F392105

General Info

Members Datasets Scaffolds Average Seq Length
294 211 588 319

Family's Representative Sequence

Representative Sequence 3300022734|Ga0224571_100043|Ga0224571_1000433
Length 363
Sequence VFFAFAIWKYHGPISRAMSNRFHILAVCRVVQSGSDSDTKGSQMETHQLGTSDLRITRLGIGAWAIGGSGWSGSMGPQNESDSIPAIHAALDHGLNWIDTAALYGLGHSEEVIARALRGRVPRPYIFTKCERVWDASGTIGACLKAASIRKECEDSLRRLQADVIDLYQIHWPEPDENIEEAWTELARLKQEGKVRYIGVSNFNVSQMKRAQSIAPITSLQPPYSIVTRETEKEILPFALQNNIGVIVYSPMSAGLLTGAMTRERVANFAIEDWRKNLPNFQEPLLSRNLKLVECLREIGTRHRLTPGEVAIAWTLKNPAVTGAIVGFRNPKQVSGIIGAAEFVLPPAEMAEIEDALKRERAN

Samples

Sample ID Description Type Environment
1 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
82 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
209 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
210 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
211 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.9
Metatranscriptomes 3.74
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 3.06
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 12.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224571_100043 3300022734 Unclassified 4173
2 Ga0065707_10000895 3300005295 Bacteria 13258
3 Ga0065707_10014554 3300005295 Bacteria 1878
4 Ga0070676_10032234 3300005328 Bacteria 3001
5 Ga0070666_10027829 3300005335 Bacteria 3705
6 Ga0070680_100128758 3300005336 Bacteria 2116
7 Ga0068868_100033771 3300005338 Bacteria 3946
8 Ga0068868_100050088 3300005338 Unclassified 3279
9 Ga0070660_100012289 3300005339 Bacteria 6110
10 Ga0070668_100009460 3300005347 Bacteria 7228
11 Ga0070675_100299478 3300005354 Unclassified 1416
12 Ga0070673_100336630 3300005364 Unclassified 1336
13 Ga0070659_100023238 3300005366 Bacteria 4742
14 Ga0070667_100015128 3300005367 Bacteria 6372
15 Ga0070709_10159891 3300005434 Unclassified 1565
16 Ga0070714_100017523 3300005435 Bacteria 5804
17 Ga0070714_100072761 3300005435 Unclassified 2976
18 Ga0070714_100259467 3300005435 Bacteria 1609
19 Ga0070713_100000118 3300005436 Bacteria 51698
20 Ga0070713_100011120 3300005436 Bacteria 6539
21 Ga0070710_10030412 3300005437 Bacteria 2905
22 Ga0070711_100004251 3300005439 Bacteria 8419
23 Ga0070708_100164530 3300005445 Bacteria 2069
24 Ga0070663_100157646 3300005455 Bacteria 1745
25 Ga0070662_100027216 3300005457 Bacteria 3966
26 Ga0070681_10082805 3300005458 Bacteria 3163
27 Ga0068867_100235758 3300005459 Unclassified 1481
28 Ga0070685_10122022 3300005466 Bacteria 1619
29 Ga0070706_100121404 3300005467 Bacteria 2435
30 Ga0070684_100017847 3300005535 Bacteria 5832
31 Ga0070697_100078296 3300005536 Bacteria 2720
32 Ga0070697_100097981 3300005536 Unclassified 2434
33 Ga0070697_100532137 3300005536 Bacteria 1030
34 Ga0070695_100177332 3300005545 Bacteria 1507
35 Ga0070665_100005355 3300005548 Bacteria 13256
36 Ga0070704_100028466 3300005549 Bacteria 3718
37 Ga0068857_100120339 3300005577 Bacteria 2363
