F392348

General Info

Members Datasets Scaffolds Average Seq Length
294 185 588 204

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_133835_c1|nmdc:mga03683_133835_c1_315_1025
Length 236
Sequence MLVGRNVALRIGTSDRLTGTLRPHVHPHEGAVMATWQISGEYMETCNCTLLCPCITSNLAATPTEGDCKAAVTMRIEKGHKDGVPLDGLSFIVMLHAPGAMGAGNITVGLIIDERASDAQVEAISAIATGAVGGPMAALGPLVGKIAGIERRPIQFDMDGLNRAVRAGDLVDQACEGFPSASAPGQAIGVDNTAHPVNSRLSLAKATRSLFNVFGIKWNDSTGTRNGHFAPFAWAG

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
134 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
135 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 2.04
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_133835_c1 3300050489 Bacteria 1111
2 Ga0007409J51694_1064309 3300003575 Unclassified 643
3 Ga0065715_10236255 3300005293 Bacteria 1215
4 Ga0070658_10365654 3300005327 Bacteria 1236
5 Ga0070658_10823000 3300005327 Bacteria 807
6 Ga0070676_10771470 3300005328 Unclassified 707
7 Ga0070690_100524920 3300005330 Bacteria 889
8 Ga0070670_100044061 3300005331 Bacteria 3836
9 Ga0070670_100397297 3300005331 Bacteria 1217
10 Ga0068869_100114259 3300005334 Bacteria 2057
11 Ga0070666_10367241 3300005335 Unclassified 1032
12 Ga0070666_10572757 3300005335 Bacteria 823
13 Ga0070680_100144615 3300005336 Bacteria 1994
14 Ga0068868_100072394 3300005338 Bacteria 2750
15 Ga0068868_100456937 3300005338 Bacteria 1112
16 Ga0070689_100182019 3300005340 Bacteria 1707
17 Ga0070668_100037289 3300005347 Bacteria 3712
18 Ga0070669_100022109 3300005353 Bacteria 4549
19 Ga0070669_100163446 3300005353 Bacteria 1732
20 Ga0070675_100053918 3300005354 Bacteria 3307
21 Ga0070671_100051706 3300005355 Bacteria 3417
22 Ga0070673_100067717 3300005364 Unclassified 2856
23 Ga0070673_100634223 3300005364 Bacteria 977
24 Ga0070667_100101445 3300005367 Bacteria 2486
25 Ga0070705_100038448 3300005440 Bacteria 2707
26 Ga0070694_100032177 3300005444 Bacteria 3444
27 Ga0070663_100245827 3300005455 Bacteria 1414
28 Ga0070678_100036803 3300005456 Bacteria 3429
29 Ga0070678_100257585 3300005456 Unclassified 1466
30 Ga0070678_101216512 3300005456 Unclassified 699
31 Ga0068867_100000630 3300005459 Bacteria 23232
32 Ga0068867_100004572 3300005459 Bacteria 9732
33 Ga0068867_100657900 3300005459 Unclassified 920
34 Ga0068867_100889193 3300005459 Bacteria 801
35 Ga0070707_100885373 3300005468 Bacteria 857
36 Ga0070699_100011693 3300005518 Bacteria 7580
37 Ga0070699_100387810 3300005518 Bacteria 1262
38 Ga0070679_100375095 3300005530 Bacteria 1369
39 Ga0070697_100116289 3300005536 Bacteria 2233
40 Ga0070672_100170208 3300005543 Bacteria 1811
41 Ga0070672_100627035 3300005543 Bacteria 938
42 Ga0070686_100323887 3300005544 Bacteria 1150
43 Ga0070695_100223796 3300005545 Bacteria 1357
44 Ga0070696_100205368 3300005546 Bacteria 1472
45 Ga0070665_100050678 3300005548 Bacteria 4166
46 Ga0070665_100130393 3300005548 Bacteria 2516
