F391881

General Info

Members Datasets Scaffolds Average Seq Length
294 176 588 177

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10035753|Ga0065712_100357531
Length 213
Sequence VGGNHNTGRLLRARNGLTPGSDSMANCGGSHIMGPSANTIDGMRELKAFNFRRWIDEHRHLLKPPVGNKLVFTDSEFIIMVVGGPNSRKDFHVDPGEEFFYQLEGGITLATVQDGKRVDIAIGEGDIFLLPPNMPHSPRRPANTVGLVIXRTRRPGELXGFQWYCENCGTRLYEEFVEVTDIETQLPPVFDRFFGSTANRTCRNCSTVMERPK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
140 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.7
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10035753 3300005290 Bacteria 946
2 Ga0070676_10074251 3300005328 Bacteria 2048
3 Ga0070690_100133775 3300005330 Bacteria 1677
4 Ga0070690_101312715 3300005330 Bacteria 580
5 Ga0070677_10048929 3300005333 Bacteria 1701
6 Ga0070666_10140145 3300005335 Bacteria 1684
7 Ga0070680_100261484 3300005336 Bacteria 1464
8 Ga0070682_100073235 3300005337 Bacteria 2197
9 Ga0070682_100102257 3300005337 Bacteria 1894
10 Ga0070682_100235663 3300005337 Bacteria 1311
11 Ga0070682_100304330 3300005337 Bacteria 1171
12 Ga0070682_100553179 3300005337 Unclassified 901
13 Ga0068868_100280065 3300005338 Bacteria 1411
14 Ga0068868_100977309 3300005338 Bacteria 773
15 Ga0070660_100564446 3300005339 Unclassified 950
16 Ga0070692_10289165 3300005345 Unclassified 996
17 Ga0070668_100384190 3300005347 Bacteria 1195
18 Ga0070675_100564800 3300005354 Bacteria 1030
19 Ga0070671_100149450 3300005355 Unclassified 1972
20 Ga0070671_100447805 3300005355 Unclassified 1108
21 Ga0070674_100037006 3300005356 Bacteria 3280
22 Ga0070674_100057858 3300005356 Bacteria 2693
23 Ga0070674_100223697 3300005356 Bacteria 1465
24 Ga0070674_100516070 3300005356 Bacteria 997
25 Ga0070673_100262682 3300005364 Bacteria 1509
26 Ga0070659_100723208 3300005366 Bacteria 862
27 Ga0070667_100000008 3300005367 Bacteria 285591
28 Ga0070667_100227905 3300005367 Bacteria 1660
29 Ga0070667_100847659 3300005367 Bacteria 850
30 Ga0070700_100135169 3300005441 Bacteria 1669
31 Ga0070663_100390111 3300005455 Bacteria 1136
32 Ga0070678_100003908 3300005456 Bacteria 8377
33 Ga0070662_100436854 3300005457 Bacteria 1085
34 Ga0070681_10001429 3300005458 Bacteria 21006
35 Ga0070681_10002655 3300005458 Bacteria 16419
36 Ga0070681_10012498 3300005458 Bacteria 8425
37 Ga0070681_10075230 3300005458 Bacteria 3337
38 Ga0070681_10105304 3300005458 Unclassified 2763
39 Ga0068867_100276262 3300005459 Bacteria 1376
40 Ga0070685_10038144 3300005466 Bacteria 2724
41 Ga0070685_10101350 3300005466 Bacteria 1759
42 Ga0070706_101513303 3300005467 Bacteria 613
43 Ga0070679_100026728 3300005530 Bacteria 5675
44 Ga0070679_100163714 3300005530 Bacteria 2198
45 Ga0070679_100610011 3300005530 Bacteria 1034
46 Ga0070679_100754135 3300005530 Bacteria 916
47 Ga0068853_100258792 3300005539 Unclassified 1599
48 Ga0070672_100017879 3300005543 Bacteria 5112
49 Ga0070672_100034468 3300005543 Bacteria 3841
50 Ga0070686_100095859 3300005544 Bacteria 1994
51 Ga0070686_100223099 3300005544 Bacteria 1363
52 Ga0070693_100819458 3300005547 Unclassified 691
53 Ga0070665_100024709 3300005548 Bacteria 6053