38 Ga0068854_100027794 3300005578 Bacteria 3902
39 Ga0068854_100106643 3300005578 Bacteria 2108
40 Ga0068856_100000347 3300005614 Bacteria 50484
41 Ga0068856_100024254 3300005614 Bacteria 5902
42 Ga0068852_100026895 3300005616 Bacteria 4682
43 Ga0068859_100459990 3300005617 Bacteria 1368
44 Ga0068861_100196064 3300005719 Bacteria 1692
45 Ga0068851_10013811 3300005834 Bacteria 3824
46 Ga0068858_100103713 3300005842 Bacteria 2653
47 Ga0068860_100177182 3300005843 Bacteria 2060
48 Ga0068860_100409004 3300005843 Bacteria 1343
49 Ga0068862_100192724 3300005844 Bacteria 1835
50 Ga0070717_10001647 3300006028 Bacteria 15524
51 Ga0070717_10030480 3300006028 Bacteria 4334
52 Ga0070717_10056787 3300006028 Bacteria 3235
53 Ga0075364_10090140 3300006051 Bacteria 2034
54 Ga0070716_100211832 3300006173 Unclassified 1295
55 Ga0070712_100000292 3300006175 Bacteria 28152
56 Ga0070712_100001749 3300006175 Bacteria 13283
57 Ga0097621_100338828 3300006237 Bacteria 1335
58 Ga0075431_100019857 3300006847 Bacteria 6861
59 Ga0075434_100004590 3300006871 Bacteria 12474
60 Ga0075434_100069322 3300006871 Bacteria 3516
61 Ga0075434_100230868 3300006871 Unclassified 1870
62 Ga0075429_100213414 3300006880 Bacteria 1691
63 Ga0068865_100401550 3300006881 Bacteria 1123
64 Ga0075436_100168716 3300006914 Bacteria 1545
65 Ga0097620_100459991 3300006931 Bacteria 1368
66 Ga0075435_100002601 3300007076 Bacteria 12044
67 Ga0105240_10000028 3300009093 Bacteria 347789
68 Ga0105240_10125431 3300009093 Bacteria 3086
69 Ga0105240_10283524 3300009093 Bacteria 1902
70 Ga0105245_10003276 3300009098 Bacteria 14530
71 Ga0114129_10093779 3300009147 Unclassified 4158
72 Ga0114129_10143615 3300009147 Bacteria 3270
73 Ga0114129_10396975 3300009147 Bacteria 1818
74 Ga0105241_10069932 3300009174 Bacteria 2722
75 Ga0105242_10408425 3300009176 Bacteria 1269
76 Ga0105242_10619296 3300009176 Bacteria 1048
77 Ga0105248_10004812 3300009177 Bacteria 14944
78 Ga0105248_10027700 3300009177 Bacteria 6310
79 Ga0105248_10087887 3300009177 Bacteria 3498
80 Ga0105237_10077320 3300009545 Bacteria 3318
81 Ga0105237_10118040 3300009545 Bacteria 2647
82 Ga0105249_10034444 3300009553 Bacteria 4589
83 Ga0105249_10251670 3300009553 Bacteria 1752
84 Ga0105246_10025324 3300011119 Bacteria 3867
85 Ga0157373_10045033 3300013100 Bacteria 3150
86 Ga0157371_10010130 3300013102 Bacteria 7365
87 Ga0157369_10026572 3300013105 Bacteria 6420
88 Ga0157369_10085360 3300013105 Bacteria 3374
89 Ga0157374_10469450 3300013296 Unclassified 1261
90 Ga0157378_10000132 3300013297 Bacteria 71918
91 Ga0157378_10291108 3300013297 Bacteria 1577
92 Ga0163162_10002572 3300013306 Bacteria 17167
93 Ga0157372_10001848 3300013307 Bacteria 22942
94 Ga0157372_10050862 3300013307 Bacteria 4609
95 Ga0157372_10060636 3300013307 Bacteria 4233
96 Ga0157380_10133183 3300014326 Bacteria 2124
97 Ga0157379_10037526 3300014968 Bacteria 4321
98 Ga0157376_10182010 3300014969 Bacteria 1922
