F391947

General Info

Members Datasets Scaffolds Average Seq Length
294 182 294 271

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100160704|Ga0070708_1001607042
Length 327
Sequence MTFDHRVKLSGSRAAPTSFLRQIVVQLDDHNHFHGFGTSDRFAVRGERAAFHSAGACMAEVFGQELLAKKNAIITGGGSGINLAIARRFAAHGASVALIGRTKEKLDSAADEIRRTGGTASGHPADVRDYDALAAAIKSAREIHGEIDLVVCGAAGNFPAPALGMSANGFKAVVDIDLLGTFNTCRAVFEHLRRPGASIINISAMQAFTPTPMQAHVCAAKAGVDMLTKCLAIEWGPDGVRVNSIAPGAVDDTEGMKRLAPTPEIQKQLTRSIPLRRFATKDEIADLALFLCSDAAKFITGAVVVCDGGQSLAGLGVNMMAAMQPRS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
168 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
169 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
170 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
181 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 3.06
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_616894 2162886012 Bacteria 2234
2 MBSR1b_contig_7724554 2162886012 Bacteria 1430
3 Ga0065715_10091158 3300005293 Bacteria 6049
4 Ga0065715_10116144 3300005293 Bacteria 2390
5 Ga0070658_10103469 3300005327 Unclassified 2355
6 Ga0070676_10015357 3300005328 Unclassified 4223
7 Ga0070676_10095165 3300005328 Bacteria 1831
8 Ga0070683_100014487 3300005329 Bacteria 6899
9 Ga0070683_100086816 3300005329 Bacteria 2933
10 Ga0070683_100247522 3300005329 Bacteria 1695
11 Ga0070683_100501864 3300005329 Bacteria 1159
12 Ga0070690_100148367 3300005330 Bacteria 1598
13 Ga0070670_100062813 3300005331 Bacteria 3188
14 Ga0070677_10061889 3300005333 Bacteria 1546
15 Ga0070680_100005081 3300005336 Bacteria 9926
16 Ga0070680_100024302 3300005336 Bacteria 4839
17 Ga0070680_100031074 3300005336 Bacteria 4292
18 Ga0070680_100046226 3300005336 Bacteria 3540
19 Ga0070680_100141061 3300005336 Bacteria 2021
20 Ga0070680_100554473 3300005336 Bacteria 985
21 Ga0070682_100002055 3300005337 Bacteria 11226
22 Ga0070682_100002665 3300005337 Bacteria 9865
23 Ga0070682_100084321 3300005337 Bacteria 2064
24 Ga0068868_100010733 3300005338 Bacteria 6640
25 Ga0070691_10060008 3300005341 Bacteria 1828
26 Ga0070661_100004725 3300005344 Bacteria 9372
27 Ga0070692_10210586 3300005345 Bacteria 1143
28 Ga0070692_10385890 3300005345 Bacteria 880
29 Ga0070668_100485652 3300005347 Bacteria 1067
30 Ga0070671_100088421 3300005355 Bacteria 2593
31 Ga0070674_100042303 3300005356 Bacteria 3094
32 Ga0070673_100051628 3300005364 Unclassified 3222
33 Ga0070673_100268049 3300005364 Bacteria 1494
34 Ga0070659_100012330 3300005366 Bacteria 6333
35 Ga0070659_100519694 3300005366 Bacteria 1016
36 Ga0070709_10135137 3300005434 Bacteria 1688
37 Ga0070709_10239695 3300005434 Bacteria 1302
38 Ga0070710_10006070 3300005437 Bacteria 5778
39 Ga0070701_10095625 3300005438 Bacteria 1636
40 Ga0070711_100418041 3300005439 Bacteria 1092
41 Ga0070694_100037860 3300005444 Bacteria 3201
42 Ga0070708_100000064 3300005445 Bacteria 69617
43 Ga0070708_100160704 3300005445 Bacteria 2093
44 Ga0070678_100044194 3300005456 Bacteria 3180
45 Ga0070662_100075666 3300005457 Bacteria 2493
46 Ga0070662_100225976 3300005457 Bacteria 1495
47 Ga0070681_10001206 3300005458 Bacteria 22475
48 Ga0070681_10139920 3300005458 Bacteria 2350
49 Ga0070681_10153898 3300005458 Bacteria 2225
50 Ga0070681_10313795 3300005458 Bacteria 1477
51 Ga0068867_100076609 3300005459 Bacteria 2511
52 Ga0068867_100153844 3300005459 Bacteria 1808
53 Ga0070706_100057268 3300005467 Bacteria 3596
54 Ga0070706_100218181 3300005467 Unclassified 1780
55 Ga0070707_100000322 3300005468 Bacteria 47149
56 Ga0070707_100097128 3300005468 Unclassified 2853
57 Ga0070707_100201952 3300005468 Unclassified 1938
58 Ga0070698_100002374 3300005471 Bacteria 20765
59 Ga0070698_100189180 3300005471 Unclassified 1996
60 Ga0070699_100067949 3300005518 Bacteria 3095
61 Ga0070699_100209878 3300005518 Unclassified 1733
62 Ga0070679_100002944 3300005530 Bacteria 15511
63 Ga0070679_100003858 3300005530 Bacteria 13769
64 Ga0070679_100018837 3300005530 Bacteria 6702
65 Ga0070679_100144925 3300005530 Bacteria 2353
66 Ga0070679_100166503 3300005530 Bacteria 2177
67 Ga0070684_100000163 3300005535 Bacteria 45728
68 Ga0070684_100060894 3300005535 Bacteria 3303
69 Ga0070684_100783939 3300005535 Bacteria 891
70 Ga0070697_100007983 3300005536 Bacteria 8253
71 Ga0070697_100026420 3300005536 Bacteria 4637