47 Ga0070704_100369247 3300005549 Bacteria 1216
48 Ga0070704_100519250 3300005549 Bacteria 1036
49 Ga0068855_100513366 3300005563 Bacteria 1301
50 Ga0068856_100235855 3300005614 Bacteria 1845
51 Ga0068859_100080681 3300005617 Bacteria 3294
52 Ga0068859_100236354 3300005617 Bacteria 1916
53 Ga0068864_100022410 3300005618 Bacteria 5297
54 Ga0068864_100115669 3300005618 Bacteria 2392
55 Ga0068864_100118931 3300005618 Bacteria 2360
56 Ga0068864_100367687 3300005618 Bacteria 1360
57 Ga0068866_10122313 3300005718 Bacteria 1468
58 Ga0068861_100003806 3300005719 Bacteria 10073
59 Ga0068870_10118558 3300005840 Bacteria 1521
60 Ga0068870_10668637 3300005840 Bacteria 713
61 Ga0068863_100027500 3300005841 Bacteria 5426
62 Ga0068863_100191380 3300005841 Bacteria 1966
63 Ga0068863_100225361 3300005841 Bacteria 1807
64 Ga0068863_100317944 3300005841 Bacteria 1512
65 Ga0068858_100082739 3300005842 Bacteria 2984
66 Ga0068858_100175204 3300005842 Bacteria 2024
67 Ga0068858_100247240 3300005842 Bacteria 1694
68 Ga0068860_100001154 3300005843 Bacteria 28883
69 Ga0068860_100048665 3300005843 Bacteria 4040
70 Ga0068860_100061276 3300005843 Bacteria 3575
71 Ga0068862_100004759 3300005844 Bacteria 11429
72 Ga0068862_100155400 3300005844 Bacteria 2039
73 Ga0075366_10014439 3300006195 Bacteria 4511
74 Ga0068871_100309652 3300006358 Bacteria 1388
75 Ga0068871_100466743 3300006358 Bacteria 1134
76 Ga0075430_100581399 3300006846 Bacteria 924
77 Ga0075433_10039272 3300006852 Bacteria 4091
78 Ga0075434_100390116 3300006871 Bacteria 1413
79 Ga0075429_100418229 3300006880 Bacteria 1174
80 Ga0068865_100039090 3300006881 Bacteria 3216
81 Ga0068865_100692815 3300006881 Bacteria 870
82 Ga0075436_100008330 3300006914 Bacteria 7090
83 Ga0075436_100040946 3300006914 Bacteria 3196
84 Ga0097620_100080685 3300006931 Bacteria 3294
85 Ga0097620_100236342 3300006931 Bacteria 1916
86 Ga0075435_100019017 3300007076 Bacteria 5235
87 Ga0105240_11084184 3300009093 Bacteria 853
88 Ga0111539_10000067 3300009094 Bacteria 105394
89 Ga0105245_10025328 3300009098 Bacteria 5217
90 Ga0105243_10002283 3300009148 Bacteria 16075
91 Ga0105243_10048613 3300009148 Bacteria 3344
92 Ga0105243_10534600 3300009148 Bacteria 1117
93 Ga0105242_10262150 3300009176 Bacteria 1562
94 Ga0105248_10188650 3300009177 Bacteria 2323
95 Ga0105248_10824867 3300009177 Bacteria 1047
96 Ga0105249_10197230 3300009553 Bacteria 1968
97 Ga0105249_10735837 3300009553 Bacteria 1048
98 Ga0157374_10060544 3300013296 Bacteria 3543
99 Ga0157378_10084633 3300013297 Bacteria 2872
100 Ga0157378_10243104 3300013297 Bacteria 1720
101 Ga0163162_10037643 3300013306 Bacteria 4828
102 Ga0163162_10476713 3300013306 Bacteria 1379
103 Ga0163162_11521826 3300013306 Bacteria 762
104 Ga0163162_11830025 3300013306 Bacteria 694
105 Ga0157375_10113047 3300013308 Bacteria 2816
106 Ga0163163_11160090 3300014325 Unclassified 835
107 Ga0157380_10006565 3300014326 Bacteria 8201
