207710_10002770 | 3300025900 | Bacteria | 8011 |
| 129 | Ga0207647_10000657 | 3300025904 | Bacteria | 26990 |
| 130 | Ga0207647_10001113 | 3300025904 | Bacteria | 20682 |
| 131 | Ga0207647_10007684 | 3300025904 | Bacteria | 7767 |
| 132 | Ga0207705_10000228 | 3300025909 | Bacteria | 55776 |
| 133 | Ga0207654_10000588 | 3300025911 | Bacteria | 20498 |
| 134 | Ga0207654_10016311 | 3300025911 | Bacteria | 3866 |
| 135 | Ga0207695_10001282 | 3300025913 | Bacteria | 42704 |
| 136 | Ga0207695_10003877 | 3300025913 | Bacteria | 20702 |
| 137 | Ga0207695_10042778 | 3300025913 | Bacteria | 4833 |
| 138 | Ga0207671_10002268 | 3300025914 | Bacteria | 20795 |
| 139 | Ga0207671_10005793 | 3300025914 | Bacteria | 11244 |
| 140 | Ga0207649_10068238 | 3300025920 | Bacteria | 2260 |
| 141 | Ga0207694_10004354 | 3300025924 | Bacteria | 11062 |
| 142 | Ga0207694_10006476 | 3300025924 | Bacteria | 8910 |
| 143 | Ga0207694_10225313 | 3300025924 | Bacteria | 1530 |
| 144 | Ga0207650_10090259 | 3300025925 | Bacteria | 2340 |
| 145 | Ga0207687_10018515 | 3300025927 | Bacteria | 4599 |
| 146 | Ga0207706_10020791 | 3300025933 | Bacteria | 5895 |
| 147 | Ga0207706_10050072 | 3300025933 | Bacteria | 3692 |
| 148 | Ga0207709_10011663 | 3300025935 | Bacteria | 4844 |
| 149 | Ga0207679_10004047 | 3300025945 | Bacteria | 9107 |
| 150 | Ga0207667_10002278 | 3300025949 | Bacteria | 24132 |
| 151 | Ga0207667_10025395 | 3300025949 | Bacteria | 6484 |
| 152 | Ga0207667_10054541 | 3300025949 | Bacteria | 4204 |
| 153 | Ga0207667_10220249 | 3300025949 | Bacteria | 1944 |
| 154 | Ga0207712_10000388 | 3300025961 | Bacteria | 38208 |
| 155 | Ga0207640_10002194 | 3300025981 | Bacteria | 10494 |
| 156 | Ga0207640_10045913 | 3300025981 | Bacteria | 2808 |
| 157 | Ga0207703_10000086 | 3300026035 | Bacteria | 107307 |
| 158 | Ga0207639_10006604 | 3300026041 | Bacteria | 7888 |
| 159 | Ga0207639_10007846 | 3300026041 | Bacteria | 7291 |
| 160 | Ga0207639_10027128 | 3300026041 | Bacteria | 4168 |
| 161 | Ga0207639_10137852 | 3300026041 | Bacteria | 2029 |
| 162 | Ga0207639_10524785 | 3300026041 | Bacteria | 1085 |
| 163 | Ga0207678_10090176 | 3300026067 | Bacteria | 2620 |
| 164 | Ga0207702_10001600 | 3300026078 | Bacteria | 22401 |
| 165 | Ga0207702_10012046 | 3300026078 | Bacteria | 7191 |
| 166 | Ga0207641_10000395 | 3300026088 | Bacteria | 51273 |
| 167 | Ga0207641_10002050 | 3300026088 | Bacteria | 19167 |
| 168 | Ga0207676_10002070 | 3300026095 | Bacteria | 14565 |
| 169 | Ga0207674_10004009 | 3300026116 | Bacteria | 17885 |
| 170 | Ga0207674_10083018 | 3300026116 | Bacteria | 3204 |
| 171 | Ga0207698_10000797 | 3300026142 | Bacteria | 18332 |
| 172 | Ga0207698_10006706 | 3300026142 | Bacteria | 7194 |
| 173 | Ga0207698_10027761 | 3300026142 | Bacteria | 4024 |
| 174 | Ga0207698_10146001 | 3300026142 | Bacteria | 2046 |
| 175 | Ga0268265_10000121 | 3300028380 | Bacteria | 97688 |
| 176 | Ga0268264_10005300 | 3300028381 | Bacteria | 10920 |
| 177 | Ga0268264_10267731 | 3300028381 | Bacteria | 1595 |
| 178 | Ga0307517_10066298 | 3300028786 | Bacteria | 3324 |
| 179 | Ga0307515_10000047 | 3300028794 | Bacteria | 291475 |
| 180 | Ga0307515_10000178 | 3300028794 | Bacteria | 157107 |
| 181 | Ga0307515_10000672 | 3300028794 | Bacteria | 78835 |
| 182 | Ga0307515_10001013 | 3300028794 | Bacteria | 64205 |
| 183 | Ga0307515_10001836 | 3300028794 | Bacteria | 47333 |
| 184 | Ga0307515_10003361 | 3300028794 | Bacteria | 33757 |
| 185 | Ga0307515_10045647 | 3300028794 | Bacteria | 6723 |
| 186 | Ga0307515_10065808 | 3300028794 | Bacteria | 5034 |
| 187 | Ga0307515_10127061 | 3300028794 | Bacteria | 2838 |
| 188 | Ga0307512_10194178 | 3300030522 | Bacteria | 1113 |
| 189 | Ga0307513_10041072 | 3300031456 | Bacteria | 5109 |
| 190 | Ga0307513_10071530 | 3300031456 | Bacteria | 3619 |
| 191 | Ga0307513_10084654 | 3300031456 | Bacteria | 3256 |
| 192 | Ga0307509_10002620 | 3300031507 | Bacteria | 28791 |
| 193 | Ga0307509_10003530 | 3300031507 | Bacteria | 23571 |
| 194 | Ga0307408_100018968 | 3300031548 | Bacteria | 4625 |
