F392632

General Info

Members Datasets Scaffolds Average Seq Length
295 150 590 91

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10134730|Ga0157370_101347304
Length 101
Sequence MRTGSGGTTLVGRSLKKGPFVADHLLKKIDAMNERREKRVVKTWSRASTIVPAMVGHTIGVHNGKAHVPVFVTENMVGHKLGEFAPTRNFRGHGGDKAAVK

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
6 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
7 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
9 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
47 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
52 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
53 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
67 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
86 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
99 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
100 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
143 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
148 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
149 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
150 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.46
Metatranscriptomes 12.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 1.36
Rhizoplane 1.02
Rhizosphere 78.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10134730 3300013104 Bacteria 2303
2 JGI24740J21852_10019708 3300001979 Bacteria 2370
3 JGI26129J50193_1000001 3300003349 Eukaryota 16798
4 JGI26145J50221_1000001 3300003371 Eukaryota 32231
5 JGI26142J50222_100002 3300003379 Eukaryota 32216
6 JGI26144J50225_100007 3300003380 Eukaryota 12626
7 Ga0006556J51387_1001104 3300003479 Eukaryota 1378
8 JGI26143J51219_1000001 3300003502 Eukaryota 16944
9 Ga0006557J51388_1000889 3300003556 Eukaryota 19942
10 Ga0006557J51388_1000890 3300003556 Eukaryota 15880
11 Ga0006558J51389_1000540 3300003558 Eukaryota 14115
12 Ga0006559J51393_1001439 3300003560 Eukaryota 25300
13 Ga0006559J51393_1001440 3300003560 Eukaryota 21274
14 Ga0006553J51392_1001570 3300003561 Eukaryota 30225
15 Ga0006553J51392_1001572 3300003561 Eukaryota 26240
16 Ga0006555J51386_1004624 3300003564 Eukaryota 17599
17 Ga0006555J51386_1004626 3300003564 Eukaryota 13519
18 Ga0006560J51390_1004764 3300003565 Eukaryota 18502
19 Ga0006560J51390_1004765 3300003565 Eukaryota 14520
20 Ga0006554J51385_1003403 3300003567 Eukaryota 15572
21 Ga0006554J51385_1003404 3300003567 Eukaryota 14430
22 JGI25404J52841_10000017 3300003659 Eukaryota 13841
23 JGI25405J52794_10008302 3300003911 Eukaryota 1937
24 Ga0058863_11895058 3300004799 Bacteria 1510
25 Ga0058861_11406994 3300004800 Bacteria 1281
26 Ga0065717_1001937 3300005276 Eukaryota 9227
27 Ga0070683_100040141 3300005329 Bacteria 4301
28 Ga0070682_100106479 3300005337 Bacteria 1861
29 Ga0070691_10001010 3300005341 Bacteria 11554
30 Ga0070668_100200251 3300005347 Eukaryota 1639
31 Ga0070688_100291664 3300005365 Eukaryota 1176
32 Ga0070714_100000519 3300005435 Bacteria 27946