108 Ga0157380_10083018 3300014326 Bacteria 2624
109 Ga0157377_10000045 3300014745 Bacteria 99825
110 Ga0157379_10039191 3300014968 Bacteria 4227
111 Ga0157379_10177219 3300014968 Bacteria 1925
112 Ga0157379_10375935 3300014968 Bacteria 1303
113 Ga0157379_10402631 3300014968 Bacteria 1258
114 Ga0157379_10697556 3300014968 Unclassified 953
115 Ga0163161_10009149 3300017792 Bacteria 6846
116 Ga0163161_10059030 3300017792 Bacteria 2789
117 Ga0163161_11093784 3300017792 Bacteria 685
118 Ga0207656_10176277 3300025321 Unclassified 1024
119 Ga0207680_10502890 3300025903 Bacteria 863
120 Ga0207643_10048572 3300025908 Bacteria 2404
121 Ga0207643_10415361 3300025908 Bacteria 852
122 Ga0207705_10179346 3300025909 Bacteria 1598
123 Ga0207660_10446595 3300025917 Bacteria 1045
124 Ga0207662_10070740 3300025918 Bacteria 2111
125 Ga0207652_10453609 3300025921 Unclassified 1156
126 Ga0207681_10051536 3300025923 Bacteria 2789
127 Ga0207681_10307032 3300025923 Bacteria 1257
128 Ga0207681_10888395 3300025923 Bacteria 746
129 Ga0207650_10002249 3300025925 Bacteria 13484
130 Ga0207650_10032155 3300025925 Bacteria 3795
131 Ga0207650_10339806 3300025925 Bacteria 1233
132 Ga0207659_10022283 3300025926 Bacteria 4216
133 Ga0207644_10088518 3300025931 Bacteria 2303
134 Ga0207644_10298435 3300025931 Bacteria 1298
135 Ga0207690_10309286 3300025932 Bacteria 1239
136 Ga0207706_10600393 3300025933 Bacteria 945
137 Ga0207709_10003884 3300025935 Bacteria 8736
138 Ga0207709_10086316 3300025935 Bacteria 2037
139 Ga0207670_10149923 3300025936 Bacteria 1729
140 Ga0207704_10151746 3300025938 Bacteria 1636
141 Ga0207691_10070408 3300025940 Bacteria 3158
142 Ga0207691_10188367 3300025940 Bacteria 1801
143 Ga0207689_10273366 3300025942 Bacteria 1399
144 Ga0207689_10665465 3300025942 Bacteria 878
145 Ga0207651_10127047 3300025960 Bacteria 1945
146 Ga0207712_10010461 3300025961 Bacteria 5890
147 Ga0207668_10057946 3300025972 Archaea 2705
148 Ga0207640_10202620 3300025981 Bacteria 1505
149 Ga0207677_10065658 3300026023 Bacteria 2533
150 Ga0207677_10838998 3300026023 Bacteria 825
151 Ga0207703_10288923 3300026035 Bacteria 1491
152 Ga0207703_10416564 3300026035 Bacteria 1249
153 Ga0207639_11174653 3300026041 Bacteria 720
154 Ga0207678_10372654 3300026067 Bacteria 1233
155 Ga0207708_10495378 3300026075 Bacteria 1023
156 Ga0207708_10811716 3300026075 Bacteria 806
157 Ga0207641_10022572 3300026088 Bacteria 5180
158 Ga0207648_10000976 3300026089 Bacteria 32284
159 Ga0207648_10001566 3300026089 Bacteria 25104
160 Ga0207676_10057909 3300026095 Bacteria 3054
161 Ga0207676_10084567 3300026095 Bacteria 2586
162 Ga0207676_11057774 3300026095 Bacteria 801
163 Ga0207674_10341940 3300026116 Bacteria 1447
164 Ga0207675_100000193 3300026118 Bacteria 55695
165 Ga0207675_100679909 3300026118 Bacteria 1037
166 Ga0207683_10215038 3300026121 Bacteria 1750
167 Ga0207428_10000922 3300027907 Bacteria 32865
