F392689

General Info

Members Datasets Scaffolds Average Seq Length
295 162 590 198

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10441081|Ga0207689_104410812
Length 223
Sequence MSDVSLNCFGNVVILSLRGYALVHNTMTIPRGHIGLQFPCECVSASDEAYSDPWADIAKRKLLPNGTKEEIINLVAEEPKTLSQLADALSLSPPSIHTHINDLLKSELLRESVEWEKKYPAERYYEPNFPVFKRAECEEFMSLCNELAEQMARLFQSKMSKFKGAYNRTGLSQQGWEFSDVTQCLYANAQRHARRLLEEQELLPSRQKRGNGAEWIFWAQQPD

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
113 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
114 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
115 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
116 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
117 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
120 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
121 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
122 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
123 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
124 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
125 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
126 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
127 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
128 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
131 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
132 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
133 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
134 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
135 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
136 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
137 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
138 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
139 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
140 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
141 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
142 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
143 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
144 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
145 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
146 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
147 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
150 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
151 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
154 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
155 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
156 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.66
Stem 0
Stem Tuber 0
Unclassified 36.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10441081 3300025942 Bacteria 1087
2 SwRhRL3b_contig_2514795 2162886006 Eukaryota 1011
3 SwRhRL3b_contig_2705395 2162886006 Bacteria 1568
4 SwRhRL2b_contig_1515277 2162886007 Bacteria 4823
5 MBSR1b_contig_9214130 2162886012 Unclassified 1644
6 MBSR1b_contig_9812458 2162886012 Eukaryota 1374
7 JGI24751J29686_10000138 3300002459 Bacteria 36181
8 rootH2_10219213 3300003320 Bacteria 1259
9 Ga0065704_10001716 3300005289 Bacteria 10593
10 Ga0065704_10147351 3300005289 Bacteria 1459
11 Ga0065712_10146283 3300005290 Unclassified 1406