33 Ga0070714_100049770 3300005435 Bacteria 3568
34 Ga0070714_100609491 3300005435 Bacteria 1049
35 Ga0070714_101239559 3300005435 Bacteria 728
36 Ga0070714_101872154 3300005435 Bacteria 586
37 Ga0070713_101135336 3300005436 Bacteria 756
38 Ga0070711_101061044 3300005439 Bacteria 697
39 Ga0070663_100079708 3300005455 Bacteria 2403
40 Ga0070681_10884154 3300005458 Bacteria 812
41 Ga0070684_100084671 3300005535 Bacteria 2811
42 Ga0068855_100011837 3300005563 Bacteria 10547
43 Ga0068854_100000039 3300005578 Bacteria 94407
44 Ga0068856_100002334 3300005614 Bacteria 19517
45 Ga0068856_101139709 3300005614 Bacteria 797
46 Ga0068852_101256875 3300005616 Bacteria 762
47 Ga0068866_10028841 3300005718 Eukaryota 2648
48 Ga0081455_10005452 3300005937 Eukaryota 13947
49 Ga0081538_10137227 3300005981 Eukaryota 1136
50 Ga0081540_1002808 3300005983 Eukaryota 14097
51 Ga0081539_10001283 3300005985 Eukaryota 44191
52 Ga0070717_10060122 3300006028 Bacteria 3146
53 Ga0070717_10098323 3300006028 Eukaryota 2481
54 Ga0070717_10312012 3300006028 Bacteria 1400
55 Ga0070717_11775332 3300006028 Eukaryota 558
56 Ga0075436_100060624 3300006914 Bacteria 2613
57 Ga0075435_100188146 3300007076 Bacteria 1747
58 Ga0105240_10426271 3300009093 Bacteria 1489
59 Ga0105238_10673988 3300009551 Bacteria 1045
60 Ga0157326_1001414 3300012513 Eukaryota 2660
61 Ga0157338_1026630 3300012515 Eukaryota 711
62 Ga0157369_10136977 3300013105 Bacteria 2592
63 Ga0157369_10604065 3300013105 Bacteria 1132
64 Ga0157374_10064852 3300013296 Bacteria 3429
65 Ga0157376_10133835 3300014969 Bacteria 2216
66 Ga0214544_1024680 3300021320 Eukaryota 3064
67 Ga0214545_1026642 3300021324 Eukaryota 3089
68 Ga0214543_1026657 3300021327 Eukaryota 3064
69 Ga0213873_10000595 3300021358 Bacteria 5889
70 Ga0213873_10025918 3300021358 Bacteria 1420
71 Ga0213873_10028247 3300021358 Bacteria 1374
72 Ga0213873_10049373 3300021358 Bacteria 1109
73 Ga0213873_10068734 3300021358 Bacteria 972
74 Ga0213873_10123752 3300021358 Bacteria 761
75 Ga0213872_10032095 3300021361 Bacteria 2407
76 Ga0213872_10042920 3300021361 Bacteria 2061
77 Ga0213872_10166850 3300021361 Bacteria 956
78 Ga0213872_10277279 3300021361 Bacteria 701
79 Ga0213872_10318639 3300021361 Bacteria 643
80 Ga0213872_10325388 3300021361 Bacteria 634
81 Ga0213872_10352291 3300021361 Bacteria 604
82 Ga0213874_10075057 3300021377 Bacteria 1086
83 Ga0213874_10237372 3300021377 Bacteria 668
84 Ga0213874_10355538 3300021377 Bacteria 562
85 Ga0213874_10428359 3300021377 Bacteria 519
86 Ga0213876_10029742 3300021384 Bacteria 2878
87 Ga0213876_10220259 3300021384 Bacteria 1009
88 Ga0213875_10034395 3300021388 Bacteria 2393
89 Ga0213875_10088036 3300021388 Bacteria 1448
90 Ga0213875_10490235 3300021388 Bacteria 590
91 Ga0213871_10006246 3300021441 Bacteria 2511
92 Ga0213871_10008780 3300021441 Bacteria 2241
93 Ga0213871_10070857 3300021441 Bacteria 985
94 Ga0213871_10097218 3300021441 Bacteria 859
95 Ga0213871_10111773 3300021441 Bacteria 808
