F392597

General Info

Members Datasets Scaffolds Average Seq Length
295 194 590 278

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10006990|Ga0099794_100069903
Length 324
Sequence MEKNSPHPRPGSAEKFSSLLPRVRETMRRMIPQGGRAMHEDAVSLLPKTEFTRREFVVTSLAAGFAMAVRPVSAQTITTNTLGLTADEVKIPVESGEIPAYRAMPASGGPFPVVLVVQEIFGVHEHIKDICRRFAKSGHLAVAPELFARQGDVSKMPDINEIISKVVSKVPDPEVMSDLDAAVAWTQKSGKGDTSKLGITGFCWGGRIVWLYAAHNPRLKAGVAWYGRLLGQPSDLQPKNPIDLVASLKAPVLGLYGGSDQGIPVETVEKMRQALQAAGSKSEIILYPDTPHGFHADYRPSYRPEQAKDGWKRLQEWFKKYGAA

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
145 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
193 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
194 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.34
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0.34
Rhizoplane 1.69
Rhizosphere 92.88
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10006990 3300007265 Bacteria 4605
2 JGI25406J46586_10064018 3300003203 Bacteria 1176
3 Ga0065704_10071809 3300005289 Bacteria 9882
4 Ga0065707_10081893 3300005295 Bacteria 30733
5 Ga0070676_10000020 3300005328 Bacteria 48745
6 Ga0070677_10019196 3300005333 Bacteria 2472
7 Ga0070666_10079705 3300005335 Bacteria 2237
8 Ga0070680_100020726 3300005336 Bacteria 5216
9 Ga0068868_100005211 3300005338 Bacteria 9123
10 Ga0070668_100002889 3300005347 Bacteria 12677
11 Ga0070669_100274039 3300005353 Bacteria 1350
12 Ga0070675_100069267 3300005354 Bacteria 2922
13 Ga0070675_100129261 3300005354 Bacteria 2151
14 Ga0070675_100210070 3300005354 Bacteria 1692
15 Ga0070671_100013689 3300005355 Bacteria 6541
16 Ga0070674_100001866 3300005356 Bacteria 11433
17 Ga0070674_100019945 3300005356 Bacteria 4271
18 Ga0070674_100022149 3300005356 Bacteria 4094
19 Ga0070673_100026558 3300005364 Bacteria 4278
20 Ga0070673_100157168 3300005364 Bacteria 1930
21 Ga0070659_100077574 3300005366 Bacteria 2650
22 Ga0070667_100061126 3300005367 Bacteria 3189
23 Ga0070714_100252675 3300005435 Bacteria 1630
24 Ga0070714_100296806 3300005435 Bacteria 1505
25 Ga0070713_100409440 3300005436 Bacteria 1268
26 Ga0070710_10213340 3300005437 Bacteria 1225
27 Ga0070711_100140604 3300005439 Bacteria 1809
28 Ga0070705_100220809 3300005440 Bacteria 1312
29 Ga0070705_100322579 3300005440 Bacteria 1116
30 Ga0070694_100006369 3300005444 Bacteria 7162
31 Ga0070708_100508746 3300005445 Bacteria 1136
32 Ga0070663_100009615 3300005455 Bacteria 5994
33 Ga0070678_100056396 3300005456 Bacteria 2873
34 Ga0070678_100083901 3300005456 Bacteria 2423
35 Ga0070681_10011391 3300005458 Bacteria 8800
36 Ga0070681_10110237 3300005458 Bacteria 2692
37 Ga0068867_100004207 3300005459 Bacteria 10128
38 Ga0070706_100004737 3300005467 Bacteria 13044
39 Ga0070706_100098578 3300005467 Bacteria 2716
40 Ga0070707_100001853 3300005468 Bacteria 20315
41 Ga0070707_100003064 3300005468 Bacteria 15836
42 Ga0070698_100013843 3300005471 Bacteria 8531