72 Ga0070697_100169511 3300005536 Archaea 1847
73 Ga0068853_100032766 3300005539 Bacteria 4404
74 Ga0070695_100007361 3300005545 Bacteria 6526
75 Ga0070695_100085945 3300005545 Bacteria 2089
76 Ga0070696_100003022 3300005546 Bacteria 11162
77 Ga0070696_100084773 3300005546 Bacteria 2248
78 Ga0070693_100129222 3300005547 Bacteria 1577
79 Ga0070693_100253037 3300005547 Bacteria 1168
80 Ga0070665_100226490 3300005548 Bacteria 1870
81 Ga0070704_100006124 3300005549 Bacteria 7064
82 Ga0070704_100064849 3300005549 Bacteria 2627
83 Ga0068855_100093825 3300005563 Bacteria 3461
84 Ga0068855_100138441 3300005563 Bacteria 2776
85 Ga0068855_100939504 3300005563 Unclassified 912
86 Ga0070664_100072951 3300005564 Bacteria 2944
87 Ga0070664_100210632 3300005564 Bacteria 1737
88 Ga0070664_100270417 3300005564 Bacteria 1531
89 Ga0068857_100002230 3300005577 Bacteria 15786
90 Ga0068856_100097298 3300005614 Bacteria 2932
91 Ga0068856_100787415 3300005614 Unclassified 971
92 Ga0068864_100125328 3300005618 Bacteria 2301
93 Ga0068866_10023011 3300005718 Bacteria 2893
94 Ga0068866_10080876 3300005718 Bacteria 1744
95 Ga0068863_100015754 3300005841 Bacteria 7259
96 Ga0070712_100389191 3300006175 Bacteria 1149
97 Ga0097621_100360085 3300006237 Bacteria 1296
98 Ga0068871_100621559 3300006358 Bacteria 984
99 Ga0075433_10007813 3300006852 Bacteria 8505
100 Ga0075434_100022846 3300006871 Bacteria 6089
101 Ga0068865_100006319 3300006881 Bacteria 7218
102 Ga0068865_100189612 3300006881 Bacteria 1589
103 Ga0075436_100004252 3300006914 Bacteria 9828
104 Ga0075436_100010659 3300006914 Bacteria 6303
105 Ga0075436_100057194 3300006914 Bacteria 2694
106 Ga0075435_100104237 3300007076 Bacteria 2353
107 Ga0105240_10007624 3300009093 Bacteria 15672
108 Ga0105240_10313632 3300009093 Bacteria 1790
109 Ga0105245_10025097 3300009098 Bacteria 5241
110 Ga0114129_10070818 3300009147 Unclassified 4863
111 Ga0105242_10105003 3300009176 Bacteria 2399
112 Ga0105248_10084436 3300009177 Bacteria 3572
113 Ga0105248_10103333 3300009177 Unclassified 3212
114 Ga0105237_10579796 3300009545 Bacteria 1129
115 Ga0157373_10174724 3300013100 Bacteria 1512
116 Ga0157373_10207659 3300013100 Unclassified 1381
117 Ga0157371_10043662 3300013102 Bacteria 3192
118 Ga0157374_10051836 3300013296 Bacteria 3819
119 Ga0157378_10029691 3300013297 Bacteria 4828
120 Ga0157378_10045963 3300013297 Bacteria 3881
121 Ga0157378_10087820 3300013297 Bacteria 2821
122 Ga0157378_10182878 3300013297 Bacteria 1973
123 Ga0157378_10361092 3300013297 Bacteria 1421
124 Ga0163162_10810934 3300013306 Bacteria 1053
125 Ga0163162_11024679 3300013306 Unclassified 934
126 Ga0157372_10003560 3300013307 Bacteria 16770
127 Ga0157372_10115589 3300013307 Bacteria 3076
128 Ga0157375_10750722 3300013308 Bacteria 1127
129 Ga0163163_10003676 3300014325 Bacteria 13054
130 Ga0163163_10009603 3300014325 Bacteria 8646
131 Ga0163163_10040203 3300014325 Bacteria 4566
132 Ga0182008_10009174 3300014497 Bacteria 5352
133 Ga0157377_10233790 3300014745 Bacteria 1183
134 Ga0157379_10151141 3300014968 Unclassified 2094
135 Ga0213872_10034072 3300021361 Bacteria 2332
136 Ga0207682_10017182 3300025893 Bacteria 2825
137 Ga0207642_10110998 3300025899 Bacteria 1396
138 Ga0207680_10056906 3300025903 Bacteria 2364
139 Ga0207699_10059775 3300025906 Bacteria 2286
140 Ga0207699_10272048 3300025906 Bacteria 1174
141 Ga0207645_10067676 3300025907 Bacteria 2283
142 Ga0207705_10345547 3300025909 Unclassified 1145
143 Ga0207684_10089289 3300025910 Bacteria 2626
144 Ga0207684_10125046 3300025910 Unclassified 2206
145 Ga0207707_10001396 3300025912 Bacteria 22390
146 Ga0207707_10012945 3300025912 Bacteria 7262
147 Ga0207707_10038666 3300025912 Bacteria 4169
148 Ga0207707_10091616 3300025912 Bacteria 2657
149 Ga0207671_10426997 3300025914 Unclassified 1054
150 Ga0207663_10027140 3300025916 Bacteria 3333
151 Ga0207663_10048695 3300025916 Bacteria 2625
152 Ga0207660_10021281 3300025917 Bacteria 4360
153 Ga0207660_10024891 3300025917 Unclassified 4056
154 Ga0207660_10036828 3300025917 Bacteria 3403
155 Ga0207660_10082036 3300025917 Bacteria 2371
156 Ga0207662_10168489 3300025918 Bacteria 1403
157 Ga0207649_10083877 3300025920 Bacteria 2069
158 Ga0207649_10179763 3300025920 Bacteria 1480
