F392175

General Info

Members Datasets Scaffolds Average Seq Length
294 186 588 228

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10216030|Ga0307411_102160301
Length 257
Sequence LVLKQIGAALCASALLTTIPNAQLPTTNLFGIDGSGLQVPIWPLGVWNWELAVGAAAPGSIRGRVELKQPPADLDPRPNPADLGMHAAHGATDRRRSVVYLDPAPRAAFDVREDVHARLDQRNEAFVPHVLAIVAGTTVDFPNNDRTYHNVFSLSKPRSFDLGRYAAGRSKSVRFDQPGIVRVFCDIHSHMSAFILVFSHRYFAVTDDEGRYRIDNVPPGTYTAVAWNESMPSETRRVTVGDGAEADLNFALSKKQP

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 9.52
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 18.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10216030 3300032005 Unclassified 1484
2 Ga0065712_10133517 3300005290 Bacteria 1522
3 Ga0065715_10011724 3300005293 Bacteria 2947
4 Ga0065707_10008840 3300005295 Bacteria 3146
5 Ga0070676_10086862 3300005328 Bacteria 1908
6 Ga0070683_100002575 3300005329 Bacteria 14494
7 Ga0070683_100039790 3300005329 Bacteria 4318
8 Ga0070690_100495526 3300005330 Bacteria 913
9 Ga0070670_100006769 3300005331 Bacteria 9711
10 Ga0070670_100044804 3300005331 Bacteria 3803
11 Ga0070670_100239786 3300005331 Bacteria 1579
12 Ga0070670_100362378 3300005331 Bacteria 1275
13 Ga0070677_10150740 3300005333 Bacteria 1082
14 Ga0068869_100024283 3300005334 Bacteria 4198
15 Ga0068869_100131530 3300005334 Unclassified 1924
16 Ga0068869_100281286 3300005334 Bacteria 1338
17 Ga0070666_10016342 3300005335 Bacteria 4747
18 Ga0070666_10228331 3300005335 Bacteria 1314
19 Ga0070689_100036524 3300005340 Bacteria 3758
20 Ga0070689_100153067 3300005340 Bacteria 1861
21 Ga0070691_10038049 3300005341 Bacteria 2271
22 Ga0070687_100049741 3300005343 Bacteria 2161
23 Ga0070661_100043068 3300005344 Bacteria 3297
24 Ga0070669_100231245 3300005353 Bacteria 1465
25 Ga0070669_100551666 3300005353 Unclassified 961
26 Ga0070671_100017246 3300005355 Bacteria 5846
27 Ga0070671_100060693 3300005355 Bacteria 3148
28 Ga0070671_100117953 3300005355 Unclassified 2232
29 Ga0070671_100208719 3300005355 Bacteria 1656
30 Ga0070671_100267925 3300005355 Bacteria 1452
31 Ga0070674_100013668 3300005356 Bacteria 5024
32 Ga0070674_100723844 3300005356 Unclassified 853
33 Ga0070673_100001103 3300005364 Bacteria 15474
34 Ga0070688_100256230 3300005365 Bacteria 1248
35 Ga0070688_100352439 3300005365 Bacteria 1078
36 Ga0070659_100294438 3300005366 Bacteria 1352
37 Ga0070701_10032750 3300005438 Bacteria 2590
38 Ga0070705_100009786 3300005440 Bacteria 4778
39 Ga0070663_100050314 3300005455 Bacteria 2963
40 Ga0070663_100109584 3300005455 Bacteria 2073
41 Ga0070662_100041692 3300005457 Bacteria 3276
42 Ga0070662_100157089 3300005457 Unclassified 1776
43 Ga0070662_100565193 3300005457 Unclassified 954
44 Ga0070681_10343302 3300005458 Bacteria 1403
45 Ga0068867_100001919 3300005459 Bacteria 14477
46 Ga0070685_10128348 3300005466 Bacteria 1583
47 Ga0070679_100033194 3300005530 Bacteria 5111
48 Ga0070679_100296813 3300005530 Bacteria 1567