96 Ga0213871_10122386 3300021441 Bacteria 776
97 Ga0207642_10000612 3300025899 Eukaryota 10996
98 Ga0207700_10903000 3300025928 Bacteria 790
99 Ga0207664_10002006 3300025929 Bacteria 13411
100 Ga0207664_10052385 3300025929 Bacteria 3227
101 Ga0207664_10861066 3300025929 Bacteria 814
102 Ga0207664_10984641 3300025929 Bacteria 756
103 Ga0207664_11353561 3300025929 Bacteria 632
104 Ga0207668_10158876 3300025972 Eukaryota 1759
105 Ga0207668_10228989 3300025972 Eukaryota 1497
106 Ga0207639_11101595 3300026041 Bacteria 745
107 Ga0209973_1000001 3300027252 Eukaryota 105314
108 Ga0209589_1029971 3300027357 Eukaryota 3057
109 Ga0209982_1000001 3300027552 Eukaryota 43272
110 Ga0209970_1000008 3300027614 Eukaryota 27956
111 Ga0210002_1000010 3300027617 Eukaryota 29326
112 Ga0209983_1000001 3300027665 Eukaryota 49943
113 Ga0209971_1096303 3300027682 Eukaryota 723
114 Ga0209998_10000079 3300027717 Eukaryota 38140
115 Ga0265334_10209832 3300028573 Bacteria 675
116 Ga0265338_10000396 3300028800 Bacteria 78090
117 Ga0265338_10153962 3300028800 Bacteria 1783
118 Ga0265338_10290041 3300028800 Bacteria 1193
119 Ga0265765_1016811 3300030879 Bacteria 859
120 Ga0265330_10072648 3300031235 Bacteria 1488
121 Ga0265332_10008913 3300031238 Bacteria 4488
122 Ga0265328_10238659 3300031239 Bacteria 694
123 Ga0265325_10021517 3300031241 Bacteria 3541
124 Ga0265339_10007654 3300031249 Bacteria 6956
125 Ga0265331_10074383 3300031250 Bacteria 1586
126 Ga0265327_10000298 3300031251 Bacteria 96149
127 Ga0265327_10096344 3300031251 Bacteria 1435
128 Ga0265316_10409726 3300031344 Bacteria 975
129 Ga0265313_10010254 3300031595 Bacteria 5958
130 Ga0310114_100567 3300031678 Eukaryota 2809
131 Ga0310119_101210 3300031686 Eukaryota 2729
132 Ga0310119_106928 3300031686 Eukaryota 1403
133 Ga0265314_10156412 3300031711 Bacteria 1392
134 Ga0265342_10006015 3300031712 Bacteria 9119
135 Ga0316576_10250619 3300031727 Bacteria 1329
136 Ga0316578_10089395 3300031728 Bacteria 1838
137 Ga0307405_10000737 3300031731 Eukaryota 12703
138 Ga0316577_10052644 3300031733 Bacteria 2272
139 Ga0316593_10001487 3300032168 Bacteria 5179
140 Ga0316593_10238548 3300032168 Bacteria 678
141 Ga0316592_1000001 3300033524 Bacteria 24674
142 Ga0316592_1000618 3300033524 Bacteria 5156
143 Ga0316592_1053101 3300033524 Bacteria 906
144 Ga0316592_1171694 3300033524 Bacteria 516
145 Ga0316586_1009746 3300033527 Bacteria 1444
146 Ga0316586_1041767 3300033527 Bacteria 807
147 Ga0316588_1037835 3300033528 Bacteria 1148
148 Ga0316587_1072607 3300033529 Bacteria 645
149 Ga0316215_1000129 3300033544 Eukaryota 13677
150 Ga0373959_0009277 3300034820 Eukaryota 1693
151 Ga0373959_0071458 3300034820 Eukaryota 785
152 Ga0373952_0116127 3300035092 Eukaryota 721
153 Ga0373936_0269088 3300035113 Bacteria 764
154 Ga0316574_0115792 3300035398 Bacteria 1719
155 Ga0316574_0221545 3300035398 Bacteria 1212
156 Ga0316574_0756638 3300035398 Bacteria 593
157 Ga0373937_0515984 3300036401 Bacteria 1135