159 Ga0207652_10002725 3300025921 Bacteria 14819
160 Ga0207652_10003141 3300025921 Bacteria 13758
161 Ga0207652_10113732 3300025921 Bacteria 2403
162 Ga0207652_10201887 3300025921 Bacteria 1789
163 Ga0207646_10003365 3300025922 Bacteria 18116
164 Ga0207646_10109585 3300025922 Bacteria 2477
165 Ga0207687_10215017 3300025927 Bacteria 1510
166 Ga0207644_10112618 3300025931 Bacteria 2060
167 Ga0207644_10160287 3300025931 Bacteria 1748
168 Ga0207644_10433027 3300025931 Unclassified 1079
169 Ga0207690_10386031 3300025932 Bacteria 1114
170 Ga0207706_10004303 3300025933 Bacteria 13383
171 Ga0207706_10291298 3300025933 Bacteria 1423
172 Ga0207670_10091385 3300025936 Bacteria 2153
173 Ga0207669_10063439 3300025937 Bacteria 2281
174 Ga0207669_10119857 3300025937 Bacteria 1783
175 Ga0207704_10108813 3300025938 Bacteria 1868
176 Ga0207704_10253971 3300025938 Bacteria 1321
177 Ga0207704_10517712 3300025938 Bacteria 964
178 Ga0207665_10000498 3300025939 Bacteria 26564
179 Ga0207691_10333560 3300025940 Bacteria 1299
180 Ga0207711_10137582 3300025941 Bacteria 2195
181 Ga0207661_10009183 3300025944 Bacteria 7089
182 Ga0207661_10026236 3300025944 Bacteria 4437
183 Ga0207661_10033228 3300025944 Bacteria 4003
184 Ga0207661_10135103 3300025944 Bacteria 2117
185 Ga0207661_10235172 3300025944 Bacteria 1624
186 Ga0207661_10317139 3300025944 Bacteria 1401
187 Ga0207667_10022974 3300025949 Bacteria 6876
188 Ga0207667_10175676 3300025949 Bacteria 2201
189 Ga0207651_10251964 3300025960 Unclassified 1445
190 Ga0207668_10226430 3300025972 Bacteria 1505
191 Ga0207640_10369402 3300025981 Bacteria 1159
192 Ga0207640_10579485 3300025981 Bacteria 947
193 Ga0207658_10329684 3300025986 Bacteria 1324
194 Ga0207677_10017915 3300026023 Bacteria 4238
195 Ga0207677_10069852 3300026023 Unclassified 2472
196 Ga0207677_10098277 3300026023 Bacteria 2147
197 Ga0207677_10300760 3300026023 Bacteria 1325
198 Ga0207639_10011378 3300026041 Bacteria 6179
199 Ga0207708_10028247 3300026075 Bacteria 4248
200 Ga0207708_10119918 3300026075 Bacteria 2049
201 Ga0207641_10124742 3300026088 Bacteria 2304
202 Ga0207648_10003042 3300026089 Bacteria 17723
203 Ga0207648_10091690 3300026089 Bacteria 2656
204 Ga0207674_10001612 3300026116 Bacteria 29060
205 Ga0207683_10005119 3300026121 Bacteria 11253
206 Ga0209981_1006468 3300027378 Bacteria 1568
207 Ga0209995_1000349 3300027471 Bacteria 7209
208 Ga0209968_1002951 3300027526 Unclassified 2554
209 Ga0209968_1003011 3300027526 Unclassified 2527
210 Ga0209999_1001424 3300027543 Unclassified 4102
211 Ga0209971_1005476 3300027682 Unclassified 3014
212 Ga0209966_1000888 3300027695 Bacteria 5747
213 Ga0209998_10000216 3300027717 Bacteria 19999
214 Ga0209974_10016804 3300027876 Unclassified 2429
215 Ga0268264_10335382 3300028381 Bacteria 1435
216 Ga0265338_10016397 3300028800 Bacteria 8066
217 Ga0265324_10008355 3300029957 Bacteria 4116
218 Ga0265331_10008121 3300031250 Bacteria 5995
219 Ga0265316_10019491 3300031344 Bacteria 5801
220 Ga0307408_100017228 3300031548 Bacteria 4834
221 Ga0307408_100218549 3300031548 Bacteria 1554
222 Ga0307405_10005952 3300031731 Bacteria 5951
223 Ga0307410_10013209 3300031852 Bacteria 4808
224 Ga0307410_10203541 3300031852 Bacteria 1513
225 Ga0307412_10012041 3300031911 Bacteria 5027
226 Ga0307409_100001754 3300031995 Bacteria 10946
227 Ga0307409_100150858 3300031995 Bacteria 2017
228 Ga0307416_100115824 3300032002 Unclassified 2374
229 Ga0307416_100598177 3300032002 Bacteria 1182
230 Ga0307414_10047671 3300032004 Unclassified 2951
231 Ga0307411_10208877 3300032005 Bacteria 1506
232 Ga0373958_0046245 3300034819 Unclassified 906
233 Ga0373959_0009002 3300034820 Bacteria 1711
234 Ga0373941_0004078 3300035115 Unclassified 3350
235 Ga0373943_0018707 3300035170 Bacteria 3185
236 Ga0373961_0029141 3300035241 Bacteria 1527
237 Ga0373931_0018549 3300035691 Bacteria 3462
238 Ga0373935_0089278 3300035692 Bacteria 2015
239 Ga0373933_0062936 3300035724 Bacteria 2242
240 Ga0373947_0283506 3300035725 Bacteria 1102
241 Ga0373937_0033881 3300036401 Bacteria 4643
242 Ga0373937_0374174 3300036401 Bacteria 1351
243 Ga0373937_0411182 3300036401 Bacteria 1284
244 Ga0373925_0220712 3300037068 Bacteria 1513
245 Ga0373925_0242174 3300037068 Bacteria 1445
246 Ga0373925_0417004 3300037068 Bacteria 1096