54 Ga0070665_100064816 3300005548 Bacteria 3665
55 Ga0070665_100137386 3300005548 Bacteria 2447
56 Ga0070665_100510447 3300005548 Bacteria 1214
57 Ga0070704_101064126 3300005549 Unclassified 734
58 Ga0068855_100004909 3300005563 Bacteria 16325
59 Ga0068855_100252288 3300005563 Bacteria 1968
60 Ga0068855_100384863 3300005563 Bacteria 1539
61 Ga0068857_100093293 3300005577 Bacteria 2696
62 Ga0068857_100715426 3300005577 Bacteria 952
63 Ga0068854_101577419 3300005578 Unclassified 598
64 Ga0068856_100080722 3300005614 Bacteria 3226
65 Ga0068856_101120871 3300005614 Bacteria 804
66 Ga0070702_100044640 3300005615 Bacteria 2503
67 Ga0070702_100234934 3300005615 Bacteria 1234
68 Ga0068852_100585390 3300005616 Bacteria 1119
69 Ga0068859_100059622 3300005617 Bacteria 3845
70 Ga0068859_100142788 3300005617 Bacteria 2468
71 Ga0068859_100222112 3300005617 Bacteria 1977
72 Ga0068859_100853556 3300005617 Bacteria 996
73 Ga0068859_101133956 3300005617 Bacteria 861
74 Ga0068864_100775634 3300005618 Bacteria 941
75 Ga0068866_10094890 3300005718 Bacteria 1633
76 Ga0068861_100010538 3300005719 Bacteria 6418
77 Ga0068861_100038168 3300005719 Bacteria 3574
78 Ga0068861_100134606 3300005719 Bacteria 2009
79 Ga0068861_100140735 3300005719 Bacteria 1969
80 Ga0068861_100358327 3300005719 Bacteria 1282
81 Ga0068861_100391476 3300005719 Bacteria 1231
82 Ga0068870_10006631 3300005840 Bacteria 5111
83 Ga0068870_10245856 3300005840 Bacteria 1107
84 Ga0068863_100006860 3300005841 Bacteria 11163
85 Ga0068858_100526308 3300005842 Bacteria 1143
86 Ga0068860_100000771 3300005843 Bacteria 36058
87 Ga0068860_100222856 3300005843 Bacteria 1831
88 Ga0068860_100261449 3300005843 Bacteria 1687
89 Ga0068860_100369344 3300005843 Bacteria 1414
90 Ga0068860_100452502 3300005843 Bacteria 1277
91 Ga0068862_100128134 3300005844 Bacteria 2242
92 Ga0068862_100164037 3300005844 Bacteria 1985
93 Ga0068862_100237771 3300005844 Bacteria 1655
94 Ga0081455_10002219 3300005937 Bacteria 23127
95 Ga0097621_100066714 3300006237 Bacteria 2964
96 Ga0097621_100156910 3300006237 Bacteria 1954
97 Ga0097621_100410733 3300006237 Bacteria 1213
98 Ga0068871_100015422 3300006358 Bacteria 5719
99 Ga0068871_100517948 3300006358 Bacteria 1077
100 Ga0075428_100000041 3300006844 Bacteria 102565
101 Ga0075430_100018740 3300006846 Bacteria 5890
102 Ga0075431_100002546 3300006847 Bacteria 17595
103 Ga0075433_10021029 3300006852 Bacteria 5466
104 Ga0075429_100000878 3300006880 Bacteria 23738
105 Ga0068865_100242237 3300006881 Bacteria 1419
106 Ga0068865_100576971 3300006881 Bacteria 948
107 Ga0097620_100059620 3300006931 Bacteria 3845
108 Ga0097620_100142780 3300006931 Bacteria 2468
109 Ga0097620_100222124 3300006931 Bacteria 1977
110 Ga0097620_100853554 3300006931 Bacteria 996
111 Ga0097620_101133897 3300006931 Bacteria 861
112 Ga0105250_10000031 3300009092 Bacteria 170328
113 Ga0105250_10085773 3300009092 Bacteria 1278
114 Ga0105240_10000960 3300009093 Bacteria 51436
115 Ga0105240_10007646 3300009093 Bacteria 15653
116 Ga0105240_10008483 3300009093 Bacteria 14696