49 Ga0070684_100000152 3300005535 Bacteria 47168
50 Ga0070684_100062296 3300005535 Bacteria 3267
51 Ga0070672_100358929 3300005543 Bacteria 1243
52 Ga0070695_100049786 3300005545 Bacteria 2683
53 Ga0070693_100051010 3300005547 Bacteria 2367
54 Ga0070665_100421306 3300005548 Bacteria 1344
55 Ga0070664_100000686 3300005564 Bacteria 25845
56 Ga0070664_100051527 3300005564 Bacteria 3485
57 Ga0070664_100272399 3300005564 Unclassified 1525
58 Ga0070664_100616980 3300005564 Bacteria 1006
59 Ga0068857_100040047 3300005577 Bacteria 4155
60 Ga0068854_100866564 3300005578 Unclassified 792
61 Ga0068856_100426017 3300005614 Unclassified 1347
62 Ga0070702_100070330 3300005615 Bacteria 2065
63 Ga0068852_100367902 3300005616 Bacteria 1408
64 Ga0068859_100199911 3300005617 Unclassified 2083
65 Ga0068870_10228517 3300005840 Bacteria 1143
66 Ga0068863_100174423 3300005841 Bacteria 2063
67 Ga0068858_100287684 3300005842 Bacteria 1566
68 Ga0068862_100095802 3300005844 Bacteria 2590
69 Ga0075364_10122863 3300006051 Bacteria 1739
70 Ga0068871_100359273 3300006358 Bacteria 1290
71 Ga0068871_100623011 3300006358 Bacteria 983
72 Ga0075428_100001411 3300006844 Bacteria 25608
73 Ga0075428_100058013 3300006844 Bacteria 4238
74 Ga0075428_100174901 3300006844 Unclassified 2326
75 Ga0075430_100001245 3300006846 Bacteria 20493
76 Ga0075430_100005905 3300006846 Bacteria 10338
77 Ga0075431_100016526 3300006847 Bacteria 7490
78 Ga0075431_100023609 3300006847 Bacteria 6294
79 Ga0075431_100054428 3300006847 Bacteria 4126
80 Ga0075431_100237280 3300006847 Bacteria 1856
81 Ga0075431_100321025 3300006847 Bacteria 1562
82 Ga0075434_100074455 3300006871 Bacteria 3389
83 Ga0075429_100031073 3300006880 Bacteria 4642
84 Ga0068865_100052314 3300006881 Bacteria 2830
85 Ga0068865_100059840 3300006881 Bacteria 2665
86 Ga0068865_100259354 3300006881 Bacteria 1375
87 Ga0068865_100870189 3300006881 Bacteria 782
88 Ga0097620_100199889 3300006931 Unclassified 2083
89 Ga0075435_100018748 3300007076 Bacteria 5271
90 Ga0105240_10062160 3300009093 Bacteria 4650
91 Ga0105240_10924178 3300009093 Bacteria 937
92 Ga0105245_10140625 3300009098 Unclassified 2273
93 Ga0105245_10439421 3300009098 Bacteria 1311
94 Ga0114129_10006660 3300009147 Bacteria 16404
95 Ga0114129_10019034 3300009147 Bacteria 9780
96 Ga0114129_10061346 3300009147 Bacteria 5254
97 Ga0114129_10162701 3300009147 Bacteria 3047
98 Ga0105243_10827164 3300009148 Bacteria 915
99 Ga0105241_10222782 3300009174 Bacteria 1586
100 Ga0105241_10240761 3300009174 Bacteria 1529
101 Ga0105242_10049952 3300009176 Bacteria 3405
102 Ga0105248_10007841 3300009177 Bacteria 11727
103 Ga0105248_10074901 3300009177 Bacteria 3804
104 Ga0105248_10769507 3300009177 Bacteria 1086
105 Ga0105238_10286432 3300009551 Unclassified 1629
106 Ga0105249_10299135 3300009553 Bacteria 1613
107 Ga0105249_10438083 3300009553 Bacteria 1344
108 Ga0105249_10724533 3300009553 Bacteria 1056
109 Ga0105239_11062228 3300010375 Bacteria 932