247 Ga0395905_0146759 3300037471 Unclassified 2220
248 Ga0436361_0862959 3300039447 Bacteria 3827
249 Ga0466966_0169862 3300044684 Bacteria 1325
250 Ga0466959_0040493 3300045049 Bacteria 3442
251 Ga0466959_0219989 3300045049 Bacteria 1317
252 Ga0495580_0002417 3300046472 Bacteria 16317
253 Ga0495580_0006075 3300046472 Bacteria 9881
254 Ga0495639_0052792 3300046475 Bacteria 1851
255 Ga0495630_0178046 3300046517 Bacteria 1621
256 Ga0495630_0258648 3300046517 Bacteria 1330
257 Ga0495621_0074858 3300046539 Bacteria 1253
258 Ga0495621_0150582 3300046539 Bacteria 915
259 Ga0495667_0019758 3300046559 Bacteria 4546
260 Ga0495625_0067434 3300046660 Bacteria 2518
261 Ga0495635_0027059 3300046663 Bacteria 3990
262 Ga0495588_0013918 3300046674 Bacteria 3841
263 Ga0495669_0065733 3300046684 Bacteria 1647
264 Ga0495669_0171778 3300046684 Bacteria 1031
265 Ga0495674_0034906 3300047319 Bacteria 4543
266 Ga0495593_0207570 3300047673 Bacteria 984
267 Ga0496104_0428516 3300048907 Bacteria 1235
268 Ga0496112_0000612 3300048915 Bacteria 24619
269 Ga0496112_0015169 3300048915 Bacteria 7180
270 Ga0496112_0031872 3300048915 Bacteria 5115
271 Ga0496112_0069719 3300048915 Bacteria 3473
272 Ga0496112_0346915 3300048915 Bacteria 1427
273 Ga0496113_0150994 3300048916 Bacteria 1833
274 Ga0496113_0450123 3300048916 Bacteria 1035
275 Ga0496115_0227916 3300048918 Bacteria 1537
276 Ga0501294_004035 3300049517 Bacteria 1383
277 Ga0501223_000910 3300049663 Bacteria 6999
278 Ga0501224_002335 3300049664 Unclassified 2571
279 Ga0501221_000649 3300049704 Bacteria 5588
280 Ga0501234_000448 3300049707 Bacteria 6220
281 Ga0501276_000401 3300049773 Bacteria 2612
282 nmdc:mga05p37_47292_c1 3300050507 Bacteria 5291
283 nmdc:mga0n895_76355_c1 3300050512 Bacteria 3332
284 nmdc:mga0rr50_317700_c1 3300050513 Bacteria 1305
285 nmdc:mga08x19_1154_c1 3300050514 Bacteria 16496
286 nmdc:mga08x19_50878_c1 3300050514 Bacteria 2659
287 nmdc:mga0a205_21142_c1 3300050515 Bacteria 6154
288 Ga0495619_0193335 3300053085 Bacteria 1408
289 Ga0500646_0030301 3300053090 Bacteria 1484
290 Ga0500583_0034040 3300053092 Bacteria 2262
291 Ga0500568_0012755 3300053139 Bacteria 3853
292 Ga0500604_0000008 3300053151 Bacteria 114485
293 Ga0500587_001994 3300053739 Bacteria 2911
294 Ga0466962_0169363 3300061719 Bacteria 1063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0030301 Ga0500646_0030301_578_1369 258
2 3300053139 Ga0500568_0012755 Ga0500568_0012755_3038_3829 258
3 3300053151 Ga0500604_0000008 Ga0500604_0000008_91840_92631 258
4 3300046660 Ga0495625_0067434 Ga0495625_0067434_1166_1960 259
5 3300053739 Ga0500587_001994 Ga0500587_001994_115_909 259
6 3300005336 Ga0070680_100554473 Ga0070680_1005544732 261
7 3300005471 Ga0070698_100002374 Ga0070698_10000237411 261
8 3300005841 Ga0068863_100015754 Ga0068863_1000157546 262
9 3300026088 Ga0207641_10124742 Ga0207641_101247422 262
10 3300032002 Ga0307416_100598177 Ga0307416_1005981771 262
11 3300005329 Ga0070683_100247522 Ga0070683_1002475221 263
12 3300025944 Ga0207661_10235172 Ga0207661_102351722 263
13 3300014325 Ga0163163_10009603 Ga0163163_100096034 264
14 3300014968 Ga0157379_10151141 Ga0157379_101511413 264
15 3300029957 Ga0265324_10008355 Ga0265324_100083552 264
16 3300031250 Ga0265331_10008121 Ga0265331_100081212 264
17 3300031344 Ga0265316_10019491 Ga0265316_100194911 264
18 3300037068 Ga0373925_0242174 Ga0373925_0242174_20_814 264
19 3300046559 Ga0495667_0019758 Ga0495667_0019758_3616_4410 264
20 3300053092 Ga0500583_0034040 Ga0500583_0034040_166_960 264
21 3300009545 Ga0105237_10579796 Ga0105237_105797962 265
22 3300025914 Ga0207671_10426997 Ga0207671_104269971 265
23 3300028800 Ga0265338_10016397 Ga0265338_100163972 265
24 3300005458 Ga0070681_10153898 Ga0070681_101538983 266
25 3300025912 Ga0207707_10091616 Ga0207707_100916162 266
26 3300037471 Ga0395905_0146759 Ga0395905_0146759_949_1761 266
27 3300046475 Ga0495639_0052792 Ga0495639_0052792_560_1372 266
28 3300046663 Ga0495635_0027059 Ga0495635_0027059_2273_3085 266
29 3300053085 Ga0495619_0193335 Ga0495619_0193335_525_1337 266
30 3300005329 Ga0070683_100501864 Ga0070683_1005018641 267
31 3300005331 Ga0070670_100062813 Ga0070670_1000628132 267
32 3300005336 Ga0070680_100046226 Ga0070680_1000462264 267
33 3300005364 Ga0070673_100268049 Ga0070673_1002680491 267