| 195 | Ga0307508_10000130 | 3300031616 | Bacteria | 89085 |
| 196 | Ga0307508_10000155 | 3300031616 | Bacteria | 82771 |
| 197 | Ga0307514_10001174 | 3300031649 | Bacteria | 35389 |
| 198 | Ga0307514_10002433 | 3300031649 | Bacteria | 19409 |
| 199 | Ga0307516_10000286 | 3300031730 | Bacteria | 65447 |
| 200 | Ga0307516_10031704 | 3300031730 | Bacteria | 5327 |
| 201 | Ga0307516_10057808 | 3300031730 | Bacteria | 3777 |
| 202 | Ga0307406_10057855 | 3300031901 | Bacteria | 2489 |
| 203 | Ga0307406_10199853 | 3300031901 | Bacteria | 1470 |
| 204 | Ga0307412_10089788 | 3300031911 | Bacteria | 2146 |
| 205 | Ga0307416_100208623 | 3300032002 | Bacteria | 1861 |
| 206 | Ga0307416_100291747 | 3300032002 | Bacteria | 1615 |
| 207 | Ga0307411_10209029 | 3300032005 | Bacteria | 1505 |
| 208 | Ga0307507_10118147 | 3300033179 | Bacteria | 2133 |
| 209 | Ga0307507_10171488 | 3300033179 | Bacteria | 1575 |
| 210 | Ga0307510_10200101 | 3300033180 | Bacteria | 1533 |
| 211 | Ga0307510_10255320 | 3300033180 | Unclassified | 1237 |
| 212 | Ga0373925_0065294 | 3300037068 | Bacteria | 2741 |
| 213 | Ga0395900_0024753 | 3300037418 | Bacteria | 6144 |
| 214 | Ga0395900_0037320 | 3300037418 | Bacteria | 5011 |
| 215 | Ga0395900_0072945 | 3300037418 | Bacteria | 3528 |
| 216 | Ga0395898_0005387 | 3300037466 | Bacteria | 13829 |
| 217 | Ga0395898_0067627 | 3300037466 | Bacteria | 3458 |
| 218 | Ga0395905_0079917 | 3300037471 | Bacteria | 3064 |
| 219 | Ga0395905_0101962 | 3300037471 | Bacteria | 2694 |
| 220 | Ga0395905_0145777 | 3300037471 | Bacteria | 2227 |
| 221 | Ga0395905_0146965 | 3300037471 | Bacteria | 2218 |
| 222 | Ga0395901_0000009 | 3300038443 | Bacteria | 479396 |
| 223 | Ga0395901_0000034 | 3300038443 | Bacteria | 230365 |
| 224 | Ga0395901_0000432 | 3300038443 | Bacteria | 49091 |
| 225 | Ga0395901_0056641 | 3300038443 | Bacteria | 4078 |
| 226 | Ga0436361_0348172 | 3300039447 | Bacteria | 5455 |
| 227 | Ga0436361_0883190 | 3300039447 | Bacteria | 11458 |
| 228 | Ga0451855_1027104 | 3300041511 | Bacteria | 1351 |
| 229 | Ga0439462_0040822 | 3300042015 | Bacteria | 1238 |
| 230 | Ga0450911_000097 | 3300042115 | Bacteria | 35730 |
| 231 | Ga0451577_0007642 | 3300042876 | Bacteria | 10601 |
| 232 | Ga0466977_0001549 | 3300044666 | Bacteria | 9615 |
| 233 | Ga0466965_0013056 | 3300044683 | Bacteria | 3914 |
| 234 | Ga0466961_0001031 | 3300044693 | Bacteria | 17198 |
| 235 | Ga0466963_0001017 | 3300044694 | Bacteria | 14520 |
| 236 | Ga0466964_0006006 | 3300044706 | Bacteria | 4526 |
| 237 | Ga0466971_0000224 | 3300044719 | Bacteria | 21717 |
| 238 | Ga0466970_0008629 | 3300044765 | Bacteria | 5134 |
| 239 | Ga0466959_0000620 | 3300045049 | Bacteria | 20592 |
| 240 | Ga0451576_0020496 | 3300045051 | Bacteria | 7198 |
| 241 | Ga0466958_0001219 | 3300045836 | Bacteria | 12015 |
| 242 | Ga0495650_0003261 | 3300046471 | Bacteria | 12028 |
| 243 | Ga0495610_0058569 | 3300046512 | Bacteria | 1842 |
| 244 | Ga0495632_0003077 | 3300046519 | Bacteria | 12111 |
| 245 | Ga0495654_0000307 | 3300046530 | Bacteria | 43179 |
| 246 | Ga0495625_0001839 | 3300046660 | Bacteria | 24238 |
| 247 | Ga0495661_0001271 | 3300046665 | Bacteria | 21687 |
| 248 | Ga0495677_0023455 | 3300047445 | Bacteria | 2240 |
| 249 | Ga0495686_0026354 | 3300047472 | Bacteria | 3803 |
| 250 | Ga0496102_0180945 | 3300048905 | Bacteria | 1986 |
| 251 | Ga0496103_0090276 | 3300048906 | Bacteria | 1933 |
| 252 | Ga0496106_0064015 | 3300048909 | Bacteria | 2797 |
| 253 | Ga0496116_0011975 | 3300048919 | Bacteria | 7125 |
| 254 | Ga0496117_0002257 | 3300048920 | Bacteria | 24885 |
| 255 | Ga0496118_0002464 | 3300048921 | Bacteria | 24866 |
| 256 | Ga0496118_0002674 | 3300048921 | Bacteria | 23560 |
| 257 | Ga0496121_0000257 | 3300048924 | Bacteria | 112257 |
| 258 | Ga0496121_0014575 | 3300048924 | Bacteria | 8327 |
| 259 | Ga0496122_0000199 | 3300048925 | Bacteria | 133898 |
| 260 | Ga0496123_0000102 | 3300048926 | Bacteria | 169327 |
| 261 | Ga0496124_0160125 | 3300048927 | Bacteria | 1755 |