168 Ga0268266_10065390 3300028379 Bacteria 3144
169 Ga0268266_10091361 3300028379 Bacteria 2669
170 Ga0268265_10022462 3300028380 Bacteria 4433
171 Ga0268265_10151354 3300028380 Bacteria 1957
172 Ga0268264_10023580 3300028381 Bacteria 5017
173 Ga0268264_10036590 3300028381 Bacteria 4045
174 Ga0268264_10123357 3300028381 Bacteria 2286
175 Ga0307509_10155018 3300031507 Unclassified 2198
176 Ga0307408_100072716 3300031548 Bacteria 2546
177 Ga0307408_100246211 3300031548 Bacteria 1472
178 Ga0307408_100714710 3300031548 Bacteria 902
179 Ga0307408_100753829 3300031548 Bacteria 880
180 Ga0316575_10001870 3300031665 Bacteria 6930
181 Ga0316575_10005450 3300031665 Bacteria 4537
182 Ga0307406_10234346 3300031901 Bacteria 1373
183 Ga0307406_10627721 3300031901 Bacteria 889
184 Ga0307406_10647420 3300031901 Bacteria 877
185 Ga0307409_100279810 3300031995 Bacteria 1541
186 Ga0307416_100105274 3300032002 Bacteria 2469
187 Ga0307416_100583656 3300032002 Bacteria 1195
188 Ga0307416_101165431 3300032002 Bacteria 876
189 Ga0307414_10295821 3300032004 Bacteria 1367
190 Ga0307411_10145647 3300032005 Bacteria 1753
191 Ga0373940_0172040 3300035088 Bacteria 700
192 Ga0373946_0061970 3300035171 Bacteria 1594
193 Ga0316574_0005714 3300035398 Bacteria 6659
194 Ga0316574_0116572 3300035398 Bacteria 1713
195 Ga0373935_0332713 3300035692 Bacteria 1080
196 Ga0373927_0091546 3300035695 Bacteria 1975
197 Ga0373925_0043807 3300037068 Bacteria 3322
198 Ga0373925_0457871 3300037068 Bacteria 1045
199 Ga0395899_0140276 3300037312 Bacteria 1720
200 Ga0395900_0011283 3300037418 Bacteria 9139
201 Ga0395900_0069037 3300037418 Bacteria 3632
202 Ga0395900_0209166 3300037418 Bacteria 1971
203 Ga0395905_0000180 3300037471 Bacteria 100693
204 Ga0395905_0017966 3300037471 Bacteria 6715
205 Ga0395905_0020542 3300037471 Bacteria 6254
206 Ga0395905_0088180 3300037471 Bacteria 2908
207 Ga0395905_0093805 3300037471 Bacteria 2815
208 Ga0395905_0238512 3300037471 Bacteria 1699
209 Ga0395905_0709462 3300037471 Bacteria 908
210 Ga0395901_0043411 3300038443 Bacteria 4663
211 Ga0395901_0063169 3300038443 Bacteria 3854
212 Ga0395901_0114758 3300038443 Bacteria 2829
213 Ga0395901_0126162 3300038443 Bacteria 2690
214 Ga0439438_017826 3300041405 Bacteria 2034
215 Ga0439438_062149 3300041405 Bacteria 934
216 Ga0439466_0012630 3300041411 Bacteria 3105
217 Ga0439465_0007963 3300041413 Bacteria 3353
218 Ga0439442_014096 3300042002 Bacteria 1645
219 Ga0439445_0001866 3300042004 Bacteria 4637
220 Ga0439432_016494 3300042006 Bacteria 2485
221 Ga0439432_074792 3300042006 Bacteria 1030
222 Ga0439449_0013646 3300042007 Bacteria 3057
223 Ga0439449_0033579 3300042007 Bacteria 1910
224 Ga0439452_002337 3300042010 Bacteria 7064
225 Ga0450891_013083 3300042129 Bacteria 777
226 Ga0450898_004787 3300042134 Bacteria 2018
227 Ga0439434_0005761 3300042435 Bacteria 3615
228 Ga0439434_0071712 3300042435 Bacteria 1091