12 Ga0065707_10004726 3300005295 Bacteria 9714
13 Ga0065707_10111533 3300005295 Bacteria 2392
14 Ga0065707_10399219 3300005295 Unclassified 855
15 Ga0070676_10214820 3300005328 Unclassified 1267
16 Ga0070683_101552526 3300005329 Unclassified 636
17 Ga0070690_100001386 3300005330 Bacteria 12630
18 Ga0070670_100000229 3300005331 Bacteria 51545
19 Ga0070670_100076628 3300005331 Unclassified 2873
20 Ga0068869_100025347 3300005334 Bacteria 4117
21 Ga0068869_100093033 3300005334 Bacteria 2270
22 Ga0068869_100538701 3300005334 Unclassified 979
23 Ga0070661_100295838 3300005344 Bacteria 1259
24 Ga0070692_10049956 3300005345 Unclassified 2171
25 Ga0070692_10053871 3300005345 Bacteria 2099
26 Ga0070692_10057022 3300005345 Bacteria 2047
27 Ga0070673_100213033 3300005364 Bacteria 1669
28 Ga0070659_100468830 3300005366 Bacteria 1070
29 Ga0070710_10270882 3300005437 Bacteria 1098
30 Ga0070701_10036283 3300005438 Bacteria 2483
31 Ga0070701_10079959 3300005438 Unclassified 1767
32 Ga0070701_10591865 3300005438 Unclassified 733
33 Ga0070705_100351334 3300005440 Bacteria 1075
34 Ga0070700_100000061 3300005441 Bacteria 80618
35 Ga0070700_100027983 3300005441 Bacteria 3349
36 Ga0070694_100002754 3300005444 Bacteria 10429
37 Ga0070694_100166984 3300005444 Bacteria 1619
38 Ga0070694_100292150 3300005444 Bacteria 1246
39 Ga0070694_100667068 3300005444 Unclassified 843
40 Ga0070694_100821443 3300005444 Bacteria 763
41 Ga0070681_10001570 3300005458 Bacteria 20289
42 Ga0068867_100169706 3300005459 Bacteria 1727
43 Ga0070706_100003013 3300005467 Bacteria 16684
44 Ga0070697_100130049 3300005536 Unclassified 2111
45 Ga0070695_100242038 3300005545 Bacteria 1309
46 Ga0070695_100283079 3300005545 Unclassified 1219
47 Ga0070695_100405098 3300005545 Bacteria 1035
48 Ga0070695_100816144 3300005545 Unclassified 748
49 Ga0070696_100115608 3300005546 Unclassified 1936
50 Ga0070696_100315736 3300005546 Bacteria 1201
51 Ga0070696_100350140 3300005546 Unclassified 1144
52 Ga0070696_100413515 3300005546 Bacteria 1057
53 Ga0070704_100004840 3300005549 Bacteria 7806
54 Ga0070704_100364950 3300005549 Unclassified 1223
55 Ga0068857_100486480 3300005577 Bacteria 1157
56 Ga0068857_100749304 3300005577 Bacteria 930
57 Ga0068854_100105490 3300005578 Bacteria 2118
58 Ga0068859_100000983 3300005617 Bacteria 29204
59 Ga0068859_100081790 3300005617 Bacteria 3272
60 Ga0068859_100121136 3300005617 Unclassified 2682
61 Ga0068859_100136607 3300005617 Unclassified 2525
62 Ga0068859_100649598 3300005617 Bacteria 1147
63 Ga0068864_100820742 3300005618 Unclassified 915
64 Ga0068861_100006828 3300005719 Bacteria 7793
65 Ga0068870_10117164 3300005840 Bacteria 1529
66 Ga0068858_100094549 3300005842 Bacteria 2784
67 Ga0068858_100096415 3300005842 Bacteria 2756
68 Ga0068858_101027343 3300005842 Bacteria 808
69 Ga0068862_100035666 3300005844 Bacteria 4214
70 Ga0068862_100108313 3300005844 Bacteria 2437
71 Ga0068862_100690325 3300005844 Bacteria 988
72 Ga0081455_10456711 3300005937 Unclassified 871
73 Ga0081539_10001594 3300005985 Bacteria 37406
74 Ga0081539_10026001 3300005985 Unclassified 3749
75 Ga0081539_10040139 3300005985 Bacteria 2751
76 Ga0070716_100013733 3300006173 Bacteria 4135