| 262 | Ga0496125_0005965 | 3300048928 | Bacteria | 13335 |
| 263 | Ga0496125_0009217 | 3300048928 | Bacteria | 10197 |
| 264 | Ga0496125_0009870 | 3300048928 | Bacteria | 9712 |
| 265 | Ga0496125_0072960 | 3300048928 | Bacteria | 2672 |
| 266 | Ga0496126_0028163 | 3300048929 | Bacteria | 5357 |
| 267 | Ga0496126_0061836 | 3300048929 | Bacteria | 3362 |
| 268 | Ga0496126_0108606 | 3300048929 | Bacteria | 2419 |
| 269 | Ga0501206_000803 | 3300049653 | Bacteria | 3841 |
| 270 | Ga0501223_006747 | 3300049663 | Bacteria | 2364 |
| 271 | Ga0501249_012011 | 3300049679 | Bacteria | 1827 |
| 272 | Ga0501257_045347 | 3300049686 | Bacteria | 1087 |
| 273 | Ga0500658_0011694 | 3300053134 | Bacteria | 3234 |
| 274 | Ga0500559_0002982 | 3300053136 | Bacteria | 8490 |
| 275 | Ga0500559_0016612 | 3300053136 | Bacteria | 3108 |
| 276 | Ga0500573_0035786 | 3300053140 | Bacteria | 2866 |
| 277 | Ga0500627_0000726 | 3300053158 | Bacteria | 8755 |
| 278 | Ga0500570_072063 | 3300053724 | Bacteria | 1606 |
| 279 | Ga0500587_004098 | 3300053739 | Bacteria | 2013 |
| 280 | Ga0466962_0001465 | 3300061719 | Bacteria | 11008 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009174 | Ga0105241_10028467 | Ga0105241_100284675 | 250 |
| 2 | 3300046512 | Ga0495610_0058569 | Ga0495610_0058569_1037_1828 | 261 |
| 3 | 3300042015 | Ga0439462_0040822 | Ga0439462_0040822_398_1219 | 268 |
| 4 | 3300044693 | Ga0466961_0001031 | Ga0466961_0001031_6873_7754 | 287 |
| 5 | 3300044694 | Ga0466963_0001017 | Ga0466963_0001017_8070_8951 | 287 |
| 6 | 3300044719 | Ga0466971_0000224 | Ga0466971_0000224_13667_14548 | 287 |
| 7 | 3300045049 | Ga0466959_0000620 | Ga0466959_0000620_12546_13427 | 287 |
| 8 | 3300045836 | Ga0466958_0001219 | Ga0466958_0001219_8435_9316 | 287 |
| 9 | 3300061719 | Ga0466962_0001465 | Ga0466962_0001465_1533_2414 | 287 |
| 10 | iso_pu_bacteria | 2919138771 | 2919142922 | 295 |
| 11 | 3300003187 | JGI25151J46595_10004222 | JGI25151J46595_100042227 | 297 |
| 12 | 3300005334 | Ga0068869_100014577 | Ga0068869_1000145772 | 297 |
| 13 | 3300005338 | Ga0068868_100115255 | Ga0068868_1001152552 | 297 |
| 14 | 3300005539 | Ga0068853_100266210 | Ga0068853_1002662101 | 297 |
| 15 | 3300025294 | Ga0209025_1000291 | Ga0209025_100029190 | 297 |
| 16 | 3300002773 | JGI25152J39213_1001325 | JGI25152J39213_10013258 | 298 |
| 17 | 3300003187 | JGI25151J46595_10002013 | JGI25151J46595_1000201310 | 298 |
| 18 | 3300003215 | JGI25153J46596_10001798 | JGI25153J46596_1000179810 | 298 |
| 19 | 3300003354 | JGI25160J50197_1023424 | JGI25160J50197_10234242 | 298 |
| 20 | 3300003578 | Ga0006562J51391_1061767 | Ga0006562J51391_10617677 | 298 |
| 21 | 3300003781 | Ga0055536_1001094 | Ga0055536_10010948 | 298 |
| 22 | 3300003791 | Ga0055530_10002212 | Ga0055530_100022124 | 298 |
| 23 | 3300003792 | Ga0055540_1000833 | Ga0055540_100083312 | 298 |
| 24 | 3300003794 | Ga0055531_10001120 | Ga0055531_1000112012 | 298 |
| 25 | 3300005262 | Ga0065165_1003222 | Ga0065165_10032223 | 298 |
| 26 | 3300005445 | Ga0070708_100240746 | Ga0070708_1002407462 | 298 |
| 27 | 3300005616 | Ga0068852_100009833 | Ga0068852_1000098335 | 298 |
| 28 | 3300025245 | Ga0207425_1000910 | Ga0207425_10009104 | 298 |
| 29 | 3300025258 | Ga0209129_1001408 | Ga0209129_10014085 | 298 |
| 30 | 3300025284 | Ga0209130_1001777 | Ga0209130_100177710 | 298 |
| 31 | 3300025292 | Ga0209676_1000004 | Ga0209676_100000462 | 298 |
| 32 | 3300025294 | Ga0209025_1004413 | Ga0209025_10044139 | 298 |
| 33 | 3300025297 | Ga0209758_1003534 | Ga0209758_10035349 | 298 |
| 34 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002572 | 298 |
| 35 | 3300025302 | Ga0207426_1002303 | Ga0207426_10023039 | 298 |
| 36 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002340 | 298 |
| 37 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002481 | 298 |
| 38 | 3300026142 | Ga0207698_10006706 | Ga0207698_100067063 | 298 |
| 39 | 3300028794 | Ga0307515_10000047 | Ga0307515_10000047189 | 298 |
| 40 | 3300028794 | Ga0307515_10001836 | Ga0307515_1000183623 | 298 |