34 3300005366 Ga0070659_100012330 Ga0070659_1000123302 267
35 3300005518 Ga0070699_100209878 Ga0070699_1002098782 267
36 3300005530 Ga0070679_100144925 Ga0070679_1001449253 267
37 3300005535 Ga0070684_100783939 Ga0070684_1007839391 267
38 3300005546 Ga0070696_100003022 Ga0070696_1000030229 267
39 3300005618 Ga0068864_100125328 Ga0068864_1001253283 267
40 3300013102 Ga0157371_10043662 Ga0157371_100436624 267
41 3300014325 Ga0163163_10003676 Ga0163163_100036765 267
42 3300014325 Ga0163163_10040203 Ga0163163_100402034 267
43 3300025917 Ga0207660_10021281 Ga0207660_100212814 267
44 3300025921 Ga0207652_10201887 Ga0207652_102018871 267
45 3300025931 Ga0207644_10112618 Ga0207644_101126183 267
46 3300025944 Ga0207661_10317139 Ga0207661_103171392 267
47 3300031852 Ga0307410_10203541 Ga0307410_102035412 267
48 3300046684 Ga0495669_0171778 Ga0495669_0171778_119_934 267
49 3300048907 Ga0496104_0428516 Ga0496104_0428516_383_1198 267
50 3300048915 Ga0496112_0031872 Ga0496112_0031872_3442_4257 267
51 3300048915 Ga0496112_0346915 Ga0496112_0346915_232_1035 267
52 3300048916 Ga0496113_0150994 Ga0496113_0150994_654_1469 267
53 3300048918 Ga0496115_0227916 Ga0496115_0227916_151_966 267
54 3300005434 Ga0070709_10239695 Ga0070709_102396952 268
55 3300005614 Ga0068856_100787415 Ga0068856_1007874151 268
56 3300025916 Ga0207663_10048695 Ga0207663_100486952 268
57 3300031548 Ga0307408_100218549 Ga0307408_1002185492 268
58 3300031995 Ga0307409_100150858 Ga0307409_1001508582 268
59 3300035724 Ga0373933_0062936 Ga0373933_0062936_1274_2080 268
60 3300036401 Ga0373937_0033881 Ga0373937_0033881_1128_1934 268
61 3300036401 Ga0373937_0374174 Ga0373937_0374174_316_1122 268
62 3300046472 Ga0495580_0002417 Ga0495580_0002417_2205_3011 268
63 3300005548 Ga0070665_100226490 Ga0070665_1002264902 269
64 3300021361 Ga0213872_10034072 Ga0213872_100340722 269
65 3300025936 Ga0207670_10091385 Ga0207670_100913852 269
66 3300025972 Ga0207668_10226430 Ga0207668_102264302 269
67 3300039447 Ga0436361_0862959 Ga0436361_0862959_1287_2108 269
68 3300044684 Ga0466966_0169862 Ga0466966_0169862_366_1175 269
69 3300045049 Ga0466959_0040493 Ga0466959_0040493_467_1276 269
70 3300045049 Ga0466959_0219989 Ga0466959_0219989_104_913 269
71 3300046539 Ga0495621_0074858 Ga0495621_0074858_151_960 269
72 3300061719 Ga0466962_0169363 Ga0466962_0169363_191_1000 269
73 2162886012 MBSR1b_contig_7724554 MBSR1b_0332.00007360 270
74 3300005293 Ga0065715_10091158 Ga0065715_100911583 270
75 3300005293 Ga0065715_10116144 Ga0065715_101161443 270
76 3300005327 Ga0070658_10103469 Ga0070658_101034692 270
77 3300005328 Ga0070676_10015357 Ga0070676_100153572 270
78 3300005328 Ga0070676_10095165 Ga0070676_100951652 270
79 3300005329 Ga0070683_100014487 Ga0070683_1000144872 270
80 3300005329 Ga0070683_100086816 Ga0070683_1000868162 270
81 3300005330 Ga0070690_100148367 Ga0070690_1001483672 270
82 3300005333 Ga0070677_10061889 Ga0070677_100618892 270
83 3300005336 Ga0070680_100005081 Ga0070680_1000050812 270
84 3300005336 Ga0070680_100024302 Ga0070680_1000243023 270
85 3300005336 Ga0070680_100031074 Ga0070680_1000310744 270
86 3300005336 Ga0070680_100141061 Ga0070680_1001410613 270
87 3300005337 Ga0070682_100002055 Ga0070682_1000020556 270
88 3300005337 Ga0070682_100002665 Ga0070682_1000026652 270
89 3300005337 Ga0070682_100084321 Ga0070682_1000843213 270
90 3300005338 Ga0068868_100010733 Ga0068868_1000107331 270
91 3300005341 Ga0070691_10060008 Ga0070691_100600082 270
92 3300005344 Ga0070661_100004725 Ga0070661_1000047251 270
93 3300005345 Ga0070692_10210586 Ga0070692_102105861 270
94 3300005345 Ga0070692_10385890 Ga0070692_103858901 270
95 3300005347 Ga0070668_100485652 Ga0070668_1004856522 270
96 3300005355 Ga0070671_100088421 Ga0070671_1000884213 270
97 3300005356 Ga0070674_100042303 Ga0070674_1000423032 270
98 3300005364 Ga0070673_100051628 Ga0070673_1000516283 270
99 3300005366 Ga0070659_100519694 Ga0070659_1005196941 270
100 3300005434 Ga0070709_10135137 Ga0070709_101351372 270
101 3300005437 Ga0070710_10006070 Ga0070710_100060705 270
102 3300005438 Ga0070701_10095625 Ga0070701_100956252 270
103 3300005439 Ga0070711_100418041 Ga0070711_1004180411 270
104 3300005444 Ga0070694_100037860 Ga0070694_1000378603 270
105 3300005456 Ga0070678_100044194 Ga0070678_1000441942 270