77 Ga0070712_100390536 3300006175 Bacteria 1147
78 Ga0075428_100927602 3300006844 Bacteria 923
79 Ga0075430_100438524 3300006846 Bacteria 1078
80 Ga0075433_10055002 3300006852 Bacteria 3473
81 Ga0075433_10306315 3300006852 Bacteria 1406
82 Ga0075433_10353290 3300006852 Bacteria 1299
83 Ga0075433_10508282 3300006852 Bacteria 1060
84 Ga0075433_10563662 3300006852 Unclassified 1001
85 Ga0075434_100132187 3300006871 Bacteria 2515
86 Ga0075434_100894116 3300006871 Unclassified 903
87 Ga0075434_101013823 3300006871 Bacteria 844
88 Ga0068865_100072403 3300006881 Unclassified 2448
89 Ga0075436_100008947 3300006914 Bacteria 6854
90 Ga0097620_100000983 3300006931 Bacteria 29204
91 Ga0097620_100081790 3300006931 Bacteria 3272
92 Ga0097620_100121149 3300006931 Unclassified 2682
93 Ga0097620_100136604 3300006931 Unclassified 2525
94 Ga0097620_100649656 3300006931 Bacteria 1147
95 Ga0075435_100017883 3300007076 Bacteria 5373
96 Ga0111539_10001110 3300009094 Bacteria 35527
97 Ga0111539_10033533 3300009094 Bacteria 6233
98 Ga0111539_10181329 3300009094 Unclassified 2459
99 Ga0111539_10198462 3300009094 Bacteria 2340
100 Ga0105245_10338260 3300009098 Bacteria 1488
101 Ga0105247_10019571 3300009101 Unclassified 4065
102 Ga0114129_10027639 3300009147 Bacteria 8033
103 Ga0114129_10171912 3300009147 Bacteria 2953
104 Ga0114129_10285456 3300009147 Unclassified 2204
105 Ga0114129_10669408 3300009147 Bacteria 1337
106 Ga0114129_11120362 3300009147 Bacteria 984
107 Ga0105243_11180535 3300009148 Unclassified 778
108 Ga0105241_10128310 3300009174 Bacteria 2050
109 Ga0105242_11696246 3300009176 Unclassified 668
110 Ga0105248_10003091 3300009177 Bacteria 18460
111 Ga0105248_10352282 3300009177 Unclassified 1657
112 Ga0105237_10010134 3300009545 Bacteria 10046
113 Ga0105249_10164700 3300009553 Bacteria 2145
114 Ga0105239_10882202 3300010375 Unclassified 1026
115 Ga0105239_11441104 3300010375 Unclassified 795
116 Ga0105246_10057606 3300011119 Bacteria 2689
117 Ga0105246_10728996 3300011119 Unclassified 872
118 Ga0157373_10091163 3300013100 Bacteria 2146
119 Ga0157378_10054862 3300013297 Bacteria 3549
120 Ga0157378_10211918 3300013297 Bacteria 1837
121 Ga0157378_10378433 3300013297 Bacteria 1390
122 Ga0163162_10109076 3300013306 Bacteria 2865
123 Ga0163162_10358031 3300013306 Bacteria 1592
124 Ga0163162_10884856 3300013306 Bacteria 1007
125 Ga0157375_10008699 3300013308 Bacteria 8896
126 Ga0157375_10513701 3300013308 Bacteria 1362
127 Ga0157375_10558102 3300013308 Bacteria 1306
128 Ga0163163_10003830 3300014325 Bacteria 12806
129 Ga0163163_10391915 3300014325 Bacteria 1447
130 Ga0163163_10796605 3300014325 Bacteria 1008
131 Ga0157380_10049624 3300014326 Bacteria 3311
132 Ga0157380_10738891 3300014326 Unclassified 994
133 Ga0182007_10172512 3300015262 Bacteria 744
134 Ga0207710_10019013 3300025900 Bacteria 2928
135 Ga0207643_10016336 3300025908 Unclassified 4048
136 Ga0207684_10029795 3300025910 Bacteria 4646
137 Ga0207654_10662213 3300025911 Unclassified 748
138 Ga0207707_10002078 3300025912 Bacteria 18125
139 Ga0207695_10091847 3300025913 Bacteria 3048
140 Ga0207671_10087989 3300025914 Bacteria 2336
141 Ga0207650_10000061 3300025925 Bacteria 149822