| 41 | 3300028794 | Ga0307515_10045647 | Ga0307515_100456479 | 298 |
| 42 | 3300031730 | Ga0307516_10031704 | Ga0307516_100317043 | 298 |
| 43 | 3300038443 | Ga0395901_0000009 | Ga0395901_0000009_170863_171810 | 298 |
| 44 | 3300041511 | Ga0451855_1027104 | Ga0451855_1027104_204_1148 | 298 |
| 45 | 3300042876 | Ga0451577_0007642 | Ga0451577_0007642_4736_5680 | 298 |
| 46 | 3300045051 | Ga0451576_0020496 | Ga0451576_0020496_716_1648 | 298 |
| 47 | 3300046660 | Ga0495625_0001839 | Ga0495625_0001839_5581_6525 | 298 |
| 48 | 3300053134 | Ga0500658_0011694 | Ga0500658_0011694_541_1485 | 298 |
| 49 | 3300053724 | Ga0500570_072063 | Ga0500570_072063_495_1439 | 298 |
| 50 | 3300053739 | Ga0500587_004098 | Ga0500587_004098_271_1215 | 298 |
| 51 | iso_pu_bacteria | 2547132374 | 2548498996 | 298 |
| 52 | iso_pu_bacteria | 2585428062 | 2587754715 | 298 |
| 53 | iso_pu_bacteria | 2643221609 | 2644062167 | 298 |
| 54 | iso_pu_bacteria | 2643221611 | 2644071355 | 298 |
| 55 | iso_pu_bacteria | 2643221717 | 2644648453 | 298 |
| 56 | iso_pu_bacteria | 2738543012 | 2739245778 | 298 |
| 57 | iso_pu_bacteria | 2816332133 | 2816470472 | 298 |
| 58 | iso_pu_bacteria | 2831265667 | 2831267545 | 298 |
| 59 | iso_pu_bacteria | 2928115317 | 2928117523 | 298 |
| 60 | 3300003323 | rootH1_10071634 | rootH1_100716347 | 299 |
| 61 | 3300003771 | Ga0055526_1002677 | Ga0055526_10026776 | 299 |
| 62 | 3300014497 | Ga0182008_10001106 | Ga0182008_1000110617 | 299 |
| 63 | 3300025291 | Ga0209675_1030909 | Ga0209675_10309092 | 299 |
| 64 | 3300025295 | Ga0209564_1000621 | Ga0209564_100062124 | 299 |
| 65 | 3300028786 | Ga0307517_10066298 | Ga0307517_100662982 | 299 |
| 66 | 3300028794 | Ga0307515_10065808 | Ga0307515_100658083 | 299 |
| 67 | 3300028794 | Ga0307515_10127061 | Ga0307515_101270612 | 299 |
| 68 | 3300031456 | Ga0307513_10084654 | Ga0307513_100846543 | 299 |
| 69 | 3300031507 | Ga0307509_10003530 | Ga0307509_1000353013 | 299 |
| 70 | 3300031901 | Ga0307406_10057855 | Ga0307406_100578552 | 299 |
| 71 | 3300031901 | Ga0307406_10199853 | Ga0307406_101998531 | 299 |
| 72 | 3300032002 | Ga0307416_100208623 | Ga0307416_1002086232 | 299 |
| 73 | 3300037068 | Ga0373925_0065294 | Ga0373925_0065294_29_976 | 299 |
| 74 | 3300042115 | Ga0450911_000097 | Ga0450911_000097_15212_16159 | 299 |
| 75 | 3300046471 | Ga0495650_0003261 | Ga0495650_0003261_5069_6016 | 299 |
| 76 | 3300047472 | Ga0495686_0026354 | Ga0495686_0026354_1018_1917 | 299 |
| 77 | 3300048924 | Ga0496121_0014575 | Ga0496121_0014575_1732_2679 | 299 |
| 78 | 3300048927 | Ga0496124_0160125 | Ga0496124_0160125_88_1035 | 299 |
| 79 | 3300048928 | Ga0496125_0009217 | Ga0496125_0009217_3389_4336 | 299 |
| 80 | 3300048928 | Ga0496125_0009870 | Ga0496125_0009870_7957_8904 | 299 |
| 81 | 3300048929 | Ga0496126_0108606 | Ga0496126_0108606_990_1937 | 299 |
| 82 | 3300049653 | Ga0501206_000803 | Ga0501206_000803_1578_2525 | 299 |
| 83 | 3300049679 | Ga0501249_012011 | Ga0501249_012011_207_1154 | 299 |
| 84 | 3300049686 | Ga0501257_045347 | Ga0501257_045347_79_1026 | 299 |
| 85 | 3300053136 | Ga0500559_0002982 | Ga0500559_0002982_5591_6553 | 299 |
| 86 | 3300053140 | Ga0500573_0035786 | Ga0500573_0035786_1169_2131 | 299 |
| 87 | 3300001989 | JGI24739J22299_10001680 | JGI24739J22299_100016805 | 300 |
| 88 | 3300003316 | rootH1_10015038 | rootH1_100150383 | 300 |
| 89 | 3300003316 | rootH1_10033302 | rootH1_1003330221 | 300 |
| 90 | 3300003751 | Ga0055538_1000010 | Ga0055538_1000010279 | 300 |
| 91 | 3300003752 | Ga0055539_1000015 | Ga0055539_1000015279 | 300 |
| 92 | 3300003756 | Ga0055533_1000018 | Ga0055533_1000018279 | 300 |
| 93 | 3300003759 | Ga0055525_1000020 | Ga0055525_1000020279 | 300 |
| 94 | 3300003841 | Ga0055541_1000011 | Ga0055541_1000011279 | 300 |
| 95 | 3300005331 | Ga0070670_100077200 | Ga0070670_1000772003 | 300 |
| 96 | 3300005457 | Ga0070662_100000952 | Ga0070662_1000009523 | 300 |
| 97 | 3300005563 | Ga0068855_100066765 | Ga0068855_1000667653 | 300 |
| 98 | 3300005563 | Ga0068855_100086222 | Ga0068855_1000862222 | 300 |