106 3300005457 Ga0070662_100075666 Ga0070662_1000756662 270
107 3300005457 Ga0070662_100225976 Ga0070662_1002259762 270
108 3300005458 Ga0070681_10001206 Ga0070681_1000120618 270
109 3300005458 Ga0070681_10139920 Ga0070681_101399202 270
110 3300005458 Ga0070681_10313795 Ga0070681_103137952 270
111 3300005459 Ga0068867_100076609 Ga0068867_1000766093 270
112 3300005459 Ga0068867_100153844 Ga0068867_1001538442 270
113 3300005467 Ga0070706_100057268 Ga0070706_1000572682 270
114 3300005467 Ga0070706_100218181 Ga0070706_1002181812 270
115 3300005468 Ga0070707_100201952 Ga0070707_1002019522 270
116 3300005530 Ga0070679_100002944 Ga0070679_1000029446 270
117 3300005530 Ga0070679_100003858 Ga0070679_1000038583 270
118 3300005530 Ga0070679_100018837 Ga0070679_1000188376 270
119 3300005530 Ga0070679_100166503 Ga0070679_1001665033 270
120 3300005535 Ga0070684_100000163 Ga0070684_10000016342 270
121 3300005535 Ga0070684_100060894 Ga0070684_1000608942 270
122 3300005536 Ga0070697_100007983 Ga0070697_1000079833 270
123 3300005536 Ga0070697_100026420 Ga0070697_1000264203 270
124 3300005536 Ga0070697_100169511 Ga0070697_1001695112 270
125 3300005539 Ga0068853_100032766 Ga0068853_1000327662 270
126 3300005545 Ga0070695_100007361 Ga0070695_1000073613 270
127 3300005545 Ga0070695_100085945 Ga0070695_1000859453 270
128 3300005546 Ga0070696_100084773 Ga0070696_1000847732 270
129 3300005547 Ga0070693_100129222 Ga0070693_1001292222 270
130 3300005547 Ga0070693_100253037 Ga0070693_1002530371 270
131 3300005549 Ga0070704_100006124 Ga0070704_1000061246 270
132 3300005549 Ga0070704_100064849 Ga0070704_1000648494 270
133 3300005563 Ga0068855_100093825 Ga0068855_1000938254 270
134 3300005563 Ga0068855_100138441 Ga0068855_1001384413 270
135 3300005563 Ga0068855_100939504 Ga0068855_1009395041 270
136 3300005564 Ga0070664_100072951 Ga0070664_1000729514 270
137 3300005564 Ga0070664_100210632 Ga0070664_1002106323 270
138 3300005564 Ga0070664_100270417 Ga0070664_1002704172 270
139 3300005577 Ga0068857_100002230 Ga0068857_1000022304 270
140 3300005614 Ga0068856_100097298 Ga0068856_1000972983 270
141 3300005718 Ga0068866_10023011 Ga0068866_100230112 270
142 3300005718 Ga0068866_10080876 Ga0068866_100808761 270
143 3300006175 Ga0070712_100389191 Ga0070712_1003891911 270
144 3300006237 Ga0097621_100360085 Ga0097621_1003600852 270
145 3300006358 Ga0068871_100621559 Ga0068871_1006215591 270
146 3300006852 Ga0075433_10007813 Ga0075433_100078136 270
147 3300006871 Ga0075434_100022846 Ga0075434_1000228466 270
148 3300006881 Ga0068865_100006319 Ga0068865_1000063191 270
149 3300006881 Ga0068865_100189612 Ga0068865_1001896121 270
150 3300006914 Ga0075436_100010659 Ga0075436_1000106595 270
151 3300006914 Ga0075436_100057194 Ga0075436_1000571943 270
152 3300007076 Ga0075435_100104237 Ga0075435_1001042371 270
153 3300009093 Ga0105240_10007624 Ga0105240_100076244 270
154 3300009098 Ga0105245_10025097 Ga0105245_100250974 270
155 3300009147 Ga0114129_10070818 Ga0114129_100708185 270
156 3300009176 Ga0105242_10105003 Ga0105242_101050033 270
157 3300009177 Ga0105248_10084436 Ga0105248_100844363 270
158 3300009177 Ga0105248_10103333 Ga0105248_101033333 270
159 3300013100 Ga0157373_10174724 Ga0157373_101747242 270
160 3300013100 Ga0157373_10207659 Ga0157373_102076592 270
161 3300013296 Ga0157374_10051836 Ga0157374_100518363 270
162 3300013297 Ga0157378_10029691 Ga0157378_100296912 270
163 3300013297 Ga0157378_10045963 Ga0157378_100459634 270
164 3300013297 Ga0157378_10087820 Ga0157378_100878202 270
165 3300013297 Ga0157378_10182878 Ga0157378_101828782 270
166 3300013306 Ga0163162_10810934 Ga0163162_108109342 270
167 3300013306 Ga0163162_11024679 Ga0163162_110246791 270
168 3300013307 Ga0157372_10115589 Ga0157372_101155893 270
169 3300013308 Ga0157375_10750722 Ga0157375_107507221 270
170 3300014497 Ga0182008_10009174 Ga0182008_100091741 270
171 3300014745 Ga0157377_10233790 Ga0157377_102337902 270
172 3300025893 Ga0207682_10017182 Ga0207682_100171823 270
173 3300025899 Ga0207642_10110998 Ga0207642_101109982 270
174 3300025903 Ga0207680_10056906 Ga0207680_100569062 270
175 3300025906 Ga0207699_10059775 Ga0207699_100597752 270
176 3300025906 Ga0207699_10272048 Ga0207699_102720481 270
177 3300025907 Ga0207645_10067676 Ga0207645_100676762 270