43 Ga0070698_100046336 3300005471 Bacteria 4445
44 Ga0070699_100001900 3300005518 Bacteria 18856
45 Ga0070699_100099006 3300005518 Bacteria 2555
46 Ga0070679_100087159 3300005530 Bacteria 3109
47 Ga0070679_100323207 3300005530 Bacteria 1492
48 Ga0070684_100170010 3300005535 Bacteria 1979
49 Ga0070684_100208793 3300005535 Bacteria 1780
50 Ga0070697_100002251 3300005536 Bacteria 14804
51 Ga0070697_100005913 3300005536 Bacteria 9446
52 Ga0070697_100031688 3300005536 Bacteria 4254
53 Ga0068853_100037075 3300005539 Bacteria 4147
54 Ga0068853_100067329 3300005539 Bacteria 3111
55 Ga0068853_100074205 3300005539 Bacteria 2968
56 Ga0068853_100391108 3300005539 Bacteria 1300
57 Ga0070672_100394409 3300005543 Bacteria 1185
58 Ga0070695_100053955 3300005545 Bacteria 2585
59 Ga0070693_100006640 3300005547 Bacteria 5617
60 Ga0070693_100234606 3300005547 Bacteria 1209
61 Ga0070665_100006453 3300005548 Bacteria 11937
62 Ga0070665_100432329 3300005548 Bacteria 1325
63 Ga0068855_100005825 3300005563 Bacteria 15039
64 Ga0068855_100023914 3300005563 Bacteria 7316
65 Ga0068855_100213236 3300005563 Bacteria 2169
66 Ga0068855_100484497 3300005563 Bacteria 1346
67 Ga0070664_100090389 3300005564 Bacteria 2650
68 Ga0068857_100074960 3300005577 Bacteria 3016
69 Ga0068856_100010300 3300005614 Bacteria 9086
70 Ga0070702_100040277 3300005615 Bacteria 2613
71 Ga0070702_100083137 3300005615 Bacteria 1922
72 Ga0070702_100217188 3300005615 Bacteria 1276
73 Ga0068852_100006785 3300005616 Bacteria 8307
74 Ga0068852_100269778 3300005616 Bacteria 1637
75 Ga0068859_100105739 3300005617 Bacteria 2873
76 Ga0068859_100300574 3300005617 Bacteria 1698
77 Ga0068851_10003138 3300005834 Bacteria 7326
78 Ga0068851_10169860 3300005834 Bacteria 1203
79 Ga0068870_10000943 3300005840 Bacteria 11398
80 Ga0068858_100017821 3300005842 Bacteria 6649
81 Ga0068858_100089942 3300005842 Bacteria 2857
82 Ga0068860_100054789 3300005843 Bacteria 3790
83 Ga0081539_10000331 3300005985 Bacteria 104820
84 Ga0081539_10000386 3300005985 Bacteria 95318
85 Ga0070717_10343638 3300006028 Bacteria 1333
86 Ga0070716_100172024 3300006173 Bacteria 1414
87 Ga0070712_100146411 3300006175 Bacteria 1808
88 Ga0070712_100309542 3300006175 Bacteria 1281
89 Ga0075366_10000623 3300006195 Bacteria 16637
90 Ga0097621_100182119 3300006237 Bacteria 1815
91 Ga0097621_100234314 3300006237 Bacteria 1603
92 Ga0068871_100155625 3300006358 Bacteria 1952
93 Ga0075428_100007067 3300006844 Bacteria 12440
94 Ga0075428_100492933 3300006844 Bacteria 1311
95 Ga0075428_100780391 3300006844 Bacteria 1016
96 Ga0075430_100028898 3300006846 Bacteria 4707
97 Ga0075430_100051400 3300006846 Bacteria 3473
98 Ga0075431_100007839 3300006847 Bacteria 10642
99 Ga0075431_100047167 3300006847 Bacteria 4442
100 Ga0075431_100263723 3300006847 Bacteria 1748
101 Ga0075433_10015290 3300006852 Bacteria 6290
102 Ga0075434_100114335 3300006871 Bacteria 2712
103 Ga0068865_100062855 3300006881 Bacteria 2608
104 Ga0097620_100105742 3300006931 Bacteria 2873
105 Ga0097620_100300552 3300006931 Bacteria 1698
106 Ga0075435_100078788 3300007076 Bacteria 2703
107 Ga0075435_100497090 3300007076 Bacteria 1054
108 Ga0099794_10000024 3300007265 Bacteria 62816
109 Ga0105240_10016345 3300009093 Bacteria 10050
110 Ga0105240_10060278 3300009093 Bacteria 4731
111 Ga0105240_10133211 3300009093 Bacteria 2978
112 Ga0105245_10094901 3300009098 Bacteria 2750
113 Ga0114129_10832791 3300009147 Bacteria 1174
114 Ga0105243_10238684 3300009148 Bacteria 1616
115 Ga0105241_10003057 3300009174 Bacteria 12476
116 Ga0105241_10022521 3300009174 Bacteria 4667
117 Ga0105242_10000549 3300009176 Bacteria 29738
118 Ga0105248_10017299 3300009177 Bacteria 7944
119 Ga0105248_10320745 3300009177 Bacteria 1745
120 Ga0105248_10693582 3300009177 Bacteria 1149
121 Ga0105237_10334125 3300009545 Bacteria 1520
122 Ga0105238_10082951 3300009551 Bacteria 3195
123 Ga0105239_10442109 3300010375 Bacteria 1474
124 Ga0157370_10003378 3300013104 Bacteria 18757
125 Ga0157369_10039101 3300013105 Bacteria 5186
126 Ga0157369_10301746 3300013105 Bacteria 1666
127 Ga0157369_10503449 3300013105 Bacteria 1253
128 Ga0157374_10027507 3300013296 Bacteria 5132
129 Ga0157374_10057074 3300013296 Bacteria 3646
130 Ga0157374_10148985 3300013296 Bacteria 2274
131 Ga0157378_10059624 3300013297 Bacteria 3405
132 Ga0157372_10041796 3300013307 Bacteria 5069
133 Ga0157372_10481071 3300013307 Bacteria 1447
134 Ga0157375_10000674 3300013308 Bacteria 30226
135 Ga0157375_10058283 3300013308 Bacteria 3820
136 Ga0157380_10003558 3300014326 Bacteria 10711
137 Ga0157379_10097870 3300014968 Bacteria 2634
138 Ga0157379_10685381 3300014968 Bacteria 961
139 Ga0157376_10154453 3300014969 Bacteria 2073
140 Ga0163161_10271213 3300017792 Bacteria 1328
141 Ga0206352_10474227 3300020078 Bacteria 1148
142 Ga0213872_10001550 3300021361 Bacteria 14724
143 Ga0213872_10001754 3300021361 Bacteria 13595
144 Ga0213872_10014510 3300021361 Bacteria 3676
145 Ga0213872_10015885 3300021361 Bacteria 3497
146 Ga0213876_10095499 3300021384 Bacteria 1575
147 Ga0207656_10006539 3300025321 Bacteria 4198
148 Ga0207680_10222236 3300025903 Bacteria 1295
149 Ga0207645_10000596 3300025907 Bacteria 29974
150 Ga0207643_10001860 3300025908 Bacteria 11670
151 Ga0207684_10003842 3300025910 Bacteria 14460
152 Ga0207684_10393406 3300025910 Bacteria 1192
153 Ga0207654_10028666 3300025911 Bacteria 3037
154 Ga0207707_10009183 3300025912 Bacteria 8582
155 Ga0207707_10016115 3300025912 Bacteria 6517
156 Ga0207707_10192724 3300025912 Bacteria 1778
157 Ga0207695_10018944 3300025913 Bacteria 7941
158 Ga0207695_10089569 3300025913 Bacteria 3094
159 Ga0207693_10022021 3300025915 Bacteria 5067
160 Ga0207693_10153957 3300025915 Bacteria 1809
161 Ga0207663_10217791 3300025916 Bacteria 1387
162 Ga0207662_10031284 3300025918 Bacteria 3091
163 Ga0207646_10000022 3300025922 Bacteria 259328
164 Ga0207646_10000458 3300025922 Bacteria 54588
165 Ga0207646_10001603 3300025922 Bacteria 27608
166 Ga0207646_10180449 3300025922 Bacteria 1907
167 Ga0207659_10129232 3300025926 Bacteria 1947
168 Ga0207659_10415236 3300025926 Bacteria 1128
169 Ga0207700_10016673 3300025928 Bacteria 4887
170 Ga0207664_10381222 3300025929 Bacteria 1252
171 Ga0207644_10066960 3300025931 Bacteria 2616
172 Ga0207690_10350863 3300025932 Bacteria 1167
173 Ga0207686_10196203 3300025934 Bacteria 1443
174 Ga0207669_10016555 3300025937 Bacteria 3750
175 Ga0207669_10326981 3300025937 Bacteria 1176
176 Ga0207669_10601748 3300025937 Bacteria 893
177 Ga0207704_10014136 3300025938 Bacteria 4022
178 Ga0207665_10043522 3300025939 Bacteria 3002
179 Ga0207691_10000152 3300025940 Bacteria 64344
180 Ga0207711_10082512 3300025941 Bacteria 2810
181 Ga0207679_10103634 3300025945 Bacteria 2230
182 Ga0207667_10002848 3300025949 Bacteria 21464
183 Ga0207667_10038809 3300025949 Bacteria 5080
184 Ga0207667_10191110 3300025949 Bacteria 2101
185 Ga0207651_10074743 3300025960 Bacteria 2414
186 Ga0207658_10000926 3300025986 Bacteria 24286
187 Ga0207677_10130105 3300026023 Bacteria 1909
188 Ga0207703_10013332 3300026035 Bacteria 6405
189 Ga0207703_10086012 3300026035 Bacteria 2633
190 Ga0207639_10052274 3300026041 Bacteria 3113
191 Ga0207639_10068994 3300026041 Bacteria 2757
192 Ga0207639_10087889 3300026041 Bacteria 2479
193 Ga0207639_10436129 3300026041 Bacteria 1187
194 Ga0207678_10005231 3300026067 Bacteria 11625
195 Ga0207708_10319383 3300026075 Bacteria 1267
196 Ga0207702_10057011 3300026078 Bacteria 3319
197 Ga0207648_10007837 3300026089 Bacteria 10425
198 Ga0207676_10065134 3300026095 Bacteria 2901
199 Ga0207674_10270348 3300026116 Bacteria 1647
200 Ga0207683_10000307 3300026121 Bacteria 44287
201 Ga0207698_10124738 3300026142 Bacteria 2187
202 Ga0207698_10239091 3300026142 Bacteria 1654
203 Ga0209588_1000026 3300027671 Bacteria 81177
204 Ga0268266_10029685 3300028379 Bacteria 4646
205 Ga0268264_10180101 3300028381 Bacteria 1918
206 Ga0265338_10315923 3300028800 Bacteria 1132
207 Ga0265324_10003644 3300029957 Bacteria 7229
208 Ga0265332_10021460 3300031238 Bacteria 2852
209 Ga0265328_10010278 3300031239 Bacteria 3773
210 Ga0265320_10005384 3300031240 Bacteria 8227
211 Ga0265339_10000185 3300031249 Bacteria 52886
212 Ga0265339_10011540 3300031249 Bacteria 5434
213 Ga0265331_10000927 3300031250 Bacteria 23510
214 Ga0265316_10000130 3300031344 Bacteria 81991
215 Ga0265314_10000003 3300031711 Bacteria 1653386
216 Ga0265314_10003478 3300031711 Bacteria 15211
217 Ga0265314_10012898 3300031711 Bacteria 6788
218 Ga0265342_10001017 3300031712 Bacteria 27615
219 Ga0316576_10008272 3300031727 Bacteria 6621
220 Ga0316578_10005936 3300031728 Bacteria 5977
221 Ga0316577_10009949 3300031733 Bacteria 5129
222 Ga0316580_10000357 3300032139 Bacteria 10106
223 Ga0373930_0041332 3300034816 Bacteria 983
224 Ga0373954_0205772 3300035118 Unclassified 967
225 Ga0373956_0029553 3300035119 Bacteria 2391
226 Ga0316574_0007301 3300035398 Bacteria 6048
227 Ga0373935_0086093 3300035692 Bacteria 2050
228 Ga0373933_0017803 3300035724 Unclassified 3988
229 Ga0373937_0043332 3300036401 Bacteria 4107
230 Ga0316582_0012059 3300036647 Bacteria 4810
231 Ga0316584_0018487 3300036712 Bacteria 5029
232 Ga0395900_0624272 3300037418 Bacteria 1016
233 Ga0395905_0087382 3300037471 Bacteria 2923
234 Ga0395905_0412647 3300037471 Bacteria 1246
235 Ga0395901_0578706 3300038443 Bacteria 1135
236 Ga0436365_1460329 3300039437 Bacteria 968
237 Ga0436365_1637722 3300039437 Bacteria 7492
238 Ga0436365_1806431 3300039437 Bacteria 2823
239 Ga0436361_0096860 3300039447 Bacteria 1427
240 Ga0436361_0443227 3300039447 Bacteria 2559
241 Ga0436361_1058169 3300039447 Bacteria 1969
242 Ga0436361_1135068 3300039447 Bacteria 3328
243 Ga0436363_0312443 3300039450 Bacteria 1842
244 Ga0451577_0028829 3300042876 Bacteria 5020
245 Ga0451577_0068334 3300042876 Bacteria 3169
246 Ga0451577_0107912 3300042876 Bacteria 2489
247 Ga0466972_0054534 3300044658 Bacteria 1923
248 Ga0453683_0009663 3300044673 Bacteria 6431
249 Ga0453683_0035221 3300044673 Bacteria 3154
250 Ga0453683_0105871 3300044673 Bacteria 1767
251 Ga0466966_0042341 3300044684 Bacteria 2923
252 Ga0466961_0085038 3300044693 Bacteria 2000
253 Ga0453684_0010213 3300044712 Bacteria 16091
254 Ga0466971_0000664 3300044719 Bacteria 13685
255 Ga0466957_0014972 3300044842 Bacteria 4526
256 Ga0451576_0011873 3300045051 Bacteria 9855
257 Ga0451576_0025067 3300045051 Bacteria 6431
258 Ga0451576_0055307 3300045051 Bacteria 4152
259 Ga0451576_0083159 3300045051 Bacteria 3330
260 Ga0451576_0124679 3300045051 Bacteria 2683
261 Ga0451576_0269896 3300045051 Bacteria 1779
262 Ga0495652_0080924 3300046529 Bacteria 2681
263 Ga0495587_0034723 3300046536 Bacteria 3040
264 Ga0495659_0011119 3300046664 Bacteria 2899
265 Ga0496110_0351399 3300048913 Bacteria 1343
266 Ga0496112_0097333 3300048915 Bacteria 2913
267 Ga0496112_0181471 3300048915 Bacteria 2069
268 Ga0496112_0348832 3300048915 Bacteria 1423
269 Ga0496115_0417652 3300048918 Bacteria 1087
270 Ga0496124_0217217 3300048927 Bacteria 1441
271 Ga0501033_0245529 3300049570 Bacteria 1270
272 Ga0501034_0248434 3300049571 Bacteria 1724
273 Ga0501043_0170535 3300049579 Bacteria 1698
274 Ga0501072_0426377 3300049588 Bacteria 1051
275 Ga0501079_0541707 3300049741 Bacteria 915
276 nmdc:mga00v17_20499_c1 3300050491 Bacteria 3788
277 nmdc:mga07m45_226205_c1 3300050496 Bacteria 1088
278 nmdc:mga0qj67_72879_c1 3300050509 Bacteria 2743
279 nmdc:mga06r32_38858_c1 3300050510 Bacteria 4512
280 nmdc:mga06r32_392729_c1 3300050510 Bacteria 1370
281 nmdc:mga06r32_68474_c1 3300050510 Bacteria 3429
282 nmdc:mga0n895_244723_c1 3300050512 Bacteria 1820
283 nmdc:mga0rr50_143428_c1 3300050513 Bacteria 1923
284 nmdc:mga0rr50_20252_c1 3300050513 Bacteria 4511
285 nmdc:mga0rr50_416972_c1 3300050513 Bacteria 1135
286 nmdc:mga0rr50_593676_c1 3300050513 Bacteria 944
287 nmdc:mga0a205_88602_c1 3300050515 Bacteria 2991
288 Ga0495612_0057100 3300053078 Bacteria 1612
289 Ga0500643_018160 3300053087 Bacteria 2340
290 Ga0500555_017918 3300053103 Bacteria 2040
291 Ga0500616_0002975 3300053153 Bacteria 13426
292 Ga0500616_0095466 3300053153 Bacteria 1463
293 Ga0500645_026810 3300053730 Bacteria 1751
294 2687239500 2684623219 Bacteria 8442773
295 643599687 643348564 Bacteria 8839022
296 Ga0099794_10006990
297 JGI25406J46586_10064018
298 Ga0065704_10071809
299 Ga0065707_10081893
300 Ga0070676_10000020
301 Ga0070677_10019196
302 Ga0070666_10079705
303 Ga0070680_100020726
304 Ga0068868_100005211
305 Ga0070668_100002889
306 Ga0070669_100274039
307 Ga0070675_100069267
308 Ga0070675_100129261
309 Ga0070675_100210070
310 Ga0070671_100013689
311 Ga0070674_100001866
312 Ga0070674_100019945
313 Ga0070674_100022149
314 Ga0070673_100026558
315 Ga0070673_100157168
316 Ga0070659_100077574
317 Ga0070667_100061126
318 Ga0070714_100252675
319 Ga0070714_100296806
320 Ga0070713_100409440
321 Ga0070710_10213340
322 Ga0070711_100140604
323 Ga0070705_100220809
324 Ga0070705_100322579
325 Ga0070694_100006369
326 Ga0070708_100508746
327 Ga0070663_100009615
328 Ga0070678_100056396
329 Ga0070678_100083901
330 Ga0070681_10011391
331 Ga0070681_10110237
332 Ga0068867_100004207
333 Ga0070706_100004737
334 Ga0070706_100098578
335 Ga0070707_100001853
336 Ga0070707_100003064
337 Ga0070698_100013843
338 Ga0070698_100046336
339 Ga0070699_100001900
340 Ga0070699_100099006
341 Ga0070679_100087159
342 Ga0070679_100323207
343 Ga0070684_100170010
344 Ga0070684_100208793
345 Ga0070697_100002251
346 Ga0070697_100005913
347 Ga0070697_100031688
348 Ga0068853_100037075
349 Ga0068853_100067329
350 Ga0068853_100074205
351 Ga0068853_100391108
352 Ga0070672_100394409
353 Ga0070695_100053955
354 Ga0070693_100006640
355 Ga0070693_100234606
356 Ga0070665_100006453
357 Ga0070665_100432329
358 Ga0068855_100005825
359 Ga0068855_100023914
360 Ga0068855_100213236
361 Ga0068855_100484497
362 Ga0070664_100090389
363 Ga0068857_100074960
364 Ga0068856_100010300
365 Ga0070702_100040277
366 Ga0070702_100083137
367 Ga0070702_100217188
368 Ga0068852_100006785
369 Ga0068852_100269778
370 Ga0068859_100105739
371 Ga0068859_100300574
372 Ga0068851_10003138
373 Ga0068851_10169860
374 Ga0068870_10000943
375 Ga0068858_100017821
376 Ga0068858_100089942
377 Ga0068860_100054789
378 Ga0081539_10000331
379 Ga0081539_10000386
380 Ga0070717_10343638
381 Ga0070716_100172024
382 Ga0070712_100146411
383 Ga0070712_100309542
384 Ga0075366_10000623
385 Ga0097621_100182119
386 Ga0097621_100234314
387 Ga0068871_100155625
388 Ga0075428_100007067
389 Ga0075428_100492933
390 Ga0075428_100780391
391 Ga0075430_100028898
392 Ga0075430_100051400
393 Ga0075431_100007839
394 Ga0075431_100047167
395 Ga0075431_100263723
396 Ga0075433_10015290
397 Ga0075434_100114335
398 Ga0068865_100062855
399 Ga0097620_100105742
400 Ga0097620_100300552
401 Ga0075435_100078788
402 Ga0075435_100497090
403 Ga0099794_10000024
404 Ga0105240_10016345
405 Ga0105240_10060278
406 Ga0105240_10133211
407 Ga0105245_10094901
408 Ga0114129_10832791
409 Ga0105243_10238684
410 Ga0105241_10003057
411 Ga0105241_10022521
412 Ga0105242_10000549
413 Ga0105248_10017299
414 Ga0105248_10320745
415 Ga0105248_10693582
416 Ga0105237_10334125
417 Ga0105238_10082951
418 Ga0105239_10442109
419 Ga0157370_10003378
420 Ga0157369_10039101
421 Ga0157369_10301746
422 Ga0157369_10503449
423 Ga0157374_10027507
424 Ga0157374_10057074
425 Ga0157374_10148985
426 Ga0157378_10059624
427 Ga0157372_10041796
428 Ga0157372_10481071
429 Ga0157375_10000674
430 Ga0157375_10058283
431 Ga0157380_10003558
432 Ga0157379_10097870
433 Ga0157379_10685381
434 Ga0157376_10154453
435 Ga0163161_10271213
436 Ga0206352_10474227
437 Ga0213872_10001550
438 Ga0213872_10001754
439 Ga0213872_10014510
440 Ga0213872_10015885
441 Ga0213876_10095499
442 Ga0207656_10006539
443 Ga0207680_10222236
444 Ga0207645_10000596
445 Ga0207643_10001860
446 Ga0207684_10003842
447 Ga0207684_10393406
448 Ga0207654_10028666
449 Ga0207707_10009183
450 Ga0207707_10016115
451 Ga0207707_10192724
452 Ga0207695_10018944
453 Ga0207695_10089569
454 Ga0207693_10022021
455 Ga0207693_10153957
456 Ga0207663_10217791
457 Ga0207662_10031284
458 Ga0207646_10000022
459 Ga0207646_10000458
460 Ga0207646_10001603
461 Ga0207646_10180449
462 Ga0207659_10129232
463 Ga0207659_10415236
464 Ga0207700_10016673
465 Ga0207664_10381222
466 Ga0207644_10066960
467 Ga0207690_10350863
468 Ga0207686_10196203
469 Ga0207669_10016555
470 Ga0207669_10326981
471 Ga0207669_10601748
472 Ga0207704_10014136
473 Ga0207665_10043522
474 Ga0207691_10000152
475 Ga0207711_10082512
476 Ga0207679_10103634
477 Ga0207667_10002848
478 Ga0207667_10038809
479 Ga0207667_10191110
480 Ga0207651_10074743
481 Ga0207658_10000926
482 Ga0207677_10130105
483 Ga0207703_10013332
484 Ga0207703_10086012
485 Ga0207639_10052274
486 Ga0207639_10068994
487 Ga0207639_10087889
488 Ga0207639_10436129
489 Ga0207678_10005231
490 Ga0207708_10319383
491 Ga0207702_10057011
492 Ga0207648_10007837
493 Ga0207676_10065134
494 Ga0207674_10270348
495 Ga0207683_10000307
496 Ga0207698_10124738
497 Ga0207698_10239091
498 Ga0209588_1000026
499 Ga0268266_10029685
500 Ga0268264_10180101
501 Ga0265338_10315923
502 Ga0265324_10003644
503 Ga0265332_10021460
504 Ga0265328_10010278
505 Ga0265320_10005384
506 Ga0265339_10000185
507 Ga0265339_10011540
508 Ga0265331_10000927
509 Ga0265316_10000130
510 Ga0265314_10000003
511 Ga0265314_10003478
512 Ga0265314_10012898
513 Ga0265342_10001017
514 Ga0316576_10008272
515 Ga0316578_10005936
516 Ga0316577_10009949
517 Ga0316580_10000357
518 Ga0373930_0041332
519 Ga0373954_0205772
520 Ga0373956_0029553
521 Ga0316574_0007301
522 Ga0373935_0086093
523 Ga0373933_0017803
524 Ga0373937_0043332
525 Ga0316582_0012059
526 Ga0316584_0018487
527 Ga0395900_0624272
528 Ga0395905_0087382
529 Ga0395905_0412647
530 Ga0395901_0578706
531 Ga0436365_1460329
532 Ga0436365_1637722
533 Ga0436365_1806431
534 Ga0436361_0096860
535 Ga0436361_0443227
536 Ga0436361_1058169
537 Ga0436361_1135068
538 Ga0436363_0312443
539 Ga0451577_0028829
540 Ga0451577_0068334
541 Ga0451577_0107912
542 Ga0466972_0054534
543 Ga0453683_0009663
544 Ga0453683_0035221
545 Ga0453683_0105871
546 Ga0466966_0042341
547 Ga0466961_0085038
548 Ga0453684_0010213
549 Ga0466971_0000664
550 Ga0466957_0014972
551 Ga0451576_0011873
552 Ga0451576_0025067
553 Ga0451576_0055307
554 Ga0451576_0083159
555 Ga0451576_0124679
556 Ga0451576_0269896
557 Ga0495652_0080924
558 Ga0495587_0034723
559 Ga0495659_0011119
560 Ga0496110_0351399
561 Ga0496112_0097333
562 Ga0496112_0181471
563 Ga0496112_0348832
564 Ga0496115_0417652
565 Ga0496124_0217217
566 Ga0501033_0245529
567 Ga0501034_0248434
568 Ga0501043_0170535
569 Ga0501072_0426377
570 Ga0501079_0541707
571 nmdc:mga00v17_20499_c1
572 nmdc:mga07m45_226205_c1
573 nmdc:mga0qj67_72879_c1
574 nmdc:mga06r32_38858_c1
575 nmdc:mga06r32_392729_c1
576 nmdc:mga06r32_68474_c1
577 nmdc:mga0n895_244723_c1
578 nmdc:mga0rr50_143428_c1
579 nmdc:mga0rr50_20252_c1
580 nmdc:mga0rr50_416972_c1
581 nmdc:mga0rr50_593676_c1
582 nmdc:mga0a205_88602_c1
583 Ga0495612_0057100
584 Ga0500643_018160
585 Ga0500555_017918
586 Ga0500616_0002975
587 Ga0500616_0095466
588 Ga0500645_026810
589 2687239500
590 643599687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

98

322

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9491 51 266
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8523 51 266
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.843 45 268
1din-assembly1.cif.gz_A dienelactone hydrolase at 2.8 angstroms 0.8253 56 266
4u2c-assembly1.cif.gz_A crystal structure of dienelactone hydrolase a-6 variant (s7t, a24v, q35h, f38l, q110l, c123s, y145c, e199g and s208g) at 1.95 a resolution 0.825 56 266
ID Description Score Start End Superfamily
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.919 51 266 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8642 67 268 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.85 45 268 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.836 51 266 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8348 54 265 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A485B8N0-F1-model_v4 Dienelactone hydrolase family 0.9959 147 268 GO:0016787
AF-A0A537QQY5-F1-model_v4 Dienelactone hydrolase family protein 0.9939 141 271 GO:0016787
AF-G5QNF5-F1-model_v4 Dienelactone hydrolase family 0.9932 146 269 GO:0016787
AF-A0A3L9HR51-F1-model_v4 Carboxymethylenebutenolidase 0.9932 149 269 GO:0016787
AF-W1XUX8-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9927 154 254 GO:0016787

Map