| 99 | 3300005564 | Ga0070664_100007556 | Ga0070664_1000075563 | 300 |
| 100 | 3300005577 | Ga0068857_100069240 | Ga0068857_1000692403 | 300 |
| 101 | 3300005616 | Ga0068852_100178456 | Ga0068852_1001784562 | 300 |
| 102 | 3300005617 | Ga0068859_100026333 | Ga0068859_1000263334 | 300 |
| 103 | 3300005617 | Ga0068859_100211440 | Ga0068859_1002114402 | 300 |
| 104 | 3300005843 | Ga0068860_100001126 | Ga0068860_10000112622 | 300 |
| 105 | 3300005844 | Ga0068862_100002005 | Ga0068862_10000200524 | 300 |
| 106 | 3300006931 | Ga0097620_100026332 | Ga0097620_1000263324 | 300 |
| 107 | 3300006931 | Ga0097620_100211430 | Ga0097620_1002114302 | 300 |
| 108 | 3300006948 | Ga0099826_10045152 | Ga0099826_100451523 | 300 |
| 109 | 3300009036 | Ga0105244_10000510 | Ga0105244_1000051034 | 300 |
| 110 | 3300009098 | Ga0105245_10032397 | Ga0105245_100323974 | 300 |
| 111 | 3300009101 | Ga0105247_10033340 | Ga0105247_100333402 | 300 |
| 112 | 3300009148 | Ga0105243_10025713 | Ga0105243_100257133 | 300 |
| 113 | 3300009551 | Ga0105238_10028498 | Ga0105238_100284982 | 300 |
| 114 | 3300009553 | Ga0105249_10000543 | Ga0105249_1000054321 | 300 |
| 115 | 3300010375 | Ga0105239_10637244 | Ga0105239_106372442 | 300 |
| 116 | 3300013297 | Ga0157378_10144532 | Ga0157378_101445322 | 300 |
| 117 | 3300014325 | Ga0163163_10124081 | Ga0163163_101240812 | 300 |
| 118 | 3300014969 | Ga0157376_10000620 | Ga0157376_1000062019 | 300 |
| 119 | 3300025224 | Ga0209784_100025 | Ga0209784_100025276 | 300 |
| 120 | 3300025225 | Ga0209566_100025 | Ga0209566_100025276 | 300 |
| 121 | 3300025226 | Ga0209674_100042 | Ga0209674_100042276 | 300 |
| 122 | 3300025230 | Ga0209563_100046 | Ga0209563_100046276 | 300 |
| 123 | 3300025253 | Ga0209677_100027 | Ga0209677_100027276 | 300 |
| 124 | 3300025728 | Ga0207655_1004190 | Ga0207655_10041905 | 300 |
| 125 | 3300025900 | Ga0207710_10002770 | Ga0207710_100027707 | 300 |
| 126 | 3300025904 | Ga0207647_10007684 | Ga0207647_100076845 | 300 |
| 127 | 3300025924 | Ga0207694_10225313 | Ga0207694_102253132 | 300 |
| 128 | 3300025925 | Ga0207650_10090259 | Ga0207650_100902592 | 300 |
| 129 | 3300025927 | Ga0207687_10018515 | Ga0207687_100185152 | 300 |
| 130 | 3300025933 | Ga0207706_10020791 | Ga0207706_100207914 | 300 |
| 131 | 3300025935 | Ga0207709_10011663 | Ga0207709_100116634 | 300 |
| 132 | 3300025945 | Ga0207679_10004047 | Ga0207679_100040476 | 300 |
| 133 | 3300025949 | Ga0207667_10054541 | Ga0207667_100545413 | 300 |
| 134 | 3300025949 | Ga0207667_10220249 | Ga0207667_102202491 | 300 |
| 135 | 3300025961 | Ga0207712_10000388 | Ga0207712_1000038822 | 300 |
| 136 | 3300026041 | Ga0207639_10524785 | Ga0207639_105247851 | 300 |
| 137 | 3300026088 | Ga0207641_10002050 | Ga0207641_1000205016 | 300 |
| 138 | 3300026116 | Ga0207674_10083018 | Ga0207674_100830182 | 300 |
| 139 | 3300028380 | Ga0268265_10000121 | Ga0268265_1000012124 | 300 |
| 140 | 3300028381 | Ga0268264_10005300 | Ga0268264_100053002 | 300 |
| 141 | 3300028381 | Ga0268264_10267731 | Ga0268264_102677312 | 300 |
| 142 | 3300028794 | Ga0307515_10000178 | Ga0307515_10000178107 | 300 |
| 143 | 3300028794 | Ga0307515_10000672 | Ga0307515_1000067225 | 300 |
| 144 | 3300028794 | Ga0307515_10001013 | Ga0307515_1000101312 | 300 |
| 145 | 3300028794 | Ga0307515_10003361 | Ga0307515_1000336130 | 300 |
| 146 | 3300030522 | Ga0307512_10194178 | Ga0307512_101941782 | 300 |
| 147 | 3300031456 | Ga0307513_10041072 | Ga0307513_100410723 | 300 |
| 148 | 3300031456 | Ga0307513_10071530 | Ga0307513_100715302 | 300 |
| 149 | 3300031507 | Ga0307509_10002620 | Ga0307509_1000262012 | 300 |
| 150 | 3300031548 | Ga0307408_100018968 | Ga0307408_1000189683 | 300 |
| 151 | 3300031616 | Ga0307508_10000130 | Ga0307508_1000013055 | 300 |
| 152 | 3300031616 | Ga0307508_10000155 | Ga0307508_1000015524 | 300 |
| 153 | 3300031649 | Ga0307514_10001174 | Ga0307514_100011743 | 300 |
| 154 | 3300031649 | Ga0307514_10002433 | Ga0307514_1000243312 | 300 |
| 155 | 3300031730 | Ga0307516_10000286 | Ga0307516_1000028647 | 300 |