229 Ga0451577_0009067 3300042876 Bacteria 9603
230 Ga0451577_0047982 3300042876 Bacteria 3816
231 Ga0451577_0160863 3300042876 Bacteria 2022
232 Ga0451577_0261125 3300042876 Bacteria 1568
233 Ga0451577_0433046 3300042876 Bacteria 1194
234 Ga0466965_0080436 3300044683 Bacteria 1647
235 Ga0466965_0103924 3300044683 Bacteria 1455
236 Ga0453684_0052779 3300044712 Bacteria 5312
237 Ga0453684_1696341 3300044712 Unclassified 645
238 Ga0466968_0157981 3300044735 Bacteria 1045
239 Ga0451576_0007110 3300045051 Bacteria 13517
240 Ga0451576_0060735 3300045051 Bacteria 3942
241 Ga0495650_0180486 3300046471 Bacteria 743
242 Ga0495582_0128601 3300046473 Bacteria 1430
243 Ga0495620_0075367 3300046515 Bacteria 1373
244 Ga0495631_0284307 3300046518 Bacteria 704
245 Ga0495648_0074758 3300046524 Bacteria 1951
246 Ga0495621_0012275 3300046539 Bacteria 2668
247 Ga0495621_0016293 3300046539 Bacteria 2383
248 Ga0495668_0014858 3300046616 Bacteria 4557
249 Ga0495647_0167679 3300046681 Unclassified 949
250 Ga0495647_0234956 3300046681 Bacteria 812
251 Ga0495658_0264984 3300046683 Bacteria 1082
252 Ga0495658_0265767 3300046683 Bacteria 1080
253 Ga0495624_0090752 3300046690 Bacteria 1885
254 Ga0495670_0143751 3300046691 Bacteria 1249
255 Ga0495671_0235335 3300046692 Bacteria 885
256 Ga0495581_0112247 3300047315 Bacteria 1585
257 Ga0495676_0015977 3300047321 Bacteria 6669
258 Ga0495593_0049927 3300047673 Bacteria 2218
259 Ga0495615_0018939 3300048090 Bacteria 1522
260 Ga0496101_0663237 3300048904 Bacteria 824
261 Ga0496104_0073161 3300048907 Bacteria 3260
262 Ga0496105_0073658 3300048908 Bacteria 2821
263 Ga0496108_0172676 3300048911 Bacteria 1871
264 Ga0496109_0714523 3300048912 Bacteria 940
265 Ga0496114_0347153 3300048917 Bacteria 1312
266 Ga0501294_002395 3300049517 Bacteria 1784
267 Ga0501298_004108 3300049521 Bacteria 2282
268 Ga0501300_005882 3300049523 Bacteria 1805
269 Ga0501034_0114316 3300049571 Bacteria 2688
270 Ga0501046_0586798 3300049580 Unclassified 792
271 Ga0501069_0153298 3300049585 Bacteria 1325
272 Ga0501206_004298 3300049653 Bacteria 1811
273 Ga0501080_0523310 3300049742 Bacteria 1058
274 Ga0501080_0724612 3300049742 Unclassified 876
275 Ga0501081_0008902 3300049743 Bacteria 6521
276 Ga0501276_008918 3300049773 Bacteria 823
277 Ga0501045_0005864 3300049824 Bacteria 8499
278 Ga0501045_0165855 3300049824 Bacteria 1645
279 nmdc:mga0k408_121614_c1 3300050493 Bacteria 1546
280 nmdc:mga0k408_26894_c1 3300050493 Bacteria 3264
281 nmdc:mga0k408_324407_c1 3300050493 Bacteria 919
282 nmdc:mga09592_172131_c1 3300050508 Bacteria 1872
283 nmdc:mga08y16_130_c1 3300050511 Bacteria 34016
284 nmdc:mga08y16_197018_c1 3300050511 Bacteria 2088
285 nmdc:mga0n895_53331_c1 3300050512 Bacteria 3974
286 nmdc:mga0rr50_736162_c1 3300050513 Bacteria 842
287 nmdc:mga08x19_21436_c1 3300050514 Bacteria 3988
288 nmdc:mga08x19_6538_c1 3300050514 Bacteria 3635
289 nmdc:mga0a205_19958_c1 3300050515 Bacteria 6324