110 Ga0105246_10822122 3300011119 Bacteria 826
111 Ga0157374_10099182 3300013296 Bacteria 2790
112 Ga0157378_10134378 3300013297 Bacteria 2292
113 Ga0163162_10257942 3300013306 Bacteria 1875
114 Ga0157372_10415659 3300013307 Bacteria 1567
115 Ga0157375_10415939 3300013308 Bacteria 1511
116 Ga0163163_10020573 3300014325 Bacteria 6218
117 Ga0163163_10023862 3300014325 Bacteria 5813
118 Ga0157376_10073640 3300014969 Unclassified 2909
119 Ga0157376_10540124 3300014969 Bacteria 1152
120 Ga0207697_10022792 3300025315 Bacteria 2564
121 Ga0207682_10104820 3300025893 Bacteria 1240
122 Ga0207688_10060840 3300025901 Bacteria 2128
123 Ga0207680_10119897 3300025903 Bacteria 1719
124 Ga0207645_10002734 3300025907 Bacteria 13735
125 Ga0207645_10203220 3300025907 Bacteria 1304
126 Ga0207707_10279369 3300025912 Bacteria 1446
127 Ga0207662_10010224 3300025918 Bacteria 5175
128 Ga0207649_10046890 3300025920 Bacteria 2657
129 Ga0207652_10045864 3300025921 Bacteria 3727
130 Ga0207681_10245697 3300025923 Bacteria 1395
131 Ga0207694_10199003 3300025924 Unclassified 1630
132 Ga0207650_10051794 3300025925 Bacteria 3039
133 Ga0207650_10112547 3300025925 Bacteria 2109
134 Ga0207650_10202010 3300025925 Bacteria 1593
135 Ga0207650_10313407 3300025925 Bacteria 1284
136 Ga0207644_10080804 3300025931 Bacteria 2401
137 Ga0207644_10087440 3300025931 Bacteria 2316
138 Ga0207644_10120332 3300025931 Bacteria 1998
139 Ga0207690_10108171 3300025932 Bacteria 1998
140 Ga0207706_10014227 3300025933 Bacteria 7213
141 Ga0207706_10341133 3300025933 Unclassified 1303
142 Ga0207670_10062087 3300025936 Bacteria 2552
143 Ga0207670_10165530 3300025936 Unclassified 1654
144 Ga0207669_10153725 3300025937 Bacteria 1615
145 Ga0207704_10109290 3300025938 Bacteria 1865
146 Ga0207704_10124298 3300025938 Bacteria 1773
147 Ga0207704_10211572 3300025938 Bacteria 1428
148 Ga0207691_10016556 3300025940 Bacteria 6999
149 Ga0207711_10035938 3300025941 Bacteria 4201
150 Ga0207711_10060211 3300025941 Bacteria 3271
151 Ga0207711_10741409 3300025941 Bacteria 916
152 Ga0207689_10015731 3300025942 Bacteria 6406
153 Ga0207689_10372124 3300025942 Bacteria 1189
154 Ga0207661_10002069 3300025944 Bacteria 13800
155 Ga0207661_10015620 3300025944 Bacteria 5592
156 Ga0207661_10300855 3300025944 Bacteria 1438
157 Ga0207679_10000849 3300025945 Bacteria 19640
158 Ga0207679_10180696 3300025945 Bacteria 1745
159 Ga0207679_10535290 3300025945 Unclassified 1049
160 Ga0207651_10002369 3300025960 Bacteria 8988
161 Ga0207651_10080493 3300025960 Bacteria 2345
162 Ga0207712_10206202 3300025961 Bacteria 1562
163 Ga0207712_10456616 3300025961 Bacteria 1084
164 Ga0207677_10378517 3300026023 Bacteria 1194
165 Ga0207703_10049734 3300026035 Bacteria 3389
166 Ga0207678_10131652 3300026067 Bacteria 2134
167 Ga0207678_10144978 3300026067 Bacteria 2027
168 Ga0207708_10006807 3300026075 Bacteria 8454
169 Ga0207702_10262510 3300026078 Unclassified 1627
170 Ga0207641_10344955 3300026088 Bacteria 1418