117 Ga0105240_10073560 3300009093 Bacteria 4219
118 Ga0105240_10345573 3300009093 Bacteria 1689
119 Ga0105240_10714807 3300009093 Bacteria 1092
120 Ga0105240_10907035 3300009093 Bacteria 948
121 Ga0111539_10139941 3300009094 Bacteria 2834
122 Ga0111539_11505797 3300009094 Bacteria 780
123 Ga0105245_11003092 3300009098 Bacteria 879
124 Ga0105247_10016824 3300009101 Bacteria 4384
125 Ga0105247_10036066 3300009101 Bacteria 3015
126 Ga0114129_10000132 3300009147 Bacteria 76665
127 Ga0105243_10954630 3300009148 Bacteria 857
128 Ga0105241_10991340 3300009174 Bacteria 785
129 Ga0105241_11705262 3300009174 Bacteria 612
130 Ga0105242_10203044 3300009176 Bacteria 1761
131 Ga0105248_10125171 3300009177 Bacteria 2899
132 Ga0105248_10158116 3300009177 Bacteria 2557
133 Ga0105248_10240443 3300009177 Bacteria 2038
134 Ga0105237_10040971 3300009545 Bacteria 4671
135 Ga0105237_10113730 3300009545 Bacteria 2699
136 Ga0105237_10343064 3300009545 Bacteria 1498
137 Ga0105237_10506731 3300009545 Bacteria 1214
138 Ga0105238_10031857 3300009551 Bacteria 5364
139 Ga0105238_10170416 3300009551 Bacteria 2153
140 Ga0105238_10278303 3300009551 Bacteria 1654
141 Ga0105238_10414193 3300009551 Bacteria 1341
142 Ga0105238_10686967 3300009551 Bacteria 1035
143 Ga0105249_10104472 3300009553 Unclassified 2669
144 Ga0105249_10643543 3300009553 Bacteria 1117
145 Ga0105239_10427715 3300010375 Bacteria 1501
146 Ga0105239_10459653 3300010375 Bacteria 1445
147 Ga0105246_10094919 3300011119 Bacteria 2158
148 Ga0157370_10001514 3300013104 Bacteria 28723
149 Ga0157369_10055981 3300013105 Bacteria 4256
150 Ga0157374_10080675 3300013296 Bacteria 3086
151 Ga0157374_10588838 3300013296 Bacteria 1122
152 Ga0157374_10666548 3300013296 Bacteria 1052
153 Ga0163162_10263502 3300013306 Bacteria 1855
154 Ga0163162_12179651 3300013306 Bacteria 636
155 Ga0157372_10491425 3300013307 Bacteria 1431
156 Ga0157372_10568503 3300013307 Bacteria 1321
157 Ga0157375_10013899 3300013308 Bacteria 7178
158 Ga0157375_10229149 3300013308 Bacteria 2017
159 Ga0163163_10024106 3300014325 Bacteria 5789
160 Ga0163163_10491988 3300014325 Unclassified 1288
161 Ga0163163_10849176 3300014325 Bacteria 976
162 Ga0157380_10024001 3300014326 Bacteria 4609
163 Ga0157380_10045513 3300014326 Bacteria 3444
164 Ga0157380_10053749 3300014326 Bacteria 3194
165 Ga0157380_10274812 3300014326 Bacteria 1538
166 Ga0157380_10292165 3300014326 Bacteria 1497
167 Ga0157377_10162909 3300014745 Bacteria 1389
168 Ga0157377_10178125 3300014745 Bacteria 1335
169 Ga0157379_10000153 3300014968 Bacteria 51100
170 Ga0157379_10157796 3300014968 Bacteria 2047
171 Ga0157379_10550333 3300014968 Unclassified 1074
172 Ga0157379_10618943 3300014968 Bacteria 1012
173 Ga0157376_10218552 3300014969 Bacteria 1764
174 Ga0157376_11317050 3300014969 Bacteria 752
175 Ga0163161_10324874 3300017792 Bacteria 1217
176 Ga0207696_1000125 3300025711 Bacteria 138603
177 Ga0207692_10152875 3300025898 Bacteria 1323
178 Ga0207642_10308896 3300025899 Bacteria 919
179 Ga0207643_10019860 3300025908 Bacteria 3683
180 Ga0207707_10061058 3300025912 Archaea 3279