158 Ga0310112_032176 3300036458 Eukaryota 719
159 Ga0310109_000232 3300036534 Eukaryota 3693
160 Ga0310110_003057 3300036535 Eukaryota 2255
161 Ga0310110_020915 3300036535 Eukaryota 903
162 Ga0316584_0069531 3300036712 Bacteria 2639
163 Ga0316584_0140284 3300036712 Bacteria 1803
164 Ga0373925_0000113 3300037068 Eukaryota 86675
165 Ga0395899_0230648 3300037312 Bacteria 1278
166 Ga0395900_0031839 3300037418 Bacteria 5421
167 Ga0395900_1755884 3300037418 Bacteria 531
168 Ga0395898_0008404 3300037466 Bacteria 10916
169 Ga0395905_0280014 3300037471 Bacteria 1554
170 Ga0436364_0022182 3300037853 Bacteria 2393
171 Ga0436364_0301827 3300037853 Bacteria 1486
172 Ga0436364_0307422 3300037853 Bacteria 1172
173 Ga0436364_0346644 3300037853 Eukaryota 698
174 Ga0436364_0578888 3300037853 Bacteria 891
175 Ga0436364_0725867 3300037853 Bacteria 3564
176 Ga0436364_0806322 3300037853 Bacteria 2425
177 Ga0436364_0977094 3300037853 Bacteria 1246
178 Ga0436364_1151975 3300037853 Bacteria 1699
179 Ga0436364_1159789 3300037853 Bacteria 515
180 Ga0436364_1172568 3300037853 Bacteria 1053
181 Ga0436364_1357710 3300037853 Bacteria 5526
182 Ga0436364_1374520 3300037853 Bacteria 558
183 Ga0395901_0029204 3300038443 Bacteria 5674
184 Ga0400483_021047 3300039062 Bacteria 1328
185 Ga0436365_0139927 3300039437 Bacteria 982
186 Ga0436365_0142954 3300039437 Bacteria 510
187 Ga0436365_0230296 3300039437 Bacteria 9287
188 Ga0436365_0500406 3300039437 Bacteria 964
189 Ga0436365_0513586 3300039437 Bacteria 1928
190 Ga0436365_0604982 3300039437 Bacteria 579
191 Ga0436365_0865502 3300039437 Bacteria 761
192 Ga0436365_1810750 3300039437 Bacteria 706
193 Ga0436360_0293982 3300039438 Bacteria 800
194 Ga0436360_0327488 3300039438 Bacteria 3072
195 Ga0436360_0384227 3300039438 Bacteria 775
196 Ga0436360_0426765 3300039438 Bacteria 1809
197 Ga0436360_0583036 3300039438 Bacteria 1318
198 Ga0436360_0689249 3300039438 Bacteria 598
199 Ga0436360_0849262 3300039438 Bacteria 1570
200 Ga0436360_0883749 3300039438 Bacteria 575
201 Ga0436360_0887653 3300039438 Bacteria 707
202 Ga0436360_0975907 3300039438 Bacteria 659
203 Ga0436360_1019953 3300039438 Bacteria 704
204 Ga0436360_1051486 3300039438 Bacteria 728
205 Ga0436360_1057762 3300039438 Bacteria 632
206 Ga0436360_1171259 3300039438 Bacteria 1575
207 Ga0436360_1210313 3300039438 Bacteria 4262
208 Ga0436360_1245589 3300039438 Bacteria 3373
209 Ga0436360_1310360 3300039438 Bacteria 1004
210 Ga0436360_1323074 3300039438 Bacteria 831
211 Ga0436360_1347115 3300039438 Bacteria 1247
212 Ga0436361_0143909 3300039447 Bacteria 889
213 Ga0436361_0146375 3300039447 Bacteria 1921
214 Ga0436361_0230525 3300039447 Bacteria 1305
215 Ga0436361_0319595 3300039447 Bacteria 575
216 Ga0436361_0510593 3300039447 Bacteria 515
217 Ga0436361_0560336 3300039447 Bacteria 3141
218 Ga0436361_0628776 3300039447 Bacteria 1328
219 Ga0436361_0639888 3300039447 Bacteria 1011
220 Ga0436361_0700810 3300039447 Bacteria 979
221 Ga0436361_0761715 3300039447 Bacteria 631