99 Ga0206356_11042066 3300020070 Bacteria 1006
100 Ga0206349_1617908 3300020075 Bacteria 1018
101 Ga0206355_1394485 3300020076 Bacteria 999
102 Ga0206352_11333380 3300020078 Bacteria 1001
103 Ga0206350_11279949 3300020080 Bacteria 1018
104 Ga0206354_10281598 3300020081 Bacteria 1002
105 Ga0154015_1157992 3300020610 Bacteria 1015
106 Ga0213876_10141328 3300021384 Bacteria 1280
107 Ga0213875_10000038 3300021388 Bacteria 164463
108 Ga0213875_10051532 3300021388 Bacteria 1928
109 Ga0224712_10162057 3300022467 Bacteria 998
110 Ga0224572_1010261 3300024225 Unclassified 1758
111 Ga0228598_1004958 3300024227 Unclassified 2801
112 Ga0207656_10031158 3300025321 Bacteria 2207
113 Ga0207692_10063246 3300025898 Unclassified 1923
114 Ga0207680_10175072 3300025903 Bacteria 1447
115 Ga0207685_10057876 3300025905 Bacteria 1522
116 Ga0207699_10108046 3300025906 Unclassified 1778
117 Ga0207645_10003361 3300025907 Bacteria 12178
118 Ga0207654_10014244 3300025911 Bacteria 4107
119 Ga0207707_10305495 3300025912 Bacteria 1375
120 Ga0207695_10000088 3300025913 Bacteria 275833
121 Ga0207695_10016575 3300025913 Bacteria 8615
122 Ga0207695_10023825 3300025913 Bacteria 6909
123 Ga0207671_10042309 3300025914 Bacteria 3372
124 Ga0207671_10096722 3300025914 Bacteria 2231
125 Ga0207693_10000353 3300025915 Bacteria 42212
126 Ga0207693_10001160 3300025915 Bacteria 23505
127 Ga0207693_10023627 3300025915 Bacteria 4879
128 Ga0207663_10000771 3300025916 Bacteria 14321
129 Ga0207663_10003100 3300025916 Bacteria 8065
130 Ga0207663_10055371 3300025916 Bacteria 2488
131 Ga0207663_10270222 3300025916 Bacteria 1259
132 Ga0207657_10007408 3300025919 Bacteria 11251
133 Ga0207649_10018489 3300025920 Bacteria 3965
134 Ga0207652_10593921 3300025921 Bacteria 993
135 Ga0207681_10043894 3300025923 Bacteria 2994
136 Ga0207659_10209053 3300025926 Unclassified 1563
137 Ga0207687_10008899 3300025927 Bacteria 6563
138 Ga0207687_10058612 3300025927 Bacteria 2710
139 Ga0207700_10001196 3300025928 Bacteria 14929
140 Ga0207700_10011794 3300025928 Bacteria 5594
141 Ga0207700_10149864 3300025928 Bacteria 1926
142 Ga0207664_10000098 3300025929 Bacteria 80444
143 Ga0207664_10024037 3300025929 Bacteria 4575
144 Ga0207664_10095755 3300025929 Unclassified 2443
145 Ga0207664_10412256 3300025929 Unclassified 1203
146 Ga0207706_10001048 3300025933 Bacteria 28070
147 Ga0207686_10034949 3300025934 Bacteria 3013
148 Ga0207669_10374084 3300025937 Bacteria 1108
149 Ga0207665_10255203 3300025939 Unclassified 1297
150 Ga0207711_10005118 3300025941 Bacteria 11117
151 Ga0207711_10009056 3300025941 Bacteria 8317
152 Ga0207711_10224474 3300025941 Bacteria 1719
153 Ga0207689_10058147 3300025942 Bacteria 3180
154 Ga0207679_10113778 3300025945 Bacteria 2141
155 Ga0207667_10008340 3300025949 Bacteria 12322
156 Ga0207668_10009290 3300025972 Bacteria 5884
157 Ga0207640_10058418 3300025981 Bacteria 2541