290 nmdc:mga0a205_237471_c1 3300050515 Unclassified 1704
291 Ga0501084_0067210 3300054114 Bacteria 3000
292 Ga0501082_0034725 3300060353 Bacteria 4347
293 Ga0530510_0025502 3300061734 Bacteria 4227
294 2885196137 2885192300 Bacteria 5882526
295 nmdc:mga03683_133835_c1
296 Ga0007409J51694_1064309
297 Ga0065715_10236255
298 Ga0070658_10365654
299 Ga0070658_10823000
300 Ga0070676_10771470
301 Ga0070690_100524920
302 Ga0070670_100044061
303 Ga0070670_100397297
304 Ga0068869_100114259
305 Ga0070666_10367241
306 Ga0070666_10572757
307 Ga0070680_100144615
308 Ga0068868_100072394
309 Ga0068868_100456937
310 Ga0070689_100182019
311 Ga0070668_100037289
312 Ga0070669_100022109
313 Ga0070669_100163446
314 Ga0070675_100053918
315 Ga0070671_100051706
316 Ga0070673_100067717
317 Ga0070673_100634223
318 Ga0070667_100101445
319 Ga0070705_100038448
320 Ga0070694_100032177
321 Ga0070663_100245827
322 Ga0070678_100036803
323 Ga0070678_100257585
324 Ga0070678_101216512
325 Ga0068867_100000630
326 Ga0068867_100004572
327 Ga0068867_100657900
328 Ga0068867_100889193
329 Ga0070707_100885373
330 Ga0070699_100011693
331 Ga0070699_100387810
332 Ga0070679_100375095
333 Ga0070697_100116289
334 Ga0070672_100170208
335 Ga0070672_100627035
336 Ga0070686_100323887
337 Ga0070695_100223796
338 Ga0070696_100205368
339 Ga0070665_100050678
340 Ga0070665_100130393
341 Ga0070704_100369247
342 Ga0070704_100519250
343 Ga0068855_100513366
344 Ga0068856_100235855
345 Ga0068859_100080681
346 Ga0068859_100236354
347 Ga0068864_100022410
348 Ga0068864_100115669
349 Ga0068864_100118931
350 Ga0068864_100367687
351 Ga0068866_10122313
352 Ga0068861_100003806
353 Ga0068870_10118558
354 Ga0068870_10668637
355 Ga0068863_100027500
356 Ga0068863_100191380
357 Ga0068863_100225361
358 Ga0068863_100317944
359 Ga0068858_100082739
360 Ga0068858_100175204
361 Ga0068858_100247240
362 Ga0068860_100001154
363 Ga0068860_100048665
364 Ga0068860_100061276
365 Ga0068862_100004759
366 Ga0068862_100155400
367 Ga0075366_10014439
368 Ga0068871_100309652
369 Ga0068871_100466743
370 Ga0075430_100581399
371 Ga0075433_10039272
372 Ga0075434_100390116
373 Ga0075429_100418229
374 Ga0068865_100039090
375 Ga0068865_100692815
376 Ga0075436_100008330
377 Ga0075436_100040946
378 Ga0097620_100080685
379 Ga0097620_100236342
380 Ga0075435_100019017
381 Ga0105240_11084184
382 Ga0111539_10000067
383 Ga0105245_10025328
384 Ga0105243_10002283
385 Ga0105243_10048613
386 Ga0105243_10534600
387 Ga0105242_10262150
388 Ga0105248_10188650
389 Ga0105248_10824867
390 Ga0105249_10197230
391 Ga0105249_10735837
392 Ga0157374_10060544
393 Ga0157378_10084633
394 Ga0157378_10243104
395 Ga0163162_10037643
396 Ga0163162_10476713
397 Ga0163162_11521826
398 Ga0163162_11830025
399 Ga0157375_10113047
400 Ga0163163_11160090
401 Ga0157380_10006565
402 Ga0157380_10083018
403 Ga0157377_10000045
404 Ga0157379_10039191
405 Ga0157379_10177219
406 Ga0157379_10375935