178 3300025909 Ga0207705_10345547 Ga0207705_103455471 270
179 3300025910 Ga0207684_10125046 Ga0207684_101250462 270
180 3300025912 Ga0207707_10001396 Ga0207707_100013969 270
181 3300025912 Ga0207707_10012945 Ga0207707_100129457 270
182 3300025912 Ga0207707_10038666 Ga0207707_100386662 270
183 3300025916 Ga0207663_10027140 Ga0207663_100271405 270
184 3300025917 Ga0207660_10024891 Ga0207660_100248914 270
185 3300025917 Ga0207660_10036828 Ga0207660_100368283 270
186 3300025917 Ga0207660_10082036 Ga0207660_100820362 270
187 3300025918 Ga0207662_10168489 Ga0207662_101684892 270
188 3300025920 Ga0207649_10083877 Ga0207649_100838772 270
189 3300025920 Ga0207649_10179763 Ga0207649_101797632 270
190 3300025921 Ga0207652_10002725 Ga0207652_100027259 270
191 3300025921 Ga0207652_10003141 Ga0207652_1000314114 270
192 3300025921 Ga0207652_10113732 Ga0207652_101137323 270
193 3300025927 Ga0207687_10215017 Ga0207687_102150172 270
194 3300025931 Ga0207644_10160287 Ga0207644_101602872 270
195 3300025931 Ga0207644_10433027 Ga0207644_104330271 270
196 3300025932 Ga0207690_10386031 Ga0207690_103860312 270
197 3300025933 Ga0207706_10004303 Ga0207706_1000430313 270
198 3300025933 Ga0207706_10291298 Ga0207706_102912982 270
199 3300025937 Ga0207669_10063439 Ga0207669_100634392 270
200 3300025937 Ga0207669_10119857 Ga0207669_101198571 270
201 3300025938 Ga0207704_10108813 Ga0207704_101088133 270
202 3300025938 Ga0207704_10253971 Ga0207704_102539711 270
203 3300025938 Ga0207704_10517712 Ga0207704_105177121 270
204 3300025939 Ga0207665_10000498 Ga0207665_1000049813 270
205 3300025940 Ga0207691_10333560 Ga0207691_103335602 270
206 3300025941 Ga0207711_10137582 Ga0207711_101375822 270
207 3300025944 Ga0207661_10009183 Ga0207661_100091837 270
208 3300025944 Ga0207661_10026236 Ga0207661_100262364 270
209 3300025944 Ga0207661_10033228 Ga0207661_100332282 270
210 3300025944 Ga0207661_10135103 Ga0207661_101351033 270
211 3300025949 Ga0207667_10022974 Ga0207667_100229743 270
212 3300025949 Ga0207667_10175676 Ga0207667_101756761 270
213 3300025960 Ga0207651_10251964 Ga0207651_102519642 270
214 3300025981 Ga0207640_10369402 Ga0207640_103694021 270
215 3300025981 Ga0207640_10579485 Ga0207640_105794851 270
216 3300025986 Ga0207658_10329684 Ga0207658_103296842 270
217 3300026023 Ga0207677_10017915 Ga0207677_100179152 270
218 3300026023 Ga0207677_10069852 Ga0207677_100698522 270
219 3300026023 Ga0207677_10098277 Ga0207677_100982771 270
220 3300026023 Ga0207677_10300760 Ga0207677_103007602 270
221 3300026041 Ga0207639_10011378 Ga0207639_100113783 270
222 3300026075 Ga0207708_10028247 Ga0207708_100282474 270
223 3300026075 Ga0207708_10119918 Ga0207708_101199182 270
224 3300026089 Ga0207648_10003042 Ga0207648_1000304210 270
225 3300026089 Ga0207648_10091690 Ga0207648_100916903 270
226 3300026116 Ga0207674_10001612 Ga0207674_100016129 270
227 3300026121 Ga0207683_10005119 Ga0207683_100051196 270
228 3300027378 Ga0209981_1006468 Ga0209981_10064682 270
229 3300027471 Ga0209995_1000349 Ga0209995_10003496 270
230 3300027526 Ga0209968_1002951 Ga0209968_10029512 270
231 3300027526 Ga0209968_1003011 Ga0209968_10030112 270
232 3300027543 Ga0209999_1001424 Ga0209999_10014242 270
233 3300027682 Ga0209971_1005476 Ga0209971_10054762 270
234 3300027695 Ga0209966_1000888 Ga0209966_10008883 270
235 3300027717 Ga0209998_10000216 Ga0209998_1000021614 270
236 3300027876 Ga0209974_10016804 Ga0209974_100168042 270
237 3300028381 Ga0268264_10335382 Ga0268264_103353822 270
238 3300031548 Ga0307408_100017228 Ga0307408_1000172283 270
239 3300031731 Ga0307405_10005952 Ga0307405_100059526 270
240 3300031852 Ga0307410_10013209 Ga0307410_100132094 270
241 3300031911 Ga0307412_10012041 Ga0307412_100120413 270
242 3300031995 Ga0307409_100001754 Ga0307409_1000017546 270
243 3300032002 Ga0307416_100115824 Ga0307416_1001158242 270
244 3300032004 Ga0307414_10047671 Ga0307414_100476713 270
245 3300032005 Ga0307411_10208877 Ga0307411_102088772 270
246 3300034819 Ga0373958_0046245 Ga0373958_0046245_29_841 270
247 3300034820 Ga0373959_0009002 Ga0373959_0009002_427_1239 270
248 3300035115 Ga0373941_0004078 Ga0373941_0004078_2315_3127 270
249 3300035170 Ga0373943_0018707 Ga0373943_0018707_1026_1838 270
250 3300035241 Ga0373961_0029141 Ga0373961_0029141_197_1009 270