142 Ga0207650_10073841 3300025925 Unclassified 2570
143 Ga0207650_10075994 3300025925 Bacteria 2537
144 Ga0207650_10088007 3300025925 Bacteria 2368
145 Ga0207690_10837848 3300025932 Unclassified 761
146 Ga0207704_10086179 3300025938 Unclassified 2047
147 Ga0207665_10040908 3300025939 Unclassified 3094
148 Ga0207711_10023982 3300025941 Bacteria 5106
149 Ga0207689_10109928 3300025942 Bacteria 2265
150 Ga0207689_10739948 3300025942 Unclassified 830
151 Ga0207661_11010833 3300025944 Unclassified 766
152 Ga0207651_10180928 3300025960 Unclassified 1672
153 Ga0207712_10218357 3300025961 Bacteria 1523
154 Ga0207640_10668121 3300025981 Bacteria 887
155 Ga0207677_10022924 3300026023 Bacteria 3846
156 Ga0207703_10085563 3300026035 Bacteria 2639
157 Ga0207639_11185113 3300026041 Unclassified 717
158 Ga0207708_10000073 3300026075 Bacteria 80597
159 Ga0207708_10009035 3300026075 Bacteria 7372
160 Ga0207648_10143264 3300026089 Bacteria 2107
161 Ga0207676_10420723 3300026095 Unclassified 1253
162 Ga0207676_10757418 3300026095 Unclassified 945
163 Ga0207674_10302940 3300026116 Unclassified 1547
164 Ga0207674_10378994 3300026116 Bacteria 1368
165 Ga0207675_100010707 3300026118 Bacteria 8589
166 Ga0207675_100024230 3300026118 Bacteria 5644
167 Ga0207428_10011986 3300027907 Bacteria 7631
168 Ga0207428_10584003 3300027907 Unclassified 806
169 Ga0268265_10095143 3300028380 Unclassified 2391
170 Ga0307408_100015187 3300031548 Bacteria 5125
171 Ga0307408_100107830 3300031548 Bacteria 2134
172 Ga0307405_10118796 3300031731 Bacteria 1805
173 Ga0307405_10361262 3300031731 Unclassified 1124
174 Ga0307413_10588187 3300031824 Unclassified 909
175 Ga0307410_10248705 3300031852 Unclassified 1381
176 Ga0307410_10362825 3300031852 Bacteria 1161
177 Ga0307406_10001867 3300031901 Bacteria 11501
178 Ga0307412_10071509 3300031911 Unclassified 2368
179 Ga0307412_10738445 3300031911 Bacteria 849
180 Ga0307409_100454029 3300031995 Unclassified 1237
181 Ga0307416_100106012 3300032002 Unclassified 2462
182 Ga0307416_100593533 3300032002 Unclassified 1186
183 Ga0307416_101010724 3300032002 Unclassified 935
184 Ga0307414_10151314 3300032004 Bacteria 1831
185 Ga0307414_10230884 3300032004 Unclassified 1525
186 Ga0307415_100001860 3300032126 Bacteria 10343
187 Ga0373941_0095137 3300035115 Bacteria 1028
188 Ga0395900_0281115 3300037418 Bacteria 1656
189 Ga0395898_0098339 3300037466 Unclassified 2810
190 Ga0395901_0106240 3300038443 Bacteria 2947
191 Ga0439448_0028238 3300042005 Bacteria 1771
192 Ga0451576_0649281 3300045051 Unclassified 1109
193 Ga0501290_026323 3300049513 Unclassified 817
194 Ga0501291_022570 3300049514 Unclassified 1011
195 Ga0501292_007284 3300049515 Bacteria 1595
196 Ga0501292_013199 3300049515 Unclassified 1269
197 Ga0501295_056118 3300049518 Unclassified 853
198 Ga0501298_006739 3300049521 Bacteria 1887
199 Ga0501298_052537 3300049521 Unclassified 848
200 Ga0501298_075014 3300049521 Unclassified 735
201 Ga0501299_008466 3300049522 Bacteria 1674
202 Ga0501077_0581543 3300049593 Unclassified 719
203 Ga0501198_004310 3300049649 Unclassified 1971
204 Ga0501198_006391 3300049649 Bacteria 1677
205 Ga0501199_009517 3300049650 Bacteria 1028
206 Ga0501202_025238 3300049652 Bacteria 1210