171 Ga0207648_10005485 3300026089 Bacteria 12779
172 Ga0207648_10256516 3300026089 Bacteria 1559
173 Ga0207676_10366278 3300026095 Bacteria 1337
174 Ga0207674_10045483 3300026116 Bacteria 4515
175 Ga0207675_100213439 3300026118 Bacteria 1857
176 Ga0207698_10375468 3300026142 Unclassified 1351
177 Ga0207698_10478487 3300026142 Bacteria 1207
178 Ga0268266_10310409 3300028379 Bacteria 1474
179 Ga0307408_100328486 3300031548 Unclassified 1291
180 Ga0307405_10028959 3300031731 Bacteria 3232
181 Ga0307405_10282042 3300031731 Unclassified 1251
182 Ga0307413_10008386 3300031824 Bacteria 4877
183 Ga0307406_10394489 3300031901 Unclassified 1095
184 Ga0307416_100251698 3300032002 Unclassified 1720
185 Ga0307416_100572176 3300032002 Bacteria 1206
186 Ga0307415_100017274 3300032126 Bacteria 4323
187 Ga0373943_0016949 3300035170 Bacteria 3331
188 Ga0373955_0098877 3300035172 Bacteria 1672
189 Ga0373962_0058669 3300035242 Unclassified 1126
190 Ga0373937_0044494 3300036401 Bacteria 4055
191 Ga0373937_0092384 3300036401 Bacteria 2805
192 Ga0373925_0246457 3300037068 Bacteria 1432
193 Ga0373925_0403559 3300037068 Bacteria 1115
194 Ga0395901_1135540 3300038443 Unclassified 750
195 Ga0451793_0902529 3300041452 Bacteria 1108
196 Ga0439446_0016054 3300042156 Bacteria 2083
197 Ga0439460_0018807 3300042461 Bacteria 1864
198 Ga0439460_0037820 3300042461 Bacteria 1405
199 Ga0451577_0015025 3300042876 Bacteria 7204
200 Ga0453684_0199839 3300044712 Bacteria 2331
201 Ga0451576_0313589 3300045051 Unclassified 1641
202 Ga0451576_0515664 3300045051 Unclassified 1256
203 Ga0495608_0357901 3300046511 Unclassified 897
204 Ga0495667_0291590 3300046559 Bacteria 1034
205 Ga0495635_0092178 3300046663 Bacteria 2072
206 Ga0495658_0094764 3300046683 Unclassified 1773
207 Ga0495613_0059191 3300046689 Bacteria 2809
208 Ga0495674_0171210 3300047319 Bacteria 1812
209 Ga0495684_0178760 3300047471 Unclassified 1574
210 Ga0496101_0635889 3300048904 Bacteria 843
211 Ga0496102_0022260 3300048905 Bacteria 5615
212 Ga0496103_0039115 3300048906 Unclassified 2914
213 Ga0496104_0005090 3300048907 Bacteria 11468
214 Ga0496104_0030980 3300048907 Bacteria 4972
215 Ga0496104_0249242 3300048907 Bacteria 1689
216 Ga0496105_0015107 3300048908 Bacteria 6145
217 Ga0496105_0061334 3300048908 Bacteria 3103
218 Ga0496106_0020733 3300048909 Bacteria 4878
219 Ga0496107_0425591 3300048910 Bacteria 987
220 Ga0496108_0001373 3300048911 Bacteria 19156
221 Ga0496109_0001103 3300048912 Bacteria 22385
222 Ga0496109_0194175 3300048912 Unclassified 1907
223 Ga0496109_0288431 3300048912 Bacteria 1547
224 Ga0496109_0481984 3300048912 Bacteria 1171
225 Ga0496110_0000490 3300048913 Bacteria 26916
226 Ga0496110_0049201 3300048913 Bacteria 3697
227 Ga0496110_0165368 3300048913 Bacteria 2006
228 Ga0496111_0001524 3300048914 Bacteria 13299
229 Ga0496112_0000535 3300048915 Bacteria 26020
230 Ga0496112_0085568 3300048915 Bacteria 3119
231 Ga0496112_0104198 3300048915 Bacteria 2807