251 3300035691 Ga0373931_0018549 Ga0373931_0018549_909_1721 270
252 3300035692 Ga0373935_0089278 Ga0373935_0089278_925_1737 270
253 3300035725 Ga0373947_0283506 Ga0373947_0283506_201_1016 270
254 3300036401 Ga0373937_0411182 Ga0373937_0411182_137_952 270
255 3300037068 Ga0373925_0417004 Ga0373925_0417004_147_962 270
256 3300046517 Ga0495630_0178046 Ga0495630_0178046_216_1031 270
257 3300046517 Ga0495630_0258648 Ga0495630_0258648_330_1142 270
258 3300046539 Ga0495621_0150582 Ga0495621_0150582_30_842 270
259 3300046674 Ga0495588_0013918 Ga0495588_0013918_1657_2469 270
260 3300046684 Ga0495669_0065733 Ga0495669_0065733_232_1044 270
261 3300047319 Ga0495674_0034906 Ga0495674_0034906_1173_1985 270
262 3300047673 Ga0495593_0207570 Ga0495593_0207570_150_965 270
263 3300048915 Ga0496112_0000612 Ga0496112_0000612_2171_2983 270
264 3300048915 Ga0496112_0015169 Ga0496112_0015169_4394_5206 270
265 3300048915 Ga0496112_0069719 Ga0496112_0069719_2570_3385 270
266 3300048916 Ga0496113_0450123 Ga0496113_0450123_184_996 270
267 3300049517 Ga0501294_004035 Ga0501294_004035_325_1143 270
268 3300049663 Ga0501223_000910 Ga0501223_000910_191_1009 270
269 3300049664 Ga0501224_002335 Ga0501224_002335_161_979 270
270 3300049704 Ga0501221_000649 Ga0501221_000649_2602_3420 270
271 3300049707 Ga0501234_000448 Ga0501234_000448_2628_3446 270
272 3300049773 Ga0501276_000401 Ga0501276_000401_112_930 270
273 3300050507 nmdc:mga05p37_47292_c1 nmdc:mga05p37_47292_c1_3534_4346 270
274 3300050512 nmdc:mga0n895_76355_c1 nmdc:mga0n895_76355_c1_684_1496 270
275 3300050513 nmdc:mga0rr50_317700_c1 nmdc:mga0rr50_317700_c1_483_1295 270
276 3300050514 nmdc:mga08x19_50878_c1 nmdc:mga08x19_50878_c1_1779_2591 270
277 3300050515 nmdc:mga0a205_21142_c1 nmdc:mga0a205_21142_c1_1129_1941 270
278 3300013297 Ga0157378_10361092 Ga0157378_103610922 271
279 3300037068 Ga0373925_0220712 Ga0373925_0220712_533_1348 271
280 3300006914 Ga0075436_100004252 Ga0075436_1000042529 272
281 3300050514 nmdc:mga08x19_1154_c1 nmdc:mga08x19_1154_c1_615_1433 272
282 3300046472 Ga0495580_0006075 Ga0495580_0006075_5527_6378 276
283 3300005445 Ga0070708_100000064 Ga0070708_10000006457 279
284 3300005468 Ga0070707_100000322 Ga0070707_10000032216 279
285 3300005518 Ga0070699_100067949 Ga0070699_1000679493 279
286 3300025922 Ga0207646_10003365 Ga0207646_100033652 279
287 2162886012 MBSR1b_contig_616894 MBSR1b_0245.00004940 286
288 3300005445 Ga0070708_100160704 Ga0070708_1001607042 286
289 3300005468 Ga0070707_100097128 Ga0070707_1000971283 286
290 3300005471 Ga0070698_100189180 Ga0070698_1001891801 286
291 3300009093 Ga0105240_10313632 Ga0105240_103136323 286
292 3300013307 Ga0157372_10003560 Ga0157372_100035603 286
293 3300025910 Ga0207684_10089289 Ga0207684_100892893 286
294 3300025922 Ga0207646_10109585 Ga0207646_101095852 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

70

264

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

76

311

0.95

PF08659

KR

KR domain

71

252

0.88

PF23441

64

313

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9696 23 270
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9691 26 270
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9673 23 271
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9638 22 270
6ihi-assembly1.cif.gz_C crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9634 23 270
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9714 23 103 3.40.50.720
af_C0P944_2_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9704 21 271 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 28 75 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.958 23 270 3.40.50.720
af_Q9XE46_1_147_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.957 157 271 3.40.50.720
ID Description Score Start End GO Terms
AF-X1HCU3-F1-model_v4 Uncharacterized protein 0.9738 26 109
AF-A0A3S1JNC0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9735 27 85 GO:0016020
GO:0016491
AF-A0A5C7KJ47-F1-model_v4 deleted 0.9694 27 111
AF-A0A3D4A6D1-F1-model_v4 Ketoacyl reductase 0.9692 27 207 GO:0016020
GO:0016491
AF-A0A845DH81-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9658 27 101

Feature Viewer

pLDDT pTM Quality
87.81 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map