| 156 | 3300031730 | Ga0307516_10057808 | Ga0307516_100578082 | 300 |
| 157 | 3300031911 | Ga0307412_10089788 | Ga0307412_100897882 | 300 |
| 158 | 3300032002 | Ga0307416_100291747 | Ga0307416_1002917472 | 300 |
| 159 | 3300032005 | Ga0307411_10209029 | Ga0307411_102090292 | 300 |
| 160 | 3300033179 | Ga0307507_10118147 | Ga0307507_101181472 | 300 |
| 161 | 3300033179 | Ga0307507_10171488 | Ga0307507_101714882 | 300 |
| 162 | 3300033180 | Ga0307510_10200101 | Ga0307510_102001012 | 300 |
| 163 | 3300033180 | Ga0307510_10255320 | Ga0307510_102553202 | 300 |
| 164 | 3300037418 | Ga0395900_0024753 | Ga0395900_0024753_4210_5175 | 300 |
| 165 | 3300037418 | Ga0395900_0037320 | Ga0395900_0037320_1451_2422 | 300 |
| 166 | 3300037418 | Ga0395900_0072945 | Ga0395900_0072945_2050_2994 | 300 |
| 167 | 3300037466 | Ga0395898_0005387 | Ga0395898_0005387_11130_12101 | 300 |
| 168 | 3300037466 | Ga0395898_0067627 | Ga0395898_0067627_1652_2596 | 300 |
| 169 | 3300037471 | Ga0395905_0079917 | Ga0395905_0079917_1537_2487 | 300 |
| 170 | 3300037471 | Ga0395905_0101962 | Ga0395905_0101962_1552_2502 | 300 |
| 171 | 3300037471 | Ga0395905_0145777 | Ga0395905_0145777_933_1898 | 300 |
| 172 | 3300037471 | Ga0395905_0146965 | Ga0395905_0146965_79_1044 | 300 |
| 173 | 3300038443 | Ga0395901_0000034 | Ga0395901_0000034_13003_13974 | 300 |
| 174 | 3300038443 | Ga0395901_0000432 | Ga0395901_0000432_20377_21348 | 300 |
| 175 | 3300038443 | Ga0395901_0056641 | Ga0395901_0056641_2674_3639 | 300 |
| 176 | 3300039447 | Ga0436361_0348172 | Ga0436361_0348172_3463_4416 | 300 |
| 177 | 3300039447 | Ga0436361_0883190 | Ga0436361_0883190_7482_8435 | 300 |
| 178 | 3300044666 | Ga0466977_0001549 | Ga0466977_0001549_4153_5103 | 300 |
| 179 | 3300044683 | Ga0466965_0013056 | Ga0466965_0013056_1888_2859 | 300 |
| 180 | 3300044706 | Ga0466964_0006006 | Ga0466964_0006006_731_1702 | 300 |
| 181 | 3300044765 | Ga0466970_0008629 | Ga0466970_0008629_4061_5032 | 300 |
| 182 | 3300046519 | Ga0495632_0003077 | Ga0495632_0003077_6940_7884 | 300 |
| 183 | 3300046530 | Ga0495654_0000307 | Ga0495654_0000307_5894_6850 | 300 |
| 184 | 3300046665 | Ga0495661_0001271 | Ga0495661_0001271_12185_13129 | 300 |
| 185 | 3300047445 | Ga0495677_0023455 | Ga0495677_0023455_287_1231 | 300 |
| 186 | 3300048919 | Ga0496116_0011975 | Ga0496116_0011975_166_1119 | 300 |
| 187 | 3300048920 | Ga0496117_0002257 | Ga0496117_0002257_9393_10346 | 300 |
| 188 | 3300048921 | Ga0496118_0002464 | Ga0496118_0002464_14421_15374 | 300 |
| 189 | 3300048924 | Ga0496121_0000257 | Ga0496121_0000257_18531_19481 | 300 |
| 190 | 3300048925 | Ga0496122_0000199 | Ga0496122_0000199_58724_59701 | 300 |
| 191 | 3300048926 | Ga0496123_0000102 | Ga0496123_0000102_92920_93897 | 300 |
| 192 | 3300048928 | Ga0496125_0005965 | Ga0496125_0005965_9760_10698 | 300 |
| 193 | 3300048928 | Ga0496125_0072960 | Ga0496125_0072960_547_1500 | 300 |
| 194 | 3300048929 | Ga0496126_0028163 | Ga0496126_0028163_2351_3289 | 300 |
| 195 | 3300048929 | Ga0496126_0061836 | Ga0496126_0061836_203_1180 | 300 |
| 196 | 3300049663 | Ga0501223_006747 | Ga0501223_006747_1327_2286 | 300 |
| 197 | 3300053136 | Ga0500559_0016612 | Ga0500559_0016612_578_1555 | 300 |
| 198 | 3300053158 | Ga0500627_0000726 | Ga0500627_0000726_3384_4286 | 300 |
| 199 | iso_pu_bacteria | 2643221596 | 2643992009 | 300 |
| 200 | iso_pu_bacteria | 2842733646 | 2842739007 | 300 |
| 201 | iso_pu_bacteria | 2842747753 | 2842748699 | 300 |
| 202 | iso_pu_bacteria | 2842747753 | 2842751777 | 300 |
| 203 | iso_pu_bacteria | 2900634093 | 2900643278 | 300 |
| 204 | 3300001904 | JGI24736J21556_1000107 | JGI24736J21556_10001076 | 302 |
| 205 | 3300001915 | JGI24741J21665_1001796 | JGI24741J21665_10017964 | 302 |
| 206 | 3300001979 | JGI24740J21852_10000073 | JGI24740J21852_1000007323 | 302 |
| 207 | 3300001979 | JGI24740J21852_10000225 | JGI24740J21852_1000022515 | 302 |
| 208 | 3300001979 | JGI24740J21852_10009300 | JGI24740J21852_100093003 | 302 |