407 Ga0157379_10402631
408 Ga0157379_10697556
409 Ga0163161_10009149
410 Ga0163161_10059030
411 Ga0163161_11093784
412 Ga0207656_10176277
413 Ga0207680_10502890
414 Ga0207643_10048572
415 Ga0207643_10415361
416 Ga0207705_10179346
417 Ga0207660_10446595
418 Ga0207662_10070740
419 Ga0207652_10453609
420 Ga0207681_10051536
421 Ga0207681_10307032
422 Ga0207681_10888395
423 Ga0207650_10002249
424 Ga0207650_10032155
425 Ga0207650_10339806
426 Ga0207659_10022283
427 Ga0207644_10088518
428 Ga0207644_10298435
429 Ga0207690_10309286
430 Ga0207706_10600393
431 Ga0207709_10003884
432 Ga0207709_10086316
433 Ga0207670_10149923
434 Ga0207704_10151746
435 Ga0207691_10070408
436 Ga0207691_10188367
437 Ga0207689_10273366
438 Ga0207689_10665465
439 Ga0207651_10127047
440 Ga0207712_10010461
441 Ga0207668_10057946
442 Ga0207640_10202620
443 Ga0207677_10065658
444 Ga0207677_10838998
445 Ga0207703_10288923
446 Ga0207703_10416564
447 Ga0207639_11174653
448 Ga0207678_10372654
449 Ga0207708_10495378
450 Ga0207708_10811716
451 Ga0207641_10022572
452 Ga0207648_10000976
453 Ga0207648_10001566
454 Ga0207676_10057909
455 Ga0207676_10084567
456 Ga0207676_11057774
457 Ga0207674_10341940
458 Ga0207675_100000193
459 Ga0207675_100679909
460 Ga0207683_10215038
461 Ga0207428_10000922
462 Ga0268266_10065390
463 Ga0268266_10091361
464 Ga0268265_10022462
465 Ga0268265_10151354
466 Ga0268264_10023580
467 Ga0268264_10036590
468 Ga0268264_10123357
469 Ga0307509_10155018
470 Ga0307408_100072716
471 Ga0307408_100246211
472 Ga0307408_100714710
473 Ga0307408_100753829
474 Ga0316575_10001870
475 Ga0316575_10005450
476 Ga0307406_10234346
477 Ga0307406_10627721
478 Ga0307406_10647420
479 Ga0307409_100279810
480 Ga0307416_100105274
481 Ga0307416_100583656
482 Ga0307416_101165431
483 Ga0307414_10295821
484 Ga0307411_10145647
485 Ga0373940_0172040
486 Ga0373946_0061970
487 Ga0316574_0005714
488 Ga0316574_0116572
489 Ga0373935_0332713
490 Ga0373927_0091546
491 Ga0373925_0043807
492 Ga0373925_0457871
493 Ga0395899_0140276
494 Ga0395900_0011283
495 Ga0395900_0069037
496 Ga0395900_0209166
497 Ga0395905_0000180
498 Ga0395905_0017966
499 Ga0395905_0020542
500 Ga0395905_0088180
501 Ga0395905_0093805
502 Ga0395905_0238512
503 Ga0395905_0709462
504 Ga0395901_0043411
505 Ga0395901_0063169
506 Ga0395901_0114758
507 Ga0395901_0126162
508 Ga0439438_017826
509 Ga0439438_062149
510 Ga0439466_0012630
511 Ga0439465_0007963
512 Ga0439442_014096
513 Ga0439445_0001866
514 Ga0439432_016494
515 Ga0439432_074792
516 Ga0439449_0013646
517 Ga0439449_0033579
518 Ga0439452_002337
519 Ga0450891_013083
520 Ga0450898_004787
521 Ga0439434_0005761
522 Ga0439434_0071712
523 Ga0451577_0009067
524 Ga0451577_0047982
525 Ga0451577_0160863
526 Ga0451577_0261125
527 Ga0451577_0433046
528 Ga0466965_0080436
529 Ga0466965_0103924
530 Ga0453684_0052779
531 Ga0453684_1696341
532 Ga0466968_0157981
533 Ga0451576_0007110
534 Ga0451576_0060735