232 Ga0496112_0211339 3300048915 Bacteria 1897
233 Ga0496113_0318986 3300048916 Unclassified 1245
234 Ga0496114_0006158 3300048917 Bacteria 9439
235 Ga0496114_0359757 3300048917 Bacteria 1287
236 Ga0496115_0021096 3300048918 Bacteria 5028
237 Ga0501034_0484807 3300049571 Unclassified 1151
238 Ga0501036_0119443 3300049572 Unclassified 2226
239 Ga0501039_0115291 3300049575 Unclassified 2103
240 Ga0501040_0010283 3300049576 Bacteria 6120
241 Ga0501040_0071168 3300049576 Bacteria 2401
242 Ga0501041_0076821 3300049577 Bacteria 2054
243 Ga0501042_0022713 3300049578 Bacteria 4383
244 Ga0501042_0042349 3300049578 Unclassified 3241
245 Ga0501046_0072500 3300049580 Bacteria 2674
246 Ga0501047_0019000 3300049581 Bacteria 6593
247 Ga0501048_0032303 3300049582 Bacteria 3783
248 Ga0501048_0040599 3300049582 Unclassified 3334
249 Ga0501068_0238171 3300049584 Bacteria 1158
250 Ga0501068_0311688 3300049584 Bacteria 1008
251 Ga0501069_0178513 3300049585 Bacteria 1227
252 Ga0501071_0004724 3300049587 Bacteria 8663
253 Ga0501071_0015122 3300049587 Bacteria 5293
254 Ga0501071_0238692 3300049587 Bacteria 1370
255 Ga0501071_0289661 3300049587 Bacteria 1240
256 Ga0501072_0103562 3300049588 Unclassified 2262
257 Ga0501075_0048747 3300049591 Unclassified 3183
258 Ga0501075_0196022 3300049591 Bacteria 1540
259 Ga0501076_0003921 3300049592 Bacteria 10493
260 Ga0501076_0474124 3300049592 Bacteria 1031
261 Ga0501079_0027355 3300049741 Bacteria 4372
262 Ga0501080_0161707 3300049742 Unclassified 2068
263 Ga0501081_0077981 3300049743 Bacteria 2316
264 Ga0501081_0584581 3300049743 Bacteria 835
265 Ga0501045_0133235 3300049824 Bacteria 1847
266 nmdc:mga03n38_136226_c1 3300050490 Bacteria 1222
267 nmdc:mga00v17_85935_c1 3300050491 Bacteria 1970
268 nmdc:mga0yw44_18391_c1 3300050492 Bacteria 3826
269 nmdc:mga05p37_112755_c1 3300050507 Unclassified 3344
270 nmdc:mga05p37_44387_c1 3300050507 Bacteria 5468
271 nmdc:mga05p37_6916_c1 3300050507 Bacteria 13371
272 nmdc:mga09592_29546_c1 3300050508 Bacteria 4558
273 nmdc:mga09592_34138_c1 3300050508 Bacteria 4252
274 nmdc:mga0qj67_303317_c1 3300050509 Unclassified 1294
275 nmdc:mga0qj67_49243_c1 3300050509 Unclassified 3331
276 nmdc:mga06r32_104132_c1 3300050510 Unclassified 2787
277 nmdc:mga06r32_186490_c1 3300050510 Unclassified 2061
278 nmdc:mga06r32_201485_c1 3300050510 Unclassified 1978
279 nmdc:mga06r32_331821_c1 3300050510 Bacteria 1506
280 nmdc:mga06r32_374109_c1 3300050510 Bacteria 1408
281 nmdc:mga08y16_492951_c1 3300050511 Unclassified 1246
282 nmdc:mga0n895_76544_c1 3300050512 Bacteria 3327
283 nmdc:mga0rr50_163932_c1 3300050513 Unclassified 1806
284 nmdc:mga0rr50_8261_c1 3300050513 Bacteria 6471
285 Ga0495601_0030920 3300053077 Bacteria 3327
286 Ga0495601_0066588 3300053077 Bacteria 2293
287 Ga0495595_0005858 3300053084 Bacteria 4981
288 Ga0495619_0015923 3300053085 Bacteria 4762
289 Ga0501084_0023795 3300054114 Bacteria 5109
290 Ga0590077_005564 3300059426 Unclassified 2579