222 Ga0436361_0762618 3300039447 Bacteria 623
223 Ga0436361_0797986 3300039447 Bacteria 1405
224 Ga0436361_0801578 3300039447 Bacteria 2005
225 Ga0436361_0804614 3300039447 Bacteria 626
226 Ga0436361_0811849 3300039447 Bacteria 557
227 Ga0436361_0914836 3300039447 Bacteria 3651
228 Ga0436361_1176443 3300039447 Bacteria 705
229 Ga0436363_0474419 3300039450 Bacteria 894
230 Ga0436363_0773153 3300039450 Bacteria 531
231 Ga0436363_0802287 3300039450 Bacteria 594
232 Ga0436363_0935759 3300039450 Bacteria 1138
233 Ga0436363_1018444 3300039450 Bacteria 667
234 Ga0436363_1211730 3300039450 Bacteria 1068
235 Ga0436363_1455911 3300039450 Bacteria 598
236 Ga0436363_1477393 3300039450 Bacteria 4145
237 Ga0436363_1492969 3300039450 Bacteria 2660
238 Ga0436363_1533076 3300039450 Bacteria 731
239 Ga0436363_1616044 3300039450 Bacteria 1994
240 Ga0436363_1617203 3300039450 Bacteria 728
241 Ga0436362_0219029 3300039453 Bacteria 3554
242 Ga0436362_0226828 3300039453 Bacteria 7212
243 Ga0436362_0293439 3300039453 Bacteria 793
244 Ga0436362_0306872 3300039453 Bacteria 5541
245 Ga0436362_0372347 3300039453 Bacteria 2051
246 Ga0436362_0410882 3300039453 Bacteria 693
247 Ga0436362_0460400 3300039453 Bacteria 1104
248 Ga0436362_0600937 3300039453 Bacteria 904
249 Ga0436362_0655523 3300039453 Bacteria 855
250 Ga0436362_0737682 3300039453 Bacteria 2236
251 Ga0436362_0776467 3300039453 Bacteria 1281
252 Ga0436362_1014588 3300039453 Bacteria 951
253 Ga0436362_1033420 3300039453 Bacteria 575
254 Ga0436362_1062016 3300039453 Bacteria 1058
255 Ga0436362_1170699 3300039453 Bacteria 1050
256 Ga0436362_1195069 3300039453 Bacteria 1726
257 Ga0436362_1278824 3300039453 Bacteria 695
258 Ga0436362_1284836 3300039453 Bacteria 840
259 Ga0451791_1074904 3300041451 Eukaryota 738
260 Ga0451795_0854174 3300041456 Bacteria 516
261 Ga0451839_1366035 3300041496 Eukaryota 529
262 Ga0451843_0546449 3300041509 Eukaryota 537
263 Ga0451577_0303302 3300042876 Bacteria 1447
264 Ga0466976_0000009 3300044662 Eukaryota 22484
265 Ga0453683_0397664 3300044673 Bacteria 888
266 Ga0466966_0024688 3300044684 Bacteria 3931
267 Ga0466966_0181584 3300044684 Bacteria 1277
268 Ga0466963_0011357 3300044694 Bacteria 5420
269 Ga0466963_0065305 3300044694 Bacteria 2439
270 Ga0466963_0071521 3300044694 Bacteria 2335
271 Ga0466963_0892285 3300044694 Bacteria 627
272 Ga0466964_0845476 3300044706 Bacteria 520
273 Ga0453684_0009937 3300044712 Bacteria 16419
274 Ga0453684_0135107 3300044712 Bacteria 2954
275 Ga0466971_0204175 3300044719 Bacteria 933
276 Ga0466968_0189974 3300044735 Bacteria 958
277 Ga0466957_0002758 3300044842 Bacteria 9506
278 Ga0466959_0469186 3300045049 Bacteria 852
279 Ga0466959_0470021 3300045049 Bacteria 852
280 Ga0466959_0678063 3300045049 Bacteria 691
281 Ga0451576_0231113 3300045051 Bacteria 1931
282 Ga0466958_0074598 3300045836 Bacteria 2079
283 Ga0466967_0195105 3300045976 Bacteria 1915
284 Ga0495628_0960493 3300046516 Bacteria 590