158 Ga0207677_10231244 3300026023 Bacteria 1489
159 Ga0207639_10386919 3300026041 Bacteria 1257
160 Ga0207678_10002670 3300026067 Bacteria 16191
161 Ga0207678_10036949 3300026067 Unclassified 4251
162 Ga0207708_10070812 3300026075 Bacteria 2670
163 Ga0207702_10001136 3300026078 Bacteria 27202
164 Ga0207702_10126920 3300026078 Bacteria 2291
165 Ga0207648_10009381 3300026089 Bacteria 9373
166 Ga0207674_10019003 3300026116 Bacteria 7447
167 Ga0207675_100021345 3300026118 Bacteria 6033
168 Ga0207683_10028126 3300026121 Bacteria 4861
169 Ga0207698_10220224 3300026142 Bacteria 1714
170 Ga0265356_1001201 3300028017 Unclassified 3953
171 Ga0268266_10089906 3300028379 Bacteria 2690
172 Ga0268266_10247511 3300028379 Bacteria 1648
173 Ga0268265_10392486 3300028380 Bacteria 1280
174 Ga0268264_10045186 3300028381 Bacteria 3657
175 Ga0268264_10155163 3300028381 Bacteria 2057
176 Ga0265323_10009278 3300028653 Bacteria 4027
177 Ga0265338_10034651 3300028800 Bacteria 4875
178 Ga0265338_10079753 3300028800 Bacteria 2753
179 Ga0265338_10140312 3300028800 Bacteria 1894
180 Ga0265338_10156681 3300028800 Bacteria 1763
181 Ga0265338_10158349 3300028800 Bacteria 1751
182 Ga0265762_1001464 3300030760 Unclassified 4276
183 Ga0265762_1002647 3300030760 Unclassified 3212
184 Ga0265760_10000017 3300031090 Bacteria 89357
185 Ga0265332_10057095 3300031238 Unclassified 1673
186 Ga0265320_10001820 3300031240 Bacteria 15122
187 Ga0265325_10018141 3300031241 Bacteria 3903
188 Ga0265325_10036230 3300031241 Unclassified 2615
189 Ga0265329_10026245 3300031242 Bacteria 1921
190 Ga0265340_10058013 3300031247 Bacteria 1859
191 Ga0265339_10151421 3300031249 Unclassified 1172
192 Ga0265331_10000986 3300031250 Bacteria 22433
193 Ga0265316_10001581 3300031344 Bacteria 24354
194 Ga0265316_10006361 3300031344 Bacteria 11295
195 Ga0265316_10102923 3300031344 Unclassified 2169
196 Ga0265316_10127436 3300031344 Bacteria 1919
197 Ga0265316_10203556 3300031344 Unclassified 1466
198 Ga0265314_10002237 3300031711 Bacteria 20093
199 Ga0265314_10054801 3300031711 Bacteria 2757
200 Ga0316578_10067492 3300031728 Unclassified 2114
201 Ga0316214_1001926 3300033545 Bacteria 2506
202 Ga0373926_0067246 3300035083 Unclassified 1313
203 Ga0373929_0004262 3300035085 Bacteria 2566
204 Ga0373934_0000645 3300035086 Bacteria 12347
205 Ga0373934_0023816 3300035086 Bacteria 2367
206 Ga0373934_0031433 3300035086 Bacteria 2079
207 Ga0373949_0024855 3300035090 Bacteria 1395
208 Ga0373951_0039864 3300035091 Bacteria 1130
209 Ga0373923_0021367 3300035111 Bacteria 2526
210 Ga0373923_0100433 3300035111 Bacteria 1275
211 Ga0373953_0009977 3300035117 Bacteria 3292
212 Ga0373954_0009974 3300035118 Bacteria 4185
213 Ga0373956_0096857 3300035119 Bacteria 1365
214 Ga0373943_0122988 3300035170 Bacteria 1381
215 Ga0373924_0011904 3300035410 Bacteria 3240
216 Ga0373931_0006751 3300035691 Bacteria 5384
217 Ga0373935_0016532 3300035692 Bacteria 4463