207 Ga0501202_046248 3300049652 Unclassified 953
208 Ga0501206_040683 3300049653 Bacteria 716
209 Ga0501207_000042 3300049654 Bacteria 9164
210 Ga0501207_007361 3300049654 Bacteria 1569
211 Ga0501207_043586 3300049654 Unclassified 785
212 Ga0501207_054714 3300049654 Unclassified 719
213 Ga0501208_002548 3300049655 Unclassified 1917
214 Ga0501209_008932 3300049656 Unclassified 2001
215 Ga0501214_022996 3300049659 Unclassified 806
216 Ga0501216_026595 3300049660 Unclassified 1045
217 Ga0501216_067406 3300049660 Unclassified 733
218 Ga0501217_000765 3300049661 Bacteria 5593
219 Ga0501217_051774 3300049661 Bacteria 1075
220 Ga0501223_001369 3300049663 Bacteria 5638
221 Ga0501223_012185 3300049663 Bacteria 1722
222 Ga0501224_005294 3300049664 Unclassified 1844
223 Ga0501224_006069 3300049664 Bacteria 1748
224 Ga0501224_008291 3300049664 Bacteria 1515
225 Ga0501227_007295 3300049665 Unclassified 2367
226 Ga0501227_016254 3300049665 Bacteria 1670
227 Ga0501228_008968 3300049666 Bacteria 969
228 Ga0501228_011181 3300049666 Unclassified 905
229 Ga0501230_003780 3300049667 Bacteria 2038
230 Ga0501233_001362 3300049668 Unclassified 4182
231 Ga0501233_009526 3300049668 Bacteria 1895
232 Ga0501233_044957 3300049668 Bacteria 1051
233 Ga0501235_005738 3300049669 Unclassified 2699
234 Ga0501235_007213 3300049669 Unclassified 2424
235 Ga0501235_007866 3300049669 Bacteria 2324
236 Ga0501235_008116 3300049669 Bacteria 2290
237 Ga0501236_004953 3300049670 Unclassified 1599
238 Ga0501236_009558 3300049670 Bacteria 1254
239 Ga0501239_004288 3300049672 Bacteria 1393
240 Ga0501239_010312 3300049672 Unclassified 1028
241 Ga0501240_011273 3300049673 Bacteria 1202
242 Ga0501243_010347 3300049675 Bacteria 1455
243 Ga0501243_011177 3300049675 Bacteria 1406
244 Ga0501243_031433 3300049675 Unclassified 907
245 Ga0501249_005331 3300049679 Unclassified 2629
246 Ga0501249_010058 3300049679 Bacteria 1972
247 Ga0501249_064838 3300049679 Unclassified 849
248 Ga0501249_093182 3300049679 Unclassified 716
249 Ga0501250_000637 3300049680 Unclassified 2488
250 Ga0501251_007337 3300049681 Bacteria 1225
251 Ga0501253_013123 3300049683 Unclassified 1313
252 Ga0501253_056871 3300049683 Unclassified 833
253 Ga0501255_012219 3300049684 Bacteria 1003
254 Ga0501257_016627 3300049686 Bacteria 1708
255 Ga0501257_026645 3300049686 Unclassified 1380
256 Ga0501259_021600 3300049688 Unclassified 1151
257 Ga0501259_039725 3300049688 Unclassified 921
258 Ga0501259_050768 3300049688 Unclassified 841
259 Ga0501219_006683 3300049703 Unclassified 827
260 Ga0501225_0000822 3300049705 Bacteria 9663
261 Ga0501229_006400 3300049706 Bacteria 1457
262 Ga0501229_014868 3300049706 Bacteria 1005
263 Ga0501229_015932 3300049706 Unclassified 976
264 Ga0501234_001950 3300049707 Unclassified 3259
265 Ga0501234_003074 3300049707 Unclassified 2622
266 Ga0501245_004229 3300049708 Unclassified 1968
267 Ga0501245_005294 3300049708 Bacteria 1785
268 Ga0501245_014773 3300049708 Bacteria 1168
269 Ga0501079_0185458 3300049741 Bacteria 1624
270 Ga0501273_003596 3300049770 Bacteria 1657
271 Ga0501273_036209 3300049770 Bacteria 717
272 Ga0501204_003656 3300049850 Bacteria 1629