181 Ga0207695_10056294 3300025913 Bacteria 4093
182 Ga0207660_10011633 3300025917 Bacteria 5738
183 Ga0207662_10270983 3300025918 Bacteria 1120
184 Ga0207649_10354885 3300025920 Bacteria 1086
185 Ga0207652_10379213 3300025921 Bacteria 1276
186 Ga0207694_10705072 3300025924 Bacteria 851
187 Ga0207659_10081386 3300025926 Bacteria 2394
188 Ga0207690_10709327 3300025932 Bacteria 827
189 Ga0207706_10264150 3300025933 Bacteria 1502
190 Ga0207706_10293197 3300025933 Bacteria 1418
191 Ga0207686_10075005 3300025934 Bacteria 2188
192 Ga0207709_10494495 3300025935 Bacteria 953
193 Ga0207669_10259165 3300025937 Bacteria 1299
194 Ga0207704_10254177 3300025938 Bacteria 1321
195 Ga0207691_10000649 3300025940 Bacteria 34369
196 Ga0207691_10015392 3300025940 Bacteria 7277
197 Ga0207691_10021221 3300025940 Bacteria 6137
198 Ga0207689_10083006 3300025942 Bacteria 2635
199 Ga0207689_10238437 3300025942 Bacteria 1503
200 Ga0207679_10169560 3300025945 Bacteria 1796
201 Ga0207667_10027157 3300025949 Bacteria 6238
202 Ga0207651_10100956 3300025960 Bacteria 2140
203 Ga0207651_10116876 3300025960 Bacteria 2014
204 Ga0207651_10178791 3300025960 Bacteria 1681
205 Ga0207668_10233639 3300025972 Bacteria 1484
206 Ga0207658_10316492 3300025986 Bacteria 1350
207 Ga0207678_10722239 3300026067 Bacteria 877
208 Ga0207641_10238836 3300026088 Bacteria 1692
209 Ga0207648_10048595 3300026089 Bacteria 3713
210 Ga0207676_10671961 3300026095 Bacteria 1001
211 Ga0207674_10278074 3300026116 Bacteria 1622
212 Ga0207675_100002685 3300026118 Bacteria 17555
213 Ga0207675_100012998 3300026118 Bacteria 7771
214 Ga0207675_100071052 3300026118 Bacteria 3254
215 Ga0207675_100453198 3300026118 Bacteria 1271
216 Ga0207683_10002330 3300026121 Bacteria 16662
217 Ga0207683_10135627 3300026121 Bacteria 2215
218 Ga0207428_10054513 3300027907 Bacteria 3184
219 Ga0268266_10034163 3300028379 Bacteria 4324
220 Ga0268266_10066981 3300028379 Bacteria 3107
221 Ga0268266_10403472 3300028379 Bacteria 1293
222 Ga0268265_10057173 3300028380 Bacteria 2972
223 Ga0268265_10468525 3300028380 Bacteria 1180
224 Ga0268264_10315079 3300028381 Bacteria 1477
225 Ga0268264_10349426 3300028381 Bacteria 1407
226 Ga0268264_10421192 3300028381 Bacteria 1288
227 Ga0307513_10046215 3300031456 Bacteria 4750
228 Ga0307513_10054279 3300031456 Bacteria 4298
229 Ga0307513_10114278 3300031456 Bacteria 2685
230 Ga0307509_10042246 3300031507 Bacteria 4943
231 Ga0307509_10078349 3300031507 Bacteria 3424
232 Ga0307407_10011429 3300031903 Bacteria 4225
233 Ga0307412_10191906 3300031911 Bacteria 1545
234 Ga0307409_100024097 3300031995 Bacteria 4236
235 Ga0307409_100091251 3300031995 Bacteria 2496
236 Ga0307416_100087037 3300032002 Bacteria 2666
237 Ga0307414_10062869 3300032004 Bacteria 2636
238 Ga0307414_10145849 3300032004 Bacteria 1859
239 Ga0307411_10242444 3300032005 Bacteria 1412
240 Ga0307415_100239091 3300032126 Bacteria 1468
241 Ga0307415_100717038 3300032126 Bacteria 904
242 Ga0373936_0027819 3300035113 Bacteria 2219
243 Ga0373955_0156117 3300035172 Bacteria 1344
244 Ga0373942_0134550 3300035207 Bacteria 782
245 Ga0373933_0123695 3300035724 Bacteria 1621