218 Ga0373927_0000948 3300035695 Bacteria 22094
219 Ga0373933_0022263 3300035724 Bacteria 3607
220 Ga0373947_0020097 3300035725 Bacteria 3854
221 Ga0373937_0002587 3300036401 Bacteria 15053
222 Ga0373937_0008687 3300036401 Bacteria 8825
223 Ga0373937_0022281 3300036401 Bacteria 5695
224 Ga0373937_0368286 3300036401 Bacteria 1362
225 Ga0373925_0000822 3300037068 Bacteria 28569
226 Ga0373925_0004466 3300037068 Bacteria 10576
227 Ga0373925_0124061 3300037068 Unclassified 2008
228 Ga0373925_0143256 3300037068 Unclassified 1872
229 Ga0395905_0000116 3300037471 Bacteria 133816
230 Ga0395905_0054909 3300037471 Bacteria 3728
231 Ga0436364_0807701 3300037853 Bacteria 7295
232 Ga0436364_0991316 3300037853 Bacteria 187962
233 Ga0436364_1025752 3300037853 Bacteria 2743
234 Ga0436364_1144359 3300037853 Bacteria 3325
235 Ga0395901_0128402 3300038443 Bacteria 2665
236 Ga0436365_0429581 3300039437 Bacteria 12359
237 Ga0436360_1295512 3300039438 Bacteria 3353
238 Ga0436361_0471656 3300039447 Bacteria 2101
239 Ga0436363_0314783 3300039450 Unclassified 1668
240 Ga0439448_0036663 3300042005 Bacteria 1573
241 Ga0453683_0000963 3300044673 Bacteria 27294
242 Ga0453684_0000858 3300044712 Bacteria 102289
243 Ga0451576_0000572 3300045051 Bacteria 78655
244 Ga0451576_0396471 3300045051 Bacteria 1447
245 Ga0466958_0015553 3300045836 Bacteria 4363
246 Ga0495580_0004783 3300046472 Bacteria 11341
247 Ga0495580_0032165 3300046472 Bacteria 3787
248 Ga0495580_0135166 3300046472 Bacteria 1710
249 Ga0495584_0046036 3300046491 Unclassified 2201
250 Ga0495608_0210380 3300046511 Bacteria 1223
251 Ga0495587_0095361 3300046536 Bacteria 1717
252 Ga0495645_0002510 3300046543 Bacteria 12456
253 Ga0495645_0180622 3300046543 Bacteria 1446
254 Ga0495613_0021502 3300046689 Bacteria 4808
255 Ga0495624_0068846 3300046690 Bacteria 2206
256 Ga0495604_0102886 3300047317 Bacteria 2096
257 Ga0495604_0262635 3300047317 Bacteria 1173
258 Ga0495674_0145708 3300047319 Bacteria 1988
259 Ga0495675_0047694 3300047444 Bacteria 2725
260 Ga0495675_0122875 3300047444 Bacteria 1616
261 Ga0496101_0122147 3300048904 Bacteria 1970
262 Ga0496102_0354382 3300048905 Bacteria 1381
263 Ga0496103_0078075 3300048906 Bacteria 2079
264 Ga0496104_0111331 3300048907 Bacteria 2625
265 Ga0496104_0255796 3300048907 Bacteria 1664
266 Ga0496105_0177261 3300048908 Bacteria 1746
267 Ga0496112_0019069 3300048915 Bacteria 6466
268 Ga0496113_0298978 3300048916 Bacteria 1289
269 Ga0496115_0002037 3300048918 Bacteria 14464
270 Ga0501037_0004129 3300049573 Bacteria 10535
271 Ga0501038_0210575 3300049574 Bacteria 1555
272 Ga0501047_0038106 3300049581 Bacteria 4650
273 Ga0501070_0048351 3300049586 Bacteria 3534
274 Ga0501071_0032754 3300049587 Bacteria 3692
275 Ga0501072_0163773 3300049588 Bacteria 1774
276 Ga0501074_0140472 3300049590 Bacteria 1728
277 Ga0501075_0023177 3300049591 Bacteria 4543
278 Ga0501076_0140837 3300049592 Bacteria 1959