291 Ga0501082_0044043 3300060353 Bacteria 3850
292 Ga0530510_0150034 3300061734 Bacteria 1721
293 Ga0530510_0168950 3300061734 Unclassified 1620
294 Ga0530510_0640164 3300061734 Bacteria 809
295 Ga0307411_10216030
296 Ga0065712_10133517
297 Ga0065715_10011724
298 Ga0065707_10008840
299 Ga0070676_10086862
300 Ga0070683_100002575
301 Ga0070683_100039790
302 Ga0070690_100495526
303 Ga0070670_100006769
304 Ga0070670_100044804
305 Ga0070670_100239786
306 Ga0070670_100362378
307 Ga0070677_10150740
308 Ga0068869_100024283
309 Ga0068869_100131530
310 Ga0068869_100281286
311 Ga0070666_10016342
312 Ga0070666_10228331
313 Ga0070689_100036524
314 Ga0070689_100153067
315 Ga0070691_10038049
316 Ga0070687_100049741
317 Ga0070661_100043068
318 Ga0070669_100231245
319 Ga0070669_100551666
320 Ga0070671_100017246
321 Ga0070671_100060693
322 Ga0070671_100117953
323 Ga0070671_100208719
324 Ga0070671_100267925
325 Ga0070674_100013668
326 Ga0070674_100723844
327 Ga0070673_100001103
328 Ga0070688_100256230
329 Ga0070688_100352439
330 Ga0070659_100294438
331 Ga0070701_10032750
332 Ga0070705_100009786
333 Ga0070663_100050314
334 Ga0070663_100109584
335 Ga0070662_100041692
336 Ga0070662_100157089
337 Ga0070662_100565193
338 Ga0070681_10343302
339 Ga0068867_100001919
340 Ga0070685_10128348
341 Ga0070679_100033194
342 Ga0070679_100296813
343 Ga0070684_100000152
344 Ga0070684_100062296
345 Ga0070672_100358929
346 Ga0070695_100049786
347 Ga0070693_100051010
348 Ga0070665_100421306
349 Ga0070664_100000686
350 Ga0070664_100051527
351 Ga0070664_100272399
352 Ga0070664_100616980
353 Ga0068857_100040047
354 Ga0068854_100866564
355 Ga0068856_100426017
356 Ga0070702_100070330
357 Ga0068852_100367902
358 Ga0068859_100199911
359 Ga0068870_10228517
360 Ga0068863_100174423
361 Ga0068858_100287684
362 Ga0068862_100095802
363 Ga0075364_10122863
364 Ga0068871_100359273
365 Ga0068871_100623011
366 Ga0075428_100001411
367 Ga0075428_100058013
368 Ga0075428_100174901
369 Ga0075430_100001245
370 Ga0075430_100005905
371 Ga0075431_100016526
372 Ga0075431_100023609
373 Ga0075431_100054428
374 Ga0075431_100237280
375 Ga0075431_100321025
376 Ga0075434_100074455
377 Ga0075429_100031073
378 Ga0068865_100052314
379 Ga0068865_100059840
380 Ga0068865_100259354
381 Ga0068865_100870189
382 Ga0097620_100199889
383 Ga0075435_100018748
384 Ga0105240_10062160
385 Ga0105240_10924178
386 Ga0105245_10140625
387 Ga0105245_10439421
388 Ga0114129_10006660
389 Ga0114129_10019034
390 Ga0114129_10061346
391 Ga0114129_10162701
392 Ga0105243_10827164
393 Ga0105241_10222782
394 Ga0105241_10240761
395 Ga0105242_10049952
396 Ga0105248_10007841
397 Ga0105248_10074901
398 Ga0105248_10769507
399 Ga0105238_10286432
400 Ga0105249_10299135
401 Ga0105249_10438083
402 Ga0105249_10724533
403 Ga0105239_11062228
404 Ga0105246_10822122
405 Ga0157374_10099182
406 Ga0157378_10134378
407 Ga0163162_10257942
408 Ga0157372_10415659
409 Ga0157375_10415939
410 Ga0163163_10020573
411 Ga0163163_10023862
412 Ga0157376_10073640
413 Ga0157376_10540124
414 Ga0207697_10022792
415 Ga0207682_10104820
416 Ga0207688_10060840
417 Ga0207680_10119897
418 Ga0207645_10002734
419 Ga0207645_10203220
420 Ga0207707_10279369
421 Ga0207662_10010224
422 Ga0207649_10046890
423 Ga0207652_10045864
424 Ga0207681_10245697
425 Ga0207694_10199003
426 Ga0207650_10051794
427 Ga0207650_10112547
428 Ga0207650_10202010
429 Ga0207650_10313407
430 Ga0207644_10080804
431 Ga0207644_10087440
432 Ga0207644_10120332
433 Ga0207690_10108171
434 Ga0207706_10014227
435 Ga0207706_10341133
436 Ga0207670_10062087
437 Ga0207670_10165530
438 Ga0207669_10153725
439 Ga0207704_10109290
440 Ga0207704_10124298
441 Ga0207704_10211572
442 Ga0207691_10016556
443 Ga0207711_10035938
444 Ga0207711_10060211
445 Ga0207711_10741409
446 Ga0207689_10015731
447 Ga0207689_10372124
448 Ga0207661_10002069
449 Ga0207661_10015620
450 Ga0207661_10300855
451 Ga0207679_10000849
452 Ga0207679_10180696
453 Ga0207679_10535290
454 Ga0207651_10002369
455 Ga0207651_10080493
456 Ga0207712_10206202
457 Ga0207712_10456616
458 Ga0207677_10378517
459 Ga0207703_10049734
460 Ga0207678_10131652
461 Ga0207678_10144978
462 Ga0207708_10006807
463 Ga0207702_10262510
464 Ga0207641_10344955
465 Ga0207648_10005485
466 Ga0207648_10256516
467 Ga0207676_10366278
468 Ga0207674_10045483
469 Ga0207675_100213439
470 Ga0207698_10375468
471 Ga0207698_10478487
472 Ga0268266_10310409
473 Ga0307408_100328486
474 Ga0307405_10028959
475 Ga0307405_10282042
476 Ga0307413_10008386
477 Ga0307406_10394489
478 Ga0307416_100251698
479 Ga0307416_100572176
480 Ga0307415_100017274
481 Ga0373943_0016949
482 Ga0373955_0098877
483 Ga0373962_0058669
484 Ga0373937_0044494
485 Ga0373937_0092384
486 Ga0373925_0246457
487 Ga0373925_0403559
488 Ga0395901_1135540
489 Ga0451793_0902529
490 Ga0439446_0016054
491 Ga0439460_0018807
492 Ga0439460_0037820
493 Ga0451577_0015025
494 Ga0453684_0199839
495 Ga0451576_0313589
496 Ga0451576_0515664
497 Ga0495608_0357901
498 Ga0495667_0291590
499 Ga0495635_0092178
500 Ga0495658_0094764
501 Ga0495613_0059191
502 Ga0495674_0171210
503 Ga0495684_0178760
504 Ga0496101_0635889
505 Ga0496102_0022260
506 Ga0496103_0039115
507 Ga0496104_0005090
508 Ga0496104_0030980
509 Ga0496104_0249242
510 Ga0496105_0015107
511 Ga0496105_0061334
512 Ga0496106_0020733
513 Ga0496107_0425591
514 Ga0496108_0001373
515 Ga0496109_0001103
516 Ga0496109_0194175
517 Ga0496109_0288431
518 Ga0496109_0481984
519 Ga0496110_0000490
520 Ga0496110_0049201
521 Ga0496110_0165368
522 Ga0496111_0001524
523 Ga0496112_0000535
524 Ga0496112_0085568
525 Ga0496112_0104198
526 Ga0496112_0211339
527 Ga0496113_0318986
528 Ga0496114_0006158
529 Ga0496114_0359757
530 Ga0496115_0021096
531 Ga0501034_0484807
532 Ga0501036_0119443
533 Ga0501039_0115291
534 Ga0501040_0010283
535 Ga0501040_0071168
536 Ga0501041_0076821
537 Ga0501042_0022713
538 Ga0501042_0042349
539 Ga0501046_0072500
540 Ga0501047_0019000
541 Ga0501048_0032303
542 Ga0501048_0040599
543 Ga0501068_0238171
544 Ga0501068_0311688
545 Ga0501069_0178513
546 Ga0501071_0004724
547 Ga0501071_0015122
548 Ga0501071_0238692
549 Ga0501071_0289661
550 Ga0501072_0103562
551 Ga0501075_0048747
552 Ga0501075_0196022
553 Ga0501076_0003921
554 Ga0501076_0474124
555 Ga0501079_0027355
556 Ga0501080_0161707
557 Ga0501081_0077981
558 Ga0501081_0584581
559 Ga0501045_0133235
560 nmdc:mga03n38_136226_c1
561 nmdc:mga00v17_85935_c1
562 nmdc:mga0yw44_18391_c1
563 nmdc:mga05p37_112755_c1
564 nmdc:mga05p37_44387_c1
565 nmdc:mga05p37_6916_c1
566 nmdc:mga09592_29546_c1
567 nmdc:mga09592_34138_c1
568 nmdc:mga0qj67_303317_c1
569 nmdc:mga0qj67_49243_c1
570 nmdc:mga06r32_104132_c1
571 nmdc:mga06r32_186490_c1
572 nmdc:mga06r32_201485_c1
573 nmdc:mga06r32_331821_c1
574 nmdc:mga06r32_374109_c1
575 nmdc:mga08y16_492951_c1
576 nmdc:mga0n895_76544_c1
577 nmdc:mga0rr50_163932_c1
578 nmdc:mga0rr50_8261_c1
579 Ga0495601_0030920
580 Ga0495601_0066588
581 Ga0495595_0005858
582 Ga0495619_0015923
583 Ga0501084_0023795
584 Ga0590077_005564
585 Ga0501082_0044043
586 Ga0530510_0150034
587 Ga0530510_0168950
588 Ga0530510_0640164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14686

fn3_3

Polysaccharide lyase family 4, domain II

197

248

0.93

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

192

253

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fc9-assembly1.cif.gz_D novel purple cupredoxin from nitrosopumilus maritimus 0.9101 98 178
2cj3-assembly2.cif.gz_B crystal structure of plastocyanin from a cyanobacterium, anabaena variabilis 0.8882 97 178
1jxg-assembly2.cif.gz_B the 1.6 a resolution crystal structure of a mutant poplar plastocyanin bearing a 21-25 engeneered disulfide bridge 0.8825 98 178
1byo-assembly2.cif.gz_B wild-type plastocyanin from silene 0.8823 98 178
7pcy-assembly1.cif.gz_A the crystal structure of plastocyanin from a green alga, enteromorpha prolifera 0.8786 98 178
ID Description Score Start End Superfamily
5fc9B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9101 98 178 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8903 94 178 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8696 94 178 2.60.40.420
1b3iA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8591 97 178 2.60.40.420
1jxdA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.857 97 178 2.60.40.420
ID Description Score Start End GO Terms
AF-M6YB04-F1-model_v4 Blue (type 1) copper domain-containing protein 0.9787 92 178 GO:0005507
GO:0009055
AF-A0A1I4BYP3-F1-model_v4 Copper binding protein, plastocyanin/azurin family 0.9631 100 178 GO:0005507
GO:0009055
GO:0042597
AF-A0A537S3Y7-F1-model_v4 EfeO-type cupredoxin-like domain-containing protein 0.9627 94 178 GO:0016020
AF-A0A0N0KAZ0-F1-model_v4 Cytochrome c domain-containing protein 0.9593 97 179 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A1G9YMV9-F1-model_v4 Plastocyanin 0.9583 96 179

Map