246 Ga0436365_0249262 3300039437 Bacteria 1314
247 Ga0451791_0089289 3300041451 Bacteria 3701
248 Ga0451793_0560215 3300041452 Bacteria 884
249 Ga0451807_1860684 3300041486 Bacteria 3277
250 Ga0451833_0519823 3300041491 Unclassified 2567
251 Ga0451841_0007990 3300041498 Bacteria 744
252 Ga0451851_0945350 3300041507 Bacteria 1865
253 Ga0451853_4087407 3300041512 Bacteria 1638
254 Ga0451577_0003711 3300042876 Bacteria 16691
255 Ga0453684_0001281 3300044712 Bacteria 75118
256 Ga0451576_0039939 3300045051 Bacteria 4968
257 Ga0495590_0003478 3300046457 Bacteria 6427
258 Ga0495605_0182017 3300046474 Bacteria 924
259 Ga0495616_0000618 3300046513 Bacteria 26735
260 Ga0495616_0252171 3300046513 Bacteria 758
261 Ga0495616_0341682 3300046513 Bacteria 625
262 Ga0495630_0370912 3300046517 Bacteria 1096
263 Ga0495632_0089474 3300046519 Bacteria 1461
264 Ga0495656_0114255 3300046615 Bacteria 1267
265 Ga0495668_0140255 3300046616 Bacteria 1323
266 Ga0495625_0042415 3300046660 Bacteria 3307
267 Ga0495671_0026543 3300046692 Bacteria 3002
268 Ga0495636_0011105 3300047318 Bacteria 3563
269 Ga0495680_0564629 3300047322 Bacteria 765
270 Ga0495681_0156051 3300047470 Bacteria 954
271 Ga0495686_0133398 3300047472 Bacteria 1471
272 Ga0495686_0236934 3300047472 Bacteria 1031
273 Ga0495615_0024503 3300048090 Bacteria 1393
274 Ga0495626_0061950 3300048091 Bacteria 1700
275 Ga0496114_0012123 3300048917 Bacteria 6898
276 Ga0496114_1276849 3300048917 Bacteria 621
277 Ga0501042_0063247 3300049578 Bacteria 2645
278 Ga0501068_0516378 3300049584 Bacteria 775
279 Ga0501072_0619674 3300049588 Bacteria 853
280 Ga0501073_0110325 3300049589 Bacteria 1908
281 Ga0501073_0646277 3300049589 Bacteria 730
282 Ga0501080_0053966 3300049742 Bacteria 3743
283 Ga0501083_0550515 3300049744 Bacteria 751
284 nmdc:mga05p37_244397_c1 3300050507 Bacteria 2156
285 nmdc:mga05p37_3306_c1 3300050507 Bacteria 18809
286 nmdc:mga09592_854_c1 3300050508 Bacteria 23738
287 nmdc:mga0qj67_14788_c1 3300050509 Bacteria 5900
288 nmdc:mga06r32_482_c2 3300050510 Bacteria 32195
289 nmdc:mga08y16_89435_c1 3300050511 Bacteria 3209
290 nmdc:mga0a205_277778_c1 3300050515 Bacteria 1551
291 Ga0500616_0019218 3300053153 Bacteria 3852
292 Ga0500637_0016479 3300053178 Bacteria 3939
293 Ga0530510_0718716 3300061734 Bacteria 761
294 2919693432 2919692658 Bacteria 5943958
295 Ga0065712_10035753
296 Ga0070676_10074251
297 Ga0070690_100133775
298 Ga0070690_101312715
299 Ga0070677_10048929
300 Ga0070666_10140145
301 Ga0070680_100261484
302 Ga0070682_100073235
303 Ga0070682_100102257
304 Ga0070682_100235663
305 Ga0070682_100304330
306 Ga0070682_100553179
307 Ga0068868_100280065
308 Ga0068868_100977309
309 Ga0070660_100564446
310 Ga0070692_10289165
311 Ga0070668_100384190
312 Ga0070675_100564800
313 Ga0070671_100149450
314 Ga0070671_100447805
315 Ga0070674_100037006
316 Ga0070674_100057858
317 Ga0070674_100223697
318 Ga0070674_100516070
319 Ga0070673_100262682
320 Ga0070659_100723208
321 Ga0070667_100000008
322 Ga0070667_100227905
323 Ga0070667_100847659
324 Ga0070700_100135169
325 Ga0070663_100390111