279 Ga0501044_0005401 3300049823 Bacteria 14194
280 nmdc:mga00v17_157358_c1 3300050491 Bacteria 1461
281 nmdc:mga06z11_49605_c1 3300050494 Bacteria 2142
282 nmdc:mga05p37_264463_c1 3300050507 Bacteria 2057
283 nmdc:mga05p37_451231_c1 3300050507 Bacteria 1488
284 nmdc:mga06r32_134095_c1 3300050510 Bacteria 2451
285 nmdc:mga0n895_56172_c1 3300050512 Unclassified 3878
286 nmdc:mga0n895_88426_c1 3300050512 Unclassified 3097
287 nmdc:mga0n895_99709_c1 3300050512 Bacteria 2913
288 nmdc:mga08x19_145193_c1 3300050514 Bacteria 1604
289 Ga0501084_0317724 3300054114 Bacteria 1315
290 Ga0530510_0058462 3300061734 Bacteria 2788
291 2673161557 2671180531 Bacteria 9045424
292 2848701171 2848694841 Bacteria 9205737
293 2913846570 2913844669 Bacteria 8381711
294 2913940351 2913939268 Bacteria 8559644
295 Ga0224571_100043
296 Ga0065707_10000895
297 Ga0065707_10014554
298 Ga0070676_10032234
299 Ga0070666_10027829
300 Ga0070680_100128758
301 Ga0068868_100033771
302 Ga0068868_100050088
303 Ga0070660_100012289
304 Ga0070668_100009460
305 Ga0070675_100299478
306 Ga0070673_100336630
307 Ga0070659_100023238
308 Ga0070667_100015128
309 Ga0070709_10159891
310 Ga0070714_100017523
311 Ga0070714_100072761
312 Ga0070714_100259467
313 Ga0070713_100000118
314 Ga0070713_100011120
315 Ga0070710_10030412
316 Ga0070711_100004251
317 Ga0070708_100164530
318 Ga0070663_100157646
319 Ga0070662_100027216
320 Ga0070681_10082805
321 Ga0068867_100235758
322 Ga0070685_10122022
323 Ga0070706_100121404
324 Ga0070684_100017847
325 Ga0070697_100078296
326 Ga0070697_100097981
327 Ga0070697_100532137
328 Ga0070695_100177332
329 Ga0070665_100005355
330 Ga0070704_100028466
331 Ga0068857_100120339
332 Ga0068854_100027794
333 Ga0068854_100106643
334 Ga0068856_100000347
335 Ga0068856_100024254
336 Ga0068852_100026895
337 Ga0068859_100459990
338 Ga0068861_100196064
339 Ga0068851_10013811
340 Ga0068858_100103713
341 Ga0068860_100177182
342 Ga0068860_100409004
343 Ga0068862_100192724
344 Ga0070717_10001647
345 Ga0070717_10030480
346 Ga0070717_10056787
347 Ga0075364_10090140
348 Ga0070716_100211832
349 Ga0070712_100000292
350 Ga0070712_100001749
351 Ga0097621_100338828
352 Ga0075431_100019857
353 Ga0075434_100004590
354 Ga0075434_100069322
355 Ga0075434_100230868
356 Ga0075429_100213414
357 Ga0068865_100401550
358 Ga0075436_100168716
359 Ga0097620_100459991
360 Ga0075435_100002601
361 Ga0105240_10000028
362 Ga0105240_10125431
363 Ga0105240_10283524
364 Ga0105245_10003276
365 Ga0114129_10093779
366 Ga0114129_10143615
367 Ga0114129_10396975
368 Ga0105241_10069932
369 Ga0105242_10408425
370 Ga0105242_10619296
371 Ga0105248_10004812
372 Ga0105248_10027700
373 Ga0105248_10087887
374 Ga0105237_10077320
375 Ga0105237_10118040
376 Ga0105249_10034444
377 Ga0105249_10251670
378 Ga0105246_10025324
379 Ga0157373_10045033
380 Ga0157371_10010130
381 Ga0157369_10026572
382 Ga0157369_10085360
383 Ga0157374_10469450