273 Ga0501204_021338 3300049850 Unclassified 848
274 Ga0501212_000872 3300049851 Bacteria 3175
275 Ga0501212_010097 3300049851 Unclassified 1339
276 Ga0501226_003072 3300049853 Unclassified 1999
277 Ga0501226_007423 3300049853 Bacteria 1229
278 Ga0501226_009429 3300049853 Bacteria 1087
279 nmdc:mga05p37_1242360_c1 3300050507 Bacteria 765
280 nmdc:mga05p37_1576931_c1 3300050507 Bacteria 648
281 nmdc:mga05p37_170031_c1 3300050507 Bacteria 2658
282 nmdc:mga05p37_291902_c1 3300050507 Bacteria 1941
283 nmdc:mga05p37_558308_c1 3300050507 Bacteria 1302
284 nmdc:mga05p37_84256_c1 3300050507 Bacteria 3916
285 nmdc:mga0qj67_301311_c1 3300050509 Bacteria 1298
286 nmdc:mga08y16_179527_c1 3300050511 Bacteria 2198
287 nmdc:mga08y16_618051_c1 3300050511 Bacteria 1091
288 nmdc:mga08y16_775066_c1 3300050511 Bacteria 954
289 nmdc:mga08y16_8569_c1 3300050511 Bacteria 10716
290 nmdc:mga0n895_143873_c1 3300050512 Bacteria 2413
291 nmdc:mga0n895_491098_c1 3300050512 Bacteria 1237
292 nmdc:mga08x19_11312_c1 3300050514 Bacteria 5370
293 nmdc:mga0a205_528116_c1 3300050515 Bacteria 1036
294 nmdc:mga0a205_586568_c1 3300050515 Unclassified 968
295 nmdc:mga0a205_84690_c1 3300050515 Bacteria 3062
296 Ga0207689_10441081
297 SwRhRL3b_contig_2514795
298 SwRhRL3b_contig_2705395
299 SwRhRL2b_contig_1515277
300 MBSR1b_contig_9214130
301 MBSR1b_contig_9812458
302 JGI24751J29686_10000138
303 rootH2_10219213
304 Ga0065704_10001716
305 Ga0065704_10147351
306 Ga0065712_10146283
307 Ga0065707_10004726
308 Ga0065707_10111533
309 Ga0065707_10399219
310 Ga0070676_10214820
311 Ga0070683_101552526
312 Ga0070690_100001386
313 Ga0070670_100000229
314 Ga0070670_100076628
315 Ga0068869_100025347
316 Ga0068869_100093033
317 Ga0068869_100538701
318 Ga0070661_100295838
319 Ga0070692_10049956
320 Ga0070692_10053871
321 Ga0070692_10057022
322 Ga0070673_100213033
323 Ga0070659_100468830
324 Ga0070710_10270882
325 Ga0070701_10036283
326 Ga0070701_10079959
327 Ga0070701_10591865
328 Ga0070705_100351334
329 Ga0070700_100000061
330 Ga0070700_100027983
331 Ga0070694_100002754
332 Ga0070694_100166984
333 Ga0070694_100292150
334 Ga0070694_100667068
335 Ga0070694_100821443
336 Ga0070681_10001570
337 Ga0068867_100169706
338 Ga0070706_100003013
339 Ga0070697_100130049
340 Ga0070695_100242038
341 Ga0070695_100283079
342 Ga0070695_100405098
343 Ga0070695_100816144
344 Ga0070696_100115608
345 Ga0070696_100315736
346 Ga0070696_100350140
347 Ga0070696_100413515
348 Ga0070704_100004840
349 Ga0070704_100364950
350 Ga0068857_100486480
351 Ga0068857_100749304
352 Ga0068854_100105490
353 Ga0068859_100000983
354 Ga0068859_100081790
355 Ga0068859_100121136
356 Ga0068859_100136607
357 Ga0068859_100649598
358 Ga0068864_100820742
359 Ga0068861_100006828
360 Ga0068870_10117164
361 Ga0068858_100094549
362 Ga0068858_100096415
363 Ga0068858_101027343
364 Ga0068862_100035666
365 Ga0068862_100108313
366 Ga0068862_100690325
367 Ga0081455_10456711
368 Ga0081539_10001594
369 Ga0081539_10026001
370 Ga0081539_10040139
371 Ga0070716_100013733
372 Ga0070712_100390536
373 Ga0075428_100927602
374 Ga0075430_100438524
375 Ga0075433_10055002
376 Ga0075433_10306315
377 Ga0075433_10353290
378 Ga0075433_10508282
379 Ga0075433_10563662
380 Ga0075434_100132187
381 Ga0075434_100894116
382 Ga0075434_101013823
383 Ga0068865_100072403
384 Ga0075436_100008947
385 Ga0097620_100000983
386 Ga0097620_100081790
387 Ga0097620_100121149
388 Ga0097620_100136604
389 Ga0097620_100649656
390 Ga0075435_100017883
391 Ga0111539_10001110
392 Ga0111539_10033533
393 Ga0111539_10181329
394 Ga0111539_10198462
395 Ga0105245_10338260
396 Ga0105247_10019571
397 Ga0114129_10027639
398 Ga0114129_10171912
399 Ga0114129_10285456
400 Ga0114129_10669408
401 Ga0114129_11120362
402 Ga0105243_11180535
403 Ga0105241_10128310
404 Ga0105242_11696246
405 Ga0105248_10003091
406 Ga0105248_10352282
407 Ga0105237_10010134
408 Ga0105249_10164700
409 Ga0105239_10882202
410 Ga0105239_11441104
411 Ga0105246_10057606
412 Ga0105246_10728996
413 Ga0157373_10091163
414 Ga0157378_10054862
415 Ga0157378_10211918
416 Ga0157378_10378433
417 Ga0163162_10109076
418 Ga0163162_10358031
419 Ga0163162_10884856
420 Ga0157375_10008699
421 Ga0157375_10513701
422 Ga0157375_10558102
423 Ga0163163_10003830
424 Ga0163163_10391915
425 Ga0163163_10796605
426 Ga0157380_10049624
427 Ga0157380_10738891
428 Ga0182007_10172512
429 Ga0207710_10019013
430 Ga0207643_10016336
431 Ga0207684_10029795
432 Ga0207654_10662213
433 Ga0207707_10002078
434 Ga0207695_10091847
435 Ga0207671_10087989
436 Ga0207650_10000061
437 Ga0207650_10073841
438 Ga0207650_10075994
439 Ga0207650_10088007
440 Ga0207690_10837848
441 Ga0207704_10086179
442 Ga0207665_10040908
443 Ga0207711_10023982
444 Ga0207689_10109928
445 Ga0207689_10739948
446 Ga0207661_11010833
447 Ga0207651_10180928
448 Ga0207712_10218357
449 Ga0207640_10668121
450 Ga0207677_10022924
451 Ga0207703_10085563
452 Ga0207639_11185113
453 Ga0207708_10000073
454 Ga0207708_10009035
455 Ga0207648_10143264
456 Ga0207676_10420723
457 Ga0207676_10757418
458 Ga0207674_10302940
459 Ga0207674_10378994
460 Ga0207675_100010707
461 Ga0207675_100024230
462 Ga0207428_10011986
463 Ga0207428_10584003
464 Ga0268265_10095143
465 Ga0307408_100015187
466 Ga0307408_100107830
467 Ga0307405_10118796
468 Ga0307405_10361262
469 Ga0307413_10588187
470 Ga0307410_10248705
471 Ga0307410_10362825
472 Ga0307406_10001867
473 Ga0307412_10071509
474 Ga0307412_10738445
475 Ga0307409_100454029
476 Ga0307416_100106012
477 Ga0307416_100593533
478 Ga0307416_101010724
479 Ga0307414_10151314
480 Ga0307414_10230884
481 Ga0307415_100001860
482 Ga0373941_0095137
483 Ga0395900_0281115
484 Ga0395898_0098339
485 Ga0395901_0106240
486 Ga0439448_0028238
487 Ga0451576_0649281
488 Ga0501290_026323
489 Ga0501291_022570
490 Ga0501292_007284
491 Ga0501292_013199
492 Ga0501295_056118
493 Ga0501298_006739
494 Ga0501298_052537
495 Ga0501298_075014
496 Ga0501299_008466
497 Ga0501077_0581543
498 Ga0501198_004310
499 Ga0501198_006391
500 Ga0501199_009517
501 Ga0501202_025238
502 Ga0501202_046248
503 Ga0501206_040683
504 Ga0501207_000042
505 Ga0501207_007361
506 Ga0501207_043586
507 Ga0501207_054714
508 Ga0501208_002548
509 Ga0501209_008932
510 Ga0501214_022996
511 Ga0501216_026595
512 Ga0501216_067406
513 Ga0501217_000765
514 Ga0501217_051774
515 Ga0501223_001369
516 Ga0501223_012185
517 Ga0501224_005294
518 Ga0501224_006069
519 Ga0501224_008291
520 Ga0501227_007295