326 Ga0070678_100003908
327 Ga0070662_100436854
328 Ga0070681_10001429
329 Ga0070681_10002655
330 Ga0070681_10012498
331 Ga0070681_10075230
332 Ga0070681_10105304
333 Ga0068867_100276262
334 Ga0070685_10038144
335 Ga0070685_10101350
336 Ga0070706_101513303
337 Ga0070679_100026728
338 Ga0070679_100163714
339 Ga0070679_100610011
340 Ga0070679_100754135
341 Ga0068853_100258792
342 Ga0070672_100017879
343 Ga0070672_100034468
344 Ga0070686_100095859
345 Ga0070686_100223099
346 Ga0070693_100819458
347 Ga0070665_100024709
348 Ga0070665_100064816
349 Ga0070665_100137386
350 Ga0070665_100510447
351 Ga0070704_101064126
352 Ga0068855_100004909
353 Ga0068855_100252288
354 Ga0068855_100384863
355 Ga0068857_100093293
356 Ga0068857_100715426
357 Ga0068854_101577419
358 Ga0068856_100080722
359 Ga0068856_101120871
360 Ga0070702_100044640
361 Ga0070702_100234934
362 Ga0068852_100585390
363 Ga0068859_100059622
364 Ga0068859_100142788
365 Ga0068859_100222112
366 Ga0068859_100853556
367 Ga0068859_101133956
368 Ga0068864_100775634
369 Ga0068866_10094890
370 Ga0068861_100010538
371 Ga0068861_100038168
372 Ga0068861_100134606
373 Ga0068861_100140735
374 Ga0068861_100358327
375 Ga0068861_100391476
376 Ga0068870_10006631
377 Ga0068870_10245856
378 Ga0068863_100006860
379 Ga0068858_100526308
380 Ga0068860_100000771
381 Ga0068860_100222856
382 Ga0068860_100261449
383 Ga0068860_100369344
384 Ga0068860_100452502
385 Ga0068862_100128134
386 Ga0068862_100164037
387 Ga0068862_100237771
388 Ga0081455_10002219
389 Ga0097621_100066714
390 Ga0097621_100156910
391 Ga0097621_100410733
392 Ga0068871_100015422
393 Ga0068871_100517948
394 Ga0075428_100000041
395 Ga0075430_100018740
396 Ga0075431_100002546
397 Ga0075433_10021029
398 Ga0075429_100000878
399 Ga0068865_100242237
400 Ga0068865_100576971
401 Ga0097620_100059620
402 Ga0097620_100142780
403 Ga0097620_100222124
404 Ga0097620_100853554
405 Ga0097620_101133897
406 Ga0105250_10000031
407 Ga0105250_10085773
408 Ga0105240_10000960
409 Ga0105240_10007646
410 Ga0105240_10008483
411 Ga0105240_10073560
412 Ga0105240_10345573
413 Ga0105240_10714807
414 Ga0105240_10907035
415 Ga0111539_10139941
416 Ga0111539_11505797
417 Ga0105245_11003092
418 Ga0105247_10016824
419 Ga0105247_10036066
420 Ga0114129_10000132
421 Ga0105243_10954630
422 Ga0105241_10991340
423 Ga0105241_11705262
424 Ga0105242_10203044
425 Ga0105248_10125171
426 Ga0105248_10158116
427 Ga0105248_10240443
428 Ga0105237_10040971
429 Ga0105237_10113730
430 Ga0105237_10343064
431 Ga0105237_10506731
432 Ga0105238_10031857
433 Ga0105238_10170416
434 Ga0105238_10278303
435 Ga0105238_10414193
436 Ga0105238_10686967
437 Ga0105249_10104472
438 Ga0105249_10643543
439 Ga0105239_10427715
440 Ga0105239_10459653
441 Ga0105246_10094919
442 Ga0157370_10001514
443 Ga0157369_10055981
444 Ga0157374_10080675
445 Ga0157374_10588838
446 Ga0157374_10666548
447 Ga0163162_10263502
448 Ga0163162_12179651
449 Ga0157372_10491425
450 Ga0157372_10568503
451 Ga0157375_10013899
452 Ga0157375_10229149
453 Ga0163163_10024106
454 Ga0163163_10491988
455 Ga0163163_10849176
456 Ga0157380_10024001