285 Ga0495674_1351132 3300047319 Bacteria 533
286 Ga0496114_0001912 3300048917 Bacteria 15852
287 Ga0501300_050084 3300049523 Bacteria 643
288 Ga0501323_000753 3300049539 Eukaryota 2571
289 Ga0501326_06495 3300049542 Bacteria 654
290 nmdc:mga08x19_458827_c1 3300050514 Bacteria 897
291 Ga0495601_0051892 3300053077 Bacteria 2589
292 Ga0500592_000028 3300053116 Eukaryota 48730
293 Ga0500626_000020 3300053128 Eukaryota 22616
294 Ga0500620_000005 3300053155 Eukaryota 84425
295 Ga0587070_131814 3300059491 Bacteria 609
296 Ga0157370_10134730
297 JGI24740J21852_10019708
298 JGI26129J50193_1000001
299 JGI26145J50221_1000001
300 JGI26142J50222_100002
301 JGI26144J50225_100007
302 Ga0006556J51387_1001104
303 JGI26143J51219_1000001
304 Ga0006557J51388_1000889
305 Ga0006557J51388_1000890
306 Ga0006558J51389_1000540
307 Ga0006559J51393_1001439
308 Ga0006559J51393_1001440
309 Ga0006553J51392_1001570
310 Ga0006553J51392_1001572
311 Ga0006555J51386_1004624
312 Ga0006555J51386_1004626
313 Ga0006560J51390_1004764
314 Ga0006560J51390_1004765
315 Ga0006554J51385_1003403
316 Ga0006554J51385_1003404
317 JGI25404J52841_10000017
318 JGI25405J52794_10008302
319 Ga0058863_11895058
320 Ga0058861_11406994
321 Ga0065717_1001937
322 Ga0070683_100040141
323 Ga0070682_100106479
324 Ga0070691_10001010
325 Ga0070668_100200251
326 Ga0070688_100291664
327 Ga0070714_100000519
328 Ga0070714_100049770
329 Ga0070714_100609491
330 Ga0070714_101239559
331 Ga0070714_101872154
332 Ga0070713_101135336
333 Ga0070711_101061044
334 Ga0070663_100079708
335 Ga0070681_10884154
336 Ga0070684_100084671
337 Ga0068855_100011837
338 Ga0068854_100000039
339 Ga0068856_100002334
340 Ga0068856_101139709
341 Ga0068852_101256875
342 Ga0068866_10028841
343 Ga0081455_10005452
344 Ga0081538_10137227
345 Ga0081540_1002808
346 Ga0081539_10001283
347 Ga0070717_10060122
348 Ga0070717_10098323
349 Ga0070717_10312012
350 Ga0070717_11775332
351 Ga0075436_100060624
352 Ga0075435_100188146
353 Ga0105240_10426271
354 Ga0105238_10673988
355 Ga0157326_1001414
356 Ga0157338_1026630
357 Ga0157369_10136977
358 Ga0157369_10604065
359 Ga0157374_10064852
360 Ga0157376_10133835
361 Ga0214544_1024680
362 Ga0214545_1026642
363 Ga0214543_1026657
364 Ga0213873_10000595
365 Ga0213873_10025918
366 Ga0213873_10028247
367 Ga0213873_10049373
368 Ga0213873_10068734
369 Ga0213873_10123752
370 Ga0213872_10032095
371 Ga0213872_10042920
372 Ga0213872_10166850
373 Ga0213872_10277279
374 Ga0213872_10318639
375 Ga0213872_10325388
376 Ga0213872_10352291
377 Ga0213874_10075057
378 Ga0213874_10237372
379 Ga0213874_10355538
380 Ga0213874_10428359
381 Ga0213876_10029742
382 Ga0213876_10220259
383 Ga0213875_10034395
384 Ga0213875_10088036
385 Ga0213875_10490235
386 Ga0213871_10006246
387 Ga0213871_10008780
388 Ga0213871_10070857
389 Ga0213871_10097218
390 Ga0213871_10111773
391 Ga0213871_10122386
392 Ga0207642_10000612
393 Ga0207700_10903000
394 Ga0207664_10002006
395 Ga0207664_10052385
396 Ga0207664_10861066
397 Ga0207664_10984641