384 Ga0157378_10000132
385 Ga0157378_10291108
386 Ga0163162_10002572
387 Ga0157372_10001848
388 Ga0157372_10050862
389 Ga0157372_10060636
390 Ga0157380_10133183
391 Ga0157379_10037526
392 Ga0157376_10182010
393 Ga0206356_11042066
394 Ga0206349_1617908
395 Ga0206355_1394485
396 Ga0206352_11333380
397 Ga0206350_11279949
398 Ga0206354_10281598
399 Ga0154015_1157992
400 Ga0213876_10141328
401 Ga0213875_10000038
402 Ga0213875_10051532
403 Ga0224712_10162057
404 Ga0224572_1010261
405 Ga0228598_1004958
406 Ga0207656_10031158
407 Ga0207692_10063246
408 Ga0207680_10175072
409 Ga0207685_10057876
410 Ga0207699_10108046
411 Ga0207645_10003361
412 Ga0207654_10014244
413 Ga0207707_10305495
414 Ga0207695_10000088
415 Ga0207695_10016575
416 Ga0207695_10023825
417 Ga0207671_10042309
418 Ga0207671_10096722
419 Ga0207693_10000353
420 Ga0207693_10001160
421 Ga0207693_10023627
422 Ga0207663_10000771
423 Ga0207663_10003100
424 Ga0207663_10055371
425 Ga0207663_10270222
426 Ga0207657_10007408
427 Ga0207649_10018489
428 Ga0207652_10593921
429 Ga0207681_10043894
430 Ga0207659_10209053
431 Ga0207687_10008899
432 Ga0207687_10058612
433 Ga0207700_10001196
434 Ga0207700_10011794
435 Ga0207700_10149864
436 Ga0207664_10000098
437 Ga0207664_10024037
438 Ga0207664_10095755
439 Ga0207664_10412256
440 Ga0207706_10001048
441 Ga0207686_10034949
442 Ga0207669_10374084
443 Ga0207665_10255203
444 Ga0207711_10005118
445 Ga0207711_10009056
446 Ga0207711_10224474
447 Ga0207689_10058147
448 Ga0207679_10113778
449 Ga0207667_10008340
450 Ga0207668_10009290
451 Ga0207640_10058418
452 Ga0207677_10231244
453 Ga0207639_10386919
454 Ga0207678_10002670
455 Ga0207678_10036949
456 Ga0207708_10070812
457 Ga0207702_10001136
458 Ga0207702_10126920
459 Ga0207648_10009381
460 Ga0207674_10019003
461 Ga0207675_100021345
462 Ga0207683_10028126
463 Ga0207698_10220224
464 Ga0265356_1001201
465 Ga0268266_10089906
466 Ga0268266_10247511
467 Ga0268265_10392486
468 Ga0268264_10045186
469 Ga0268264_10155163
470 Ga0265323_10009278
471 Ga0265338_10034651
472 Ga0265338_10079753
473 Ga0265338_10140312
474 Ga0265338_10156681
475 Ga0265338_10158349
476 Ga0265762_1001464
477 Ga0265762_1002647
478 Ga0265760_10000017
479 Ga0265332_10057095
480 Ga0265320_10001820
481 Ga0265325_10018141
482 Ga0265325_10036230
483 Ga0265329_10026245
484 Ga0265340_10058013
485 Ga0265339_10151421
486 Ga0265331_10000986
487 Ga0265316_10001581
488 Ga0265316_10006361
489 Ga0265316_10102923
490 Ga0265316_10127436
491 Ga0265316_10203556
492 Ga0265314_10002237
493 Ga0265314_10054801
494 Ga0316578_10067492
495 Ga0316214_1001926
496 Ga0373926_0067246
497 Ga0373929_0004262
498 Ga0373934_0000645
499 Ga0373934_0023816
500 Ga0373934_0031433
501 Ga0373949_0024855
502 Ga0373951_0039864
503 Ga0373923_0021367
504 Ga0373923_0100433
505 Ga0373953_0009977
506 Ga0373954_0009974
507 Ga0373956_0096857
508 Ga0373943_0122988
509 Ga0373924_0011904
510 Ga0373931_0006751