457 Ga0157380_10045513
458 Ga0157380_10053749
459 Ga0157380_10274812
460 Ga0157380_10292165
461 Ga0157377_10162909
462 Ga0157377_10178125
463 Ga0157379_10000153
464 Ga0157379_10157796
465 Ga0157379_10550333
466 Ga0157379_10618943
467 Ga0157376_10218552
468 Ga0157376_11317050
469 Ga0163161_10324874
470 Ga0207696_1000125
471 Ga0207692_10152875
472 Ga0207642_10308896
473 Ga0207643_10019860
474 Ga0207707_10061058
475 Ga0207695_10056294
476 Ga0207660_10011633
477 Ga0207662_10270983
478 Ga0207649_10354885
479 Ga0207652_10379213
480 Ga0207694_10705072
481 Ga0207659_10081386
482 Ga0207690_10709327
483 Ga0207706_10264150
484 Ga0207706_10293197
485 Ga0207686_10075005
486 Ga0207709_10494495
487 Ga0207669_10259165
488 Ga0207704_10254177
489 Ga0207691_10000649
490 Ga0207691_10015392
491 Ga0207691_10021221
492 Ga0207689_10083006
493 Ga0207689_10238437
494 Ga0207679_10169560
495 Ga0207667_10027157
496 Ga0207651_10100956
497 Ga0207651_10116876
498 Ga0207651_10178791
499 Ga0207668_10233639
500 Ga0207658_10316492
501 Ga0207678_10722239
502 Ga0207641_10238836
503 Ga0207648_10048595
504 Ga0207676_10671961
505 Ga0207674_10278074
506 Ga0207675_100002685
507 Ga0207675_100012998
508 Ga0207675_100071052
509 Ga0207675_100453198
510 Ga0207683_10002330
511 Ga0207683_10135627
512 Ga0207428_10054513
513 Ga0268266_10034163
514 Ga0268266_10066981
515 Ga0268266_10403472
516 Ga0268265_10057173
517 Ga0268265_10468525
518 Ga0268264_10315079
519 Ga0268264_10349426
520 Ga0268264_10421192
521 Ga0307513_10046215
522 Ga0307513_10054279
523 Ga0307513_10114278
524 Ga0307509_10042246
525 Ga0307509_10078349
526 Ga0307407_10011429
527 Ga0307412_10191906
528 Ga0307409_100024097
529 Ga0307409_100091251
530 Ga0307416_100087037
531 Ga0307414_10062869
532 Ga0307414_10145849
533 Ga0307411_10242444
534 Ga0307415_100239091
535 Ga0307415_100717038
536 Ga0373936_0027819
537 Ga0373955_0156117
538 Ga0373942_0134550
539 Ga0373933_0123695
540 Ga0436365_0249262
541 Ga0451791_0089289
542 Ga0451793_0560215
543 Ga0451807_1860684
544 Ga0451833_0519823
545 Ga0451841_0007990
546 Ga0451851_0945350
547 Ga0451853_4087407
548 Ga0451577_0003711
549 Ga0453684_0001281
550 Ga0451576_0039939
551 Ga0495590_0003478
552 Ga0495605_0182017
553 Ga0495616_0000618
554 Ga0495616_0252171
555 Ga0495616_0341682
556 Ga0495630_0370912
557 Ga0495632_0089474
558 Ga0495656_0114255
559 Ga0495668_0140255
560 Ga0495625_0042415
561 Ga0495671_0026543
562 Ga0495636_0011105
563 Ga0495680_0564629
564 Ga0495681_0156051
565 Ga0495686_0133398
566 Ga0495686_0236934
567 Ga0495615_0024503
568 Ga0495626_0061950
569 Ga0496114_0012123
570 Ga0496114_1276849
571 Ga0501042_0063247
572 Ga0501068_0516378
573 Ga0501072_0619674
574 Ga0501073_0110325
575 Ga0501073_0646277
576 Ga0501080_0053966
577 Ga0501083_0550515
578 nmdc:mga05p37_244397_c1
579 nmdc:mga05p37_3306_c1
580 nmdc:mga09592_854_c1
581 nmdc:mga0qj67_14788_c1
582 nmdc:mga06r32_482_c2
583 nmdc:mga08y16_89435_c1
584 nmdc:mga0a205_277778_c1
585 Ga0500616_0019218
586 Ga0500637_0016479
587 Ga0530510_0718716
588 2919693432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06052

3-HAO

3-hydroxyanthranilic acid dioxygenase

43

194

0.97

PF07883

Cupin_2

Cupin domain

78

149

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hvq-assembly1.cif.gz_A x-ray crystal structure of fecu reconstituted 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9545 47 192
6bvp-assembly1.cif.gz_A crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase n27a from cupriavidus metallidurans 0.9533 47 206
5v26-assembly1.cif.gz_A 1.78 angstrom crystal structure of p97h 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9531 47 207
5v28-assembly1.cif.gz_A 2.72 angstrom crystal structure of p97a 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9522 47 206
5v27-assembly1.cif.gz_A 2.35 angstrom crystal structure of p97v 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.9511 47 206
ID Description Score Start End Superfamily
af_Q54S02_3_181_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9645 47 211 2.60.120.10
af_Q59K86_4_170_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9599 47 206 2.60.120.10
4hvqA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9545 47 192 2.60.120.10
1yfuA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.954 50 206 2.60.120.10
af_Q59K86_4_170_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9153 47 206 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V1SBC2-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) 0.9845 47 211 GO:0000334
GO:0006569
GO:0008198
GO:0019805
GO:0034354
GO:0043420
AF-A0A7Y3KMR6-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) 0.9815 47 211 GO:0000334
GO:0006569
GO:0008198
GO:0019805
GO:0034354
GO:0043420
AF-A0A1A8HMX1-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase 0.9782 48 147 GO:0000334
GO:0005506
GO:0005737
GO:0034354
GO:0046874
AF-A0A081D6S2-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase (EC 1.13.11.6) (3-hydroxyanthranilate oxygenase) (3-HAO) (3-hydroxyanthranilic acid dioxygenase) (HAD) 0.9743 43 210 GO:0000334
GO:0006569
GO:0008198
GO:0019805
GO:0034354
GO:0043420
AF-A0A699QJM9-F1-model_v4 3-hydroxyanthranilate 3,4-dioxygenase 0.9736 47 201 GO:0000334
GO:0005506
GO:0019363

Map