535 Ga0495650_0180486
536 Ga0495582_0128601
537 Ga0495620_0075367
538 Ga0495631_0284307
539 Ga0495648_0074758
540 Ga0495621_0012275
541 Ga0495621_0016293
542 Ga0495668_0014858
543 Ga0495647_0167679
544 Ga0495647_0234956
545 Ga0495658_0264984
546 Ga0495658_0265767
547 Ga0495624_0090752
548 Ga0495670_0143751
549 Ga0495671_0235335
550 Ga0495581_0112247
551 Ga0495676_0015977
552 Ga0495593_0049927
553 Ga0495615_0018939
554 Ga0496101_0663237
555 Ga0496104_0073161
556 Ga0496105_0073658
557 Ga0496108_0172676
558 Ga0496109_0714523
559 Ga0496114_0347153
560 Ga0501294_002395
561 Ga0501298_004108
562 Ga0501300_005882
563 Ga0501034_0114316
564 Ga0501046_0586798
565 Ga0501069_0153298
566 Ga0501206_004298
567 Ga0501080_0523310
568 Ga0501080_0724612
569 Ga0501081_0008902
570 Ga0501276_008918
571 Ga0501045_0005864
572 Ga0501045_0165855
573 nmdc:mga0k408_121614_c1
574 nmdc:mga0k408_26894_c1
575 nmdc:mga0k408_324407_c1
576 nmdc:mga09592_172131_c1
577 nmdc:mga08y16_130_c1
578 nmdc:mga08y16_197018_c1
579 nmdc:mga0n895_53331_c1
580 nmdc:mga0rr50_736162_c1
581 nmdc:mga08x19_21436_c1
582 nmdc:mga08x19_6538_c1
583 nmdc:mga0a205_19958_c1
584 nmdc:mga0a205_237471_c1
585 Ga0501084_0067210
586 Ga0501082_0034725
587 Ga0530510_0025502
588 2885196137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07040

DUF1326

Protein of unknown function (DUF1326)

44

224

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fuy-assembly1.cif.gz_C structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass1 0.6668 73 118
6xkd-assembly1.cif.gz_A structure of ligand-bound mouse cgamp hydrolase enpp1 0.6462 117 146
1fo4-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase isolated from bovine milk 0.5963 55 92
6s2f-assembly1.cif.gz_D cryo-em structure of ctf18-1-8 in complex with the catalytic domain of dna polymerase epsilon (class 2) 0.5724 121 155
7scc-assembly1.cif.gz_BO t-cylinder of synechocystis pcc 6803 phycobilisome, complex with ocp - local refinement 0.5351 32 62
ID Description Score Start End Superfamily
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5798 73 118 3.30.300.20
af_Q9VJD1_430_532_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.5585 120 174 2.70.130.10
af_Q55C95_285_456_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5577 121 177 2.130.10.10
af_P27933_369_425_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.5554 119 148 2.60.40.1180
af_Q8GWH3_118_233_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.5461 120 167 2.70.130.10
ID Description Score Start End GO Terms
AF-A0A6N8IPW1-F1-model_v4 DUF1326 domain-containing protein 1.001 1 201
AF-A0A535HGQ4-F1-model_v4 DUF1326 domain-containing protein 0.9885 1 201
AF-A0A536DKA0-F1-model_v4 DUF1326 domain-containing protein 0.9872 33 201
AF-A0A7V3BIH2-F1-model_v4 DUF1326 domain-containing protein 0.986 2 201
AF-A0A838P7S2-F1-model_v4 DUF1326 domain-containing protein 0.9843 1 201

Map