511 Ga0373935_0016532
512 Ga0373927_0000948
513 Ga0373933_0022263
514 Ga0373947_0020097
515 Ga0373937_0002587
516 Ga0373937_0008687
517 Ga0373937_0022281
518 Ga0373937_0368286
519 Ga0373925_0000822
520 Ga0373925_0004466
521 Ga0373925_0124061
522 Ga0373925_0143256
523 Ga0395905_0000116
524 Ga0395905_0054909
525 Ga0436364_0807701
526 Ga0436364_0991316
527 Ga0436364_1025752
528 Ga0436364_1144359
529 Ga0395901_0128402
530 Ga0436365_0429581
531 Ga0436360_1295512
532 Ga0436361_0471656
533 Ga0436363_0314783
534 Ga0439448_0036663
535 Ga0453683_0000963
536 Ga0453684_0000858
537 Ga0451576_0000572
538 Ga0451576_0396471
539 Ga0466958_0015553
540 Ga0495580_0004783
541 Ga0495580_0032165
542 Ga0495580_0135166
543 Ga0495584_0046036
544 Ga0495608_0210380
545 Ga0495587_0095361
546 Ga0495645_0002510
547 Ga0495645_0180622
548 Ga0495613_0021502
549 Ga0495624_0068846
550 Ga0495604_0102886
551 Ga0495604_0262635
552 Ga0495674_0145708
553 Ga0495675_0047694
554 Ga0495675_0122875
555 Ga0496101_0122147
556 Ga0496102_0354382
557 Ga0496103_0078075
558 Ga0496104_0111331
559 Ga0496104_0255796
560 Ga0496105_0177261
561 Ga0496112_0019069
562 Ga0496113_0298978
563 Ga0496115_0002037
564 Ga0501037_0004129
565 Ga0501038_0210575
566 Ga0501047_0038106
567 Ga0501070_0048351
568 Ga0501071_0032754
569 Ga0501072_0163773
570 Ga0501074_0140472
571 Ga0501075_0023177
572 Ga0501076_0140837
573 Ga0501044_0005401
574 nmdc:mga00v17_157358_c1
575 nmdc:mga06z11_49605_c1
576 nmdc:mga05p37_264463_c1
577 nmdc:mga05p37_451231_c1
578 nmdc:mga06r32_134095_c1
579 nmdc:mga0n895_56172_c1
580 nmdc:mga0n895_88426_c1
581 nmdc:mga0n895_99709_c1
582 nmdc:mga08x19_145193_c1
583 Ga0501084_0317724
584 Ga0530510_0058462
585 2673161557
586 2848701171
587 2913846570
588 2913940351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

58

358

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9259 3 324
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9257 3 323
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9155 3 323
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9145 3 324
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.9014 1 323
ID Description Score Start End Superfamily
3n2tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9257 3 323 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9234 3 323 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9147 3 323 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9092 5 324 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9079 4 324 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A7Y4XCN8-F1-model_v4 Aldo/keto reductase 0.9825 186 327 GO:0005829
AF-A0A7X8FWV5-F1-model_v4 Aldo/keto reductase 0.9798 3 237 GO:0005829
GO:0016491
AF-A0A3D2J6A3-F1-model_v4 Aldo/keto reductase 0.9688 164 323 GO:0005829
AF-I4KL52-F1-model_v4 deleted 0.967 3 324
AF-A0A7X8FWV5-F1-model_v4 Aldo/keto reductase 0.967 3 237 GO:0005829
GO:0016491

Map