398 Ga0207664_11353561
399 Ga0207668_10158876
400 Ga0207668_10228989
401 Ga0207639_11101595
402 Ga0209973_1000001
403 Ga0209589_1029971
404 Ga0209982_1000001
405 Ga0209970_1000008
406 Ga0210002_1000010
407 Ga0209983_1000001
408 Ga0209971_1096303
409 Ga0209998_10000079
410 Ga0265334_10209832
411 Ga0265338_10000396
412 Ga0265338_10153962
413 Ga0265338_10290041
414 Ga0265765_1016811
415 Ga0265330_10072648
416 Ga0265332_10008913
417 Ga0265328_10238659
418 Ga0265325_10021517
419 Ga0265339_10007654
420 Ga0265331_10074383
421 Ga0265327_10000298
422 Ga0265327_10096344
423 Ga0265316_10409726
424 Ga0265313_10010254
425 Ga0310114_100567
426 Ga0310119_101210
427 Ga0310119_106928
428 Ga0265314_10156412
429 Ga0265342_10006015
430 Ga0316576_10250619
431 Ga0316578_10089395
432 Ga0307405_10000737
433 Ga0316577_10052644
434 Ga0316593_10001487
435 Ga0316593_10238548
436 Ga0316592_1000001
437 Ga0316592_1000618
438 Ga0316592_1053101
439 Ga0316592_1171694
440 Ga0316586_1009746
441 Ga0316586_1041767
442 Ga0316588_1037835
443 Ga0316587_1072607
444 Ga0316215_1000129
445 Ga0373959_0009277
446 Ga0373959_0071458
447 Ga0373952_0116127
448 Ga0373936_0269088
449 Ga0316574_0115792
450 Ga0316574_0221545
451 Ga0316574_0756638
452 Ga0373937_0515984
453 Ga0310112_032176
454 Ga0310109_000232
455 Ga0310110_003057
456 Ga0310110_020915
457 Ga0316584_0069531
458 Ga0316584_0140284
459 Ga0373925_0000113
460 Ga0395899_0230648
461 Ga0395900_0031839
462 Ga0395900_1755884
463 Ga0395898_0008404
464 Ga0395905_0280014
465 Ga0436364_0022182
466 Ga0436364_0301827
467 Ga0436364_0307422
468 Ga0436364_0346644
469 Ga0436364_0578888
470 Ga0436364_0725867
471 Ga0436364_0806322
472 Ga0436364_0977094
473 Ga0436364_1151975
474 Ga0436364_1159789
475 Ga0436364_1172568
476 Ga0436364_1357710
477 Ga0436364_1374520
478 Ga0395901_0029204
479 Ga0400483_021047
480 Ga0436365_0139927
481 Ga0436365_0142954
482 Ga0436365_0230296
483 Ga0436365_0500406
484 Ga0436365_0513586
485 Ga0436365_0604982
486 Ga0436365_0865502
487 Ga0436365_1810750
488 Ga0436360_0293982
489 Ga0436360_0327488
490 Ga0436360_0384227
491 Ga0436360_0426765
492 Ga0436360_0583036
493 Ga0436360_0689249
494 Ga0436360_0849262
495 Ga0436360_0883749
496 Ga0436360_0887653
497 Ga0436360_0975907
498 Ga0436360_1019953
499 Ga0436360_1051486
500 Ga0436360_1057762
501 Ga0436360_1171259
502 Ga0436360_1210313
503 Ga0436360_1245589
504 Ga0436360_1310360
505 Ga0436360_1323074
506 Ga0436360_1347115
507 Ga0436361_0143909
508 Ga0436361_0146375
509 Ga0436361_0230525
510 Ga0436361_0319595
511 Ga0436361_0510593
512 Ga0436361_0560336
513 Ga0436361_0628776
514 Ga0436361_0639888
515 Ga0436361_0700810
516 Ga0436361_0761715
517 Ga0436361_0762618
518 Ga0436361_0797986
519 Ga0436361_0801578
520 Ga0436361_0804614
521 Ga0436361_0811849
522 Ga0436361_0914836
523 Ga0436361_1176443
524 Ga0436363_0474419
525 Ga0436363_0773153
526 Ga0436363_0802287
527 Ga0436363_0935759
528 Ga0436363_1018444
529 Ga0436363_1211730
530 Ga0436363_1455911
531 Ga0436363_1477393
532 Ga0436363_1492969
533 Ga0436363_1533076
534 Ga0436363_1616044
535 Ga0436363_1617203
536 Ga0436362_0219029
537 Ga0436362_0226828
538 Ga0436362_0293439
539 Ga0436362_0306872
540 Ga0436362_0372347
541 Ga0436362_0410882
542 Ga0436362_0460400
543 Ga0436362_0600937
544 Ga0436362_0655523
545 Ga0436362_0737682
546 Ga0436362_0776467
547 Ga0436362_1014588
548 Ga0436362_1033420
549 Ga0436362_1062016
550 Ga0436362_1170699
551 Ga0436362_1195069
552 Ga0436362_1278824
553 Ga0436362_1284836
554 Ga0451791_1074904
555 Ga0451795_0854174
556 Ga0451839_1366035
557 Ga0451843_0546449
558 Ga0451577_0303302
559 Ga0466976_0000009
560 Ga0453683_0397664
561 Ga0466966_0024688
562 Ga0466966_0181584
563 Ga0466963_0011357
564 Ga0466963_0065305
565 Ga0466963_0071521
566 Ga0466963_0892285
567 Ga0466964_0845476
568 Ga0453684_0009937
569 Ga0453684_0135107
570 Ga0466971_0204175
571 Ga0466968_0189974
572 Ga0466957_0002758
573 Ga0466959_0469186
574 Ga0466959_0470021
575 Ga0466959_0678063
576 Ga0451576_0231113
577 Ga0466958_0074598
578 Ga0466967_0195105
579 Ga0495628_0960493
580 Ga0495674_1351132
581 Ga0496114_0001912
582 Ga0501300_050084
583 Ga0501323_000753
584 Ga0501326_06495
585 nmdc:mga08x19_458827_c1
586 Ga0495601_0051892
587 Ga0500592_000028
588 Ga0500626_000020
589 Ga0500620_000005
590 Ga0587070_131814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

13

93

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9388 14 64
4v5z-assembly1.cif.gz_As structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9057 3 63
7d6z-assembly1.cif.gz_z molecular model of the cryo-em structure of 70s ribosome in complex with peptide deformylase and trigger factor 0.9004 3 64
4v4b-assembly1.cif.gz_AS structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. 0.9002 3 63
6enu-assembly1.cif.gz_s polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) 0.8977 3 64
ID Description Score Start End Superfamily
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8992 4 64 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8792 3 63 3.30.860.10
4tpaS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8708 3 64 3.30.860.10
3huyS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8697 4 63 3.30.860.10
4kdjS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8688 4 64 3.30.860.10
ID Description Score Start End GO Terms
AF-A0A3L7LSD8-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9584 1 64 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-H2BCE4-F1-model_v4 30S ribosomal protein S19 0.9584 6 60 GO:0000028
GO:0003735
GO:0005763
GO:0006412
GO:0009507
AF-A0A3C1V0E1-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.947 6 64 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-H2BCE4-F1-model_v4 30S ribosomal protein S19 0.9417 6 60 GO:0000028
GO:0003735
GO:0005763
GO:0006412
GO:0009507
AF-A0A2H0B6U1-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9277 1 64 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843

Map