| 209 | 3300001979 | JGI24740J21852_10009377 | JGI24740J21852_100093774 | 302 |
| 210 | 3300001989 | JGI24739J22299_10000098 | JGI24739J22299_1000009814 | 302 |
| 211 | 3300002067 | JGI24735J21928_10003353 | JGI24735J21928_100033531 | 302 |
| 212 | 3300002075 | JGI24738J21930_10000165 | JGI24738J21930_1000016513 | 302 |
| 213 | 3300005327 | Ga0070658_10000180 | Ga0070658_1000018027 | 302 |
| 214 | 3300005455 | Ga0070663_100017852 | Ga0070663_1000178523 | 302 |
| 215 | 3300005457 | Ga0070662_100011207 | Ga0070662_1000112073 | 302 |
| 216 | 3300005539 | Ga0068853_100003584 | Ga0068853_10000358410 | 302 |
| 217 | 3300005539 | Ga0068853_100013401 | Ga0068853_1000134017 | 302 |
| 218 | 3300005539 | Ga0068853_100032125 | Ga0068853_1000321254 | 302 |
| 219 | 3300005539 | Ga0068853_100244776 | Ga0068853_1002447762 | 302 |
| 220 | 3300005563 | Ga0068855_100008273 | Ga0068855_1000082738 | 302 |
| 221 | 3300005563 | Ga0068855_100056544 | Ga0068855_1000565443 | 302 |
| 222 | 3300005577 | Ga0068857_100002717 | Ga0068857_10000271712 | 302 |
| 223 | 3300005577 | Ga0068857_100075101 | Ga0068857_1000751013 | 302 |
| 224 | 3300005578 | Ga0068854_100013948 | Ga0068854_1000139486 | 302 |
| 225 | 3300005578 | Ga0068854_100018197 | Ga0068854_1000181973 | 302 |
| 226 | 3300005614 | Ga0068856_100002651 | Ga0068856_1000026514 | 302 |
| 227 | 3300005614 | Ga0068856_100002673 | Ga0068856_10000267312 | 302 |
| 228 | 3300005616 | Ga0068852_100000291 | Ga0068852_10000029121 | 302 |
| 229 | 3300005616 | Ga0068852_100002952 | Ga0068852_1000029529 | 302 |
| 230 | 3300005616 | Ga0068852_100012328 | Ga0068852_1000123284 | 302 |
| 231 | 3300005618 | Ga0068864_100002689 | Ga0068864_1000026896 | 302 |
| 232 | 3300005834 | Ga0068851_10008489 | Ga0068851_100084893 | 302 |
| 233 | 3300005834 | Ga0068851_10028894 | Ga0068851_100288942 | 302 |
| 234 | 3300005841 | Ga0068863_100000338 | Ga0068863_10000033841 | 302 |
| 235 | 3300005842 | Ga0068858_100000098 | Ga0068858_1000000987 | 302 |
| 236 | 3300009092 | Ga0105250_10015830 | Ga0105250_100158303 | 302 |
| 237 | 3300009093 | Ga0105240_10026576 | Ga0105240_100265762 | 302 |
| 238 | 3300009093 | Ga0105240_10032011 | Ga0105240_100320115 | 302 |
| 239 | 3300009174 | Ga0105241_10007469 | Ga0105241_100074694 | 302 |
| 240 | 3300009177 | Ga0105248_10004132 | Ga0105248_1000413210 | 302 |
| 241 | 3300009545 | Ga0105237_10002793 | Ga0105237_100027935 | 302 |
| 242 | 3300009545 | Ga0105237_10023806 | Ga0105237_100238063 | 302 |
| 243 | 3300009551 | Ga0105238_10002534 | Ga0105238_1000253410 | 302 |
| 244 | 3300009551 | Ga0105238_10015425 | Ga0105238_100154254 | 302 |
| 245 | 3300009551 | Ga0105238_10057972 | Ga0105238_100579724 | 302 |
| 246 | 3300010375 | Ga0105239_10007537 | Ga0105239_1000753712 | 302 |
| 247 | 3300010375 | Ga0105239_10020177 | Ga0105239_100201773 | 302 |
| 248 | 3300010375 | Ga0105239_10069018 | Ga0105239_100690184 | 302 |
| 249 | 3300013100 | Ga0157373_10002873 | Ga0157373_100028738 | 302 |
| 250 | 3300013104 | Ga0157370_10001632 | Ga0157370_1000163216 | 302 |
| 251 | 3300013104 | Ga0157370_10003887 | Ga0157370_100038878 | 302 |
| 252 | 3300013104 | Ga0157370_10005756 | Ga0157370_100057567 | 302 |
| 253 | 3300013105 | Ga0157369_10001112 | Ga0157369_1000111222 | 302 |
| 254 | 3300013105 | Ga0157369_10001594 | Ga0157369_1000159415 | 302 |
| 255 | 3300013105 | Ga0157369_10004186 | Ga0157369_1000418612 | 302 |
| 256 | 3300013307 | Ga0157372_10000732 | Ga0157372_1000073221 | 302 |
| 257 | 3300013307 | Ga0157372_10010817 | Ga0157372_100108175 | 302 |
| 258 | 3300025321 | Ga0207656_10008068 | Ga0207656_100080683 | 302 |
| 259 | 3300025321 | Ga0207656_10010019 | Ga0207656_100100192 | 302 |
| 260 | 3300025904 | Ga0207647_10000657 | Ga0207647_1000065710 | 302 |
| 261 | 3300025904 | Ga0207647_10001113 | Ga0207647_100011138 | 302 |
| 262 | 3300025909 | Ga0207705_10000228 | Ga0207705_1000022828 | 302 |
| 263 | 3300025911 | Ga0207654_10000588 | Ga0207654_100005887 | 302 |
| 264 | 3300025911 | Ga0207654_10016311 | Ga0207654_100163112 | 302 |
| 265 | 3300025913 | Ga0207695_10001282 | Ga0207695_1000128215 | 302 |