521 Ga0501227_016254
522 Ga0501228_008968
523 Ga0501228_011181
524 Ga0501230_003780
525 Ga0501233_001362
526 Ga0501233_009526
527 Ga0501233_044957
528 Ga0501235_005738
529 Ga0501235_007213
530 Ga0501235_007866
531 Ga0501235_008116
532 Ga0501236_004953
533 Ga0501236_009558
534 Ga0501239_004288
535 Ga0501239_010312
536 Ga0501240_011273
537 Ga0501243_010347
538 Ga0501243_011177
539 Ga0501243_031433
540 Ga0501249_005331
541 Ga0501249_010058
542 Ga0501249_064838
543 Ga0501249_093182
544 Ga0501250_000637
545 Ga0501251_007337
546 Ga0501253_013123
547 Ga0501253_056871
548 Ga0501255_012219
549 Ga0501257_016627
550 Ga0501257_026645
551 Ga0501259_021600
552 Ga0501259_039725
553 Ga0501259_050768
554 Ga0501219_006683
555 Ga0501225_0000822
556 Ga0501229_006400
557 Ga0501229_014868
558 Ga0501229_015932
559 Ga0501234_001950
560 Ga0501234_003074
561 Ga0501245_004229
562 Ga0501245_005294
563 Ga0501245_014773
564 Ga0501079_0185458
565 Ga0501273_003596
566 Ga0501273_036209
567 Ga0501204_003656
568 Ga0501204_021338
569 Ga0501212_000872
570 Ga0501212_010097
571 Ga0501226_003072
572 Ga0501226_007423
573 Ga0501226_009429
574 nmdc:mga05p37_1242360_c1
575 nmdc:mga05p37_1576931_c1
576 nmdc:mga05p37_170031_c1
577 nmdc:mga05p37_291902_c1
578 nmdc:mga05p37_558308_c1
579 nmdc:mga05p37_84256_c1
580 nmdc:mga0qj67_301311_c1
581 nmdc:mga08y16_179527_c1
582 nmdc:mga08y16_618051_c1
583 nmdc:mga08y16_775066_c1
584 nmdc:mga08y16_8569_c1
585 nmdc:mga0n895_143873_c1
586 nmdc:mga0n895_491098_c1
587 nmdc:mga08x19_11312_c1
588 nmdc:mga0a205_528116_c1
589 nmdc:mga0a205_586568_c1
590 nmdc:mga0a205_84690_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

65

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wte-assembly1.cif.gz_B the structure of the crispr-associated protein, csa3, from sulfolobus solfataricus at 1.8 angstrom resolution. 0.9349 44 86
3r4k-assembly2.cif.gz_D crystal structure of a putative iclr transcriptional regulator (tm1040_3717) from silicibacter sp. tm1040 at 2.46 a resolution 0.9179 55 103
2efo-assembly1.cif.gz_A crystal structure of tyr77 to ala of st1022 from sulfolobus tokodaii 7 0.9126 43 81
2ia2-assembly1.cif.gz_A the crystal structure of a putative transcriptional regulator rha06195 from rhodococcus sp. rha1 0.9115 55 103
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9061 44 103
ID Description Score Start End Superfamily
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9773 43 86 1.10.10.10
2ia2D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9587 56 86 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 43 103 1.10.10.10
2dbbB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9433 43 81 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 41 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Q7YCJ3-F1-model_v4 HTH arsR-type domain-containing protein 0.9607 39 202 GO:0003700
AF-A0A1Q7YCJ3-F1-model_v4 HTH arsR-type domain-containing protein 0.9494 39 202 GO:0003700
AF-A0A7C0VE12-F1-model_v4 ArsR family transcriptional regulator 0.8836 42 103 GO:0003700
AF-A0A842X4F5-F1-model_v4 ArsR family transcriptional regulator 0.8795 43 103 GO:0003700
GO:0005509
AF-A0A4V2ZPY9-F1-model_v4 deleted 0.8686 43 103

Map