| 266 | 3300025913 | Ga0207695_10003877 | Ga0207695_100038777 | 302 |
| 267 | 3300025913 | Ga0207695_10042778 | Ga0207695_100427783 | 302 |
| 268 | 3300025914 | Ga0207671_10002268 | Ga0207671_100022688 | 302 |
| 269 | 3300025914 | Ga0207671_10005793 | Ga0207671_100057939 | 302 |
| 270 | 3300025920 | Ga0207649_10068238 | Ga0207649_100682382 | 302 |
| 271 | 3300025924 | Ga0207694_10004354 | Ga0207694_100043546 | 302 |
| 272 | 3300025924 | Ga0207694_10006476 | Ga0207694_100064767 | 302 |
| 273 | 3300025933 | Ga0207706_10050072 | Ga0207706_100500723 | 302 |
| 274 | 3300025949 | Ga0207667_10002278 | Ga0207667_1000227812 | 302 |
| 275 | 3300025949 | Ga0207667_10025395 | Ga0207667_100253954 | 302 |
| 276 | 3300025981 | Ga0207640_10002194 | Ga0207640_100021944 | 302 |
| 277 | 3300025981 | Ga0207640_10045913 | Ga0207640_100459132 | 302 |
| 278 | 3300026035 | Ga0207703_10000086 | Ga0207703_1000008624 | 302 |
| 279 | 3300026041 | Ga0207639_10006604 | Ga0207639_100066046 | 302 |
| 280 | 3300026041 | Ga0207639_10007846 | Ga0207639_100078464 | 302 |
| 281 | 3300026041 | Ga0207639_10027128 | Ga0207639_100271284 | 302 |
| 282 | 3300026041 | Ga0207639_10137852 | Ga0207639_101378522 | 302 |
| 283 | 3300026067 | Ga0207678_10090176 | Ga0207678_100901763 | 302 |
| 284 | 3300026078 | Ga0207702_10001600 | Ga0207702_100016008 | 302 |
| 285 | 3300026078 | Ga0207702_10012046 | Ga0207702_100120463 | 302 |
| 286 | 3300026088 | Ga0207641_10000395 | Ga0207641_1000039547 | 302 |
| 287 | 3300026095 | Ga0207676_10002070 | Ga0207676_100020706 | 302 |
| 288 | 3300026116 | Ga0207674_10004009 | Ga0207674_100040099 | 302 |
| 289 | 3300026142 | Ga0207698_10000797 | Ga0207698_100007977 | 302 |
| 290 | 3300026142 | Ga0207698_10027761 | Ga0207698_100277612 | 302 |
| 291 | 3300026142 | Ga0207698_10146001 | Ga0207698_101460012 | 302 |
| 292 | 3300048905 | Ga0496102_0180945 | Ga0496102_0180945_937_1851 | 302 |
| 293 | 3300048906 | Ga0496103_0090276 | Ga0496103_0090276_157_1071 | 302 |
| 294 | 3300048909 | Ga0496106_0064015 | Ga0496106_0064015_16_930 | 302 |
| 295 | 3300048921 | Ga0496118_0002674 | Ga0496118_0002674_8049_8963 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wzo-assembly1.cif.gz_C | crystal structure of the hpce from thermus thermophilus hb8 | 0.9418 | 10 | 256 |
| 1wzo-assembly1.cif.gz_D | crystal structure of the hpce from thermus thermophilus hb8 | 0.9365 | 10 | 258 |
| 1wzo-assembly1.cif.gz_A | crystal structure of the hpce from thermus thermophilus hb8 | 0.9304 | 10 | 258 |
| 1wzo-assembly1.cif.gz_C | crystal structure of the hpce from thermus thermophilus hb8 | 0.9303 | 10 | 256 |
| 1wzo-assembly1.cif.gz_D | crystal structure of the hpce from thermus thermophilus hb8 | 0.9289 | 10 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wzoC02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9417 | 53 | 256 | 3.90.850.10 |
| 1wzoC02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9277 | 53 | 256 | 3.90.850.10 |
| 1gttA02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9271 | 50 | 256 | 3.90.850.10 |
| af_Q96GK7_51_314_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.918 | 36 | 255 | 3.90.850.10 |
| af_A0A1D8PI10_75_291_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9149 | 56 | 255 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645IJT5-F1-model_v4 | Fumarylacetoacetase-like C-terminal domain-containing protein | 0.9672 | 84 | 254 |
GO:0018773
GO:0046872 |
| AF-A0A661JR96-F1-model_v4 | Fumarylacetoacetase-like C-terminal domain-containing protein | 0.962 | 92 | 257 |
GO:0018773
GO:0046872 |
| AF-A0A0Q9CK13-F1-model_v4 | 5-carboxymethyl-2-hydroxymuconate isomerase | 0.9604 | 3 | 295 |
GO:0016853
GO:0046872 |
| AF-A0A661JR96-F1-model_v4 | Fumarylacetoacetase-like C-terminal domain-containing protein | 0.9564 | 92 | 257 |
GO:0018773
GO:0046872 |
| AF-A0A833NRL5-F1-model_v4 | 5-oxopent-3-ene-1 2 5-tricarboxylate decarboxylase | 0.9526 | 54 | 255 |
GO:0018773
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar