F391628

General Info

Members Datasets Scaffolds Average Seq Length
293 183 293 125

Family's Representative Sequence

Representative Sequence 3300042004|Ga0439445_0148497|Ga0439445_0148497_33_461
Length 142
Sequence VLELVRINLSKRGVWEMGKYVDGFVLVVPKGKEAEYQKMAEMGRDSWMKHGALQYFECKGDDLKPQEMGDEKSRAYPEMTGATSDENVWFSFIVFNSREHRDEVNKKVMEEMDESYDEQSDFVMPNDMKKMAYGGFEVAVEG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
54 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
55 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
56 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
57 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
58 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
104 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
105 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
122 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
123 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
124 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
166 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
170 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
171 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
172 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
175 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
176 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
180 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
181 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.74
Nodule 0
Rhizoplane 0.34
Rhizosphere 65.53
Stem 0
Stem Tuber 0
Unclassified 2.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10076013 3300001979 Bacteria 888
2 JGI24737J22298_10000019 3300001990 Bacteria 46349
3 JGI24735J21928_10000069 3300002067 Bacteria 42568
4 rootH2_10106823 3300003320 Bacteria 5291
5 rootL2_10068225 3300003322 Unclassified 2029
6 rootL2_10295161 3300003322 Bacteria 1560
7 JGI25405J52794_10116740 3300003911 Bacteria 600
8 Ga0070677_10096840 3300005333 Bacteria 1293
9 Ga0068869_100836115 3300005334 Bacteria 793
10 Ga0070666_10418230 3300005335 Unclassified 965
11 Ga0070666_11481159 3300005335 Bacteria 508
12 Ga0070660_100263698 3300005339 Bacteria 1407
13 Ga0070661_100002102 3300005344 Bacteria 13710
14 Ga0070668_100049590 3300005347 Bacteria 3230
15 Ga0070668_100488604 3300005347 Bacteria 1064
16 Ga0070675_101446225 3300005354 Unclassified 634
17 Ga0070671_100000001 3300005355 Bacteria 1228151
18 Ga0070659_100003665 3300005366 Bacteria 10953
19 Ga0070667_100000001 3300005367 Bacteria 1108638
20 Ga0070667_100012079 3300005367 Bacteria 7149
21 Ga0070667_100068983 3300005367 Bacteria 3009
22 Ga0070700_101095226 3300005441 Bacteria 660
23 Ga0070663_100470709 3300005455 Bacteria 1039
24 Ga0070662_100297465 3300005457 Bacteria 1310
25 Ga0068867_100203042 3300005459 Bacteria 1588
26 Ga0070685_10276613 3300005466 Bacteria 1122
27 Ga0070686_100593682 3300005544 Bacteria 872
28 Ga0068855_100000663 3300005563 Bacteria 41994
29 Ga0070664_100000060 3300005564 Bacteria 67487
30 Ga0070664_100618396 3300005564 Bacteria 1005
31 Ga0068859_100510503 3300005617 Bacteria 1297
32 Ga0068870_10297800 3300005840 Bacteria 1017
33 Ga0068860_100022202 3300005843 Bacteria 6144
34 Ga0068860_100764262 3300005843 Bacteria 978
35 Ga0068860_101353496 3300005843 Bacteria 733
36 Ga0068862_100288884 3300005844 Bacteria 1505
37 Ga0068862_100866116 3300005844 Bacteria 886
38 Ga0081455_10000001 3300005937 Bacteria 603871
39 Ga0081455_10000008 3300005937 Bacteria 256558
40 Ga0075365_10000001 3300006038 Bacteria 371589
41 Ga0075365_10000029 3300006038 Bacteria 57477
42 Ga0075365_10000098 3300006038 Bacteria 25561
43 Ga0075365_10009234 3300006038 Bacteria 5656
44 Ga0075365_10012977 3300006038 Unclassified 4969
45 Ga0075365_10176138 3300006038 Bacteria 1494
46 Ga0075365_10431674 3300006038 Bacteria 930
47 Ga0075363_100018601 3300006048 Bacteria 3465
48 Ga0075363_100304515 3300006048 Unclassified 925
49 Ga0075364_10000247 3300006051 Bacteria 26092
50 Ga0075364_10002450 3300006051 Bacteria 10395
51 Ga0075364_10008229 3300006051 Bacteria 6228
52 Ga0075364_10023967 3300006051 Bacteria 3869
53 Ga0075364_10061832 3300006051 Bacteria 2457
54 Ga0075364_11068351 3300006051 Unclassified 548
55 Ga0075362_10004619 3300006177 Bacteria 4963
56 Ga0075362_10204733 3300006177 Bacteria 961
57 Ga0075362_10452445 3300006177 Bacteria 652
58 Ga0075367_10000055 3300006178 Bacteria 27028
59 Ga0075367_10187494 3300006178 Bacteria 1290
60 Ga0075367_11099664 3300006178 Unclassified 508
61 Ga0075369_10000008 3300006186 Bacteria 97558
62 Ga0075369_10006673 3300006186 Bacteria 4375
63 Ga0075369_10055390 3300006186 Bacteria 1723
64 Ga0075366_10000012 3300006195 Bacteria 75739
65 Ga0075366_10000646 3300006195 Bacteria 16439
66 Ga0075366_10002172 3300006195 Bacteria 10007
67 Ga0075366_10058131 3300006195 Bacteria 2297
68 Ga0097621_100086018 3300006237 Bacteria 2623
69 Ga0097621_100662824 3300006237 Bacteria 958
70 Ga0097621_101238835 3300006237 Bacteria 703
71 Ga0075370_10077287 3300006353 Bacteria 1910
72 Ga0075370_10289502 3300006353 Bacteria 973
73 Ga0068871_100100466 3300006358 Bacteria 2423
74 Ga0075428_100009705 3300006844 Bacteria 10690
75 Ga0075428_100510717 3300006844 Bacteria 1286
76 Ga0075428_101234362 3300006844 Bacteria 787
77 Ga0068865_100015154 3300006881 Unclassified 4912
78 Ga0068865_100016615 3300006881 Bacteria 4713
79 Ga0097620_100510614 3300006931 Bacteria 1297
80 Ga0105240_10000003 3300009093 Bacteria 1183681
81 Ga0105240_10001357 3300009093 Bacteria 42000
82 Ga0111539_10005690 3300009094 Bacteria 16128
83 Ga0111539_11307989 3300009094 Unclassified 841
84 Ga0111539_11449527 3300009094 Bacteria 796
85 Ga0111539_11620066 3300009094 Bacteria 751
86 Ga0105245_10000034 3300009098 Bacteria 147951
87 Ga0114129_12101874 3300009147 Bacteria 681
88 Ga0105243_10000001 3300009148 Bacteria 1156578
89 Ga0105243_10003210 3300009148 Bacteria 13375
90 Ga0105241_11981891 3300009174 Bacteria 573
91 Ga0105242_10000001 3300009176 Bacteria 574039
92 Ga0105248_10717299 3300009177 Bacteria 1128
93 Ga0105237_10078612 3300009545 Bacteria 3288
94 Ga0105249_10150758 3300009553 Bacteria 2238
95 Ga0105032_100020 3300009979 Bacteria 43175
96 Ga0105032_113567 3300009979 Bacteria 651
97 Ga0105147_107590 3300009982 Bacteria 921
98 Ga0105033_100049 3300009986 Bacteria 8863
99 Ga0105030_100367 3300009987 Bacteria 3965
100 Ga0105030_101946 3300009987 Bacteria 1825
101 Ga0105035_111458 3300009988 Bacteria 786
102 Ga0105028_100043 3300009993 Bacteria 14210
103 Ga0105028_100398 3300009993 Bacteria 4661
104 Ga0105028_102184 3300009993 Bacteria 2056
105 Ga0105239_10033415 3300010375 Bacteria 5649
106 Ga0105246_10004973 3300011119 Bacteria 8093
107 Ga0105246_11060705 3300011119 Bacteria 737
108 Ga0157373_10033150 3300013100 Bacteria 3718
109 Ga0157373_10086178 3300013100 Unclassified 2213
110 Ga0157371_10000105 3300013102 Bacteria 126728
111 Ga0157371_10110351 3300013102 Bacteria 1953
112 Ga0157369_10129495 3300013105 Bacteria 2675
113 Ga0157374_10172100 3300013296 Bacteria 2113
114 Ga0157378_10037037 3300013297 Bacteria 4319
115 Ga0163162_10268931 3300013306 Bacteria 1836
116 Ga0157372_10072819 3300013307 Bacteria 3872
117 Ga0163163_10015010 3300014325 Bacteria 7142
118 Ga0157380_10816951 3300014326 Bacteria 951
119 Ga0157380_13278202 3300014326 Bacteria 517
120 Ga0207697_10246116 3300025315 Bacteria 790
121 Ga0207682_10095646 3300025893 Bacteria 1293
122 Ga0207680_10186748 3300025903 Unclassified 1405
123 Ga0207695_10000005 3300025913 Bacteria 1196715
124 Ga0207695_10004153 3300025913 Bacteria 19886
125 Ga0207671_10207194 3300025914 Bacteria 1533
126 Ga0207657_10457459 3300025919 Bacteria 1001
127 Ga0207649_10015078 3300025920 Bacteria 4340
128 Ga0207652_11172040 3300025921 Bacteria 670
129 Ga0207687_10000701 3300025927 Bacteria 22678
130 Ga0207644_10000001 3300025931 Bacteria 1243214
131 Ga0207690_10085238 3300025932 Bacteria 2217
132 Ga0207706_10423375 3300025933 Bacteria 1153
133 Ga0207686_10000001 3300025934 Bacteria 1169580
134 Ga0207686_10984904 3300025934 Bacteria 684
135 Ga0207709_10000002 3300025935 Bacteria 1171536
136 Ga0207709_10050382 3300025935 Bacteria 2546
137 Ga0207670_10485718 3300025936 Bacteria 1001
138 Ga0207704_10001832 3300025938 Bacteria 9534
139 Ga0207704_10938264 3300025938 Bacteria 729
140 Ga0207711_10537700 3300025941 Bacteria 1090
141 Ga0207689_11491690 3300025942 Bacteria 565
142 Ga0207679_10000142 3300025945 Bacteria 59334
143 Ga0207679_10523337 3300025945 Bacteria 1061
144 Ga0207667_10000756 3300025949 Bacteria 42002
145 Ga0207651_11043015 3300025960 Unclassified 732
146 Ga0207668_10506634 3300025972 Bacteria 1039
147 Ga0207658_10000003 3300025986 Bacteria 1151934
148 Ga0207658_10063051 3300025986 Bacteria 2776
149 Ga0207658_10071222 3300025986 Bacteria 2632
150 Ga0207648_10017062 3300026089 Bacteria 6619
151 Ga0207676_11049746 3300026095 Unclassified 804
152 Ga0207674_10482650 3300026116 Unclassified 1198
153 Ga0209968_1016554 3300027526 Bacteria 1172
154 Ga0210002_1004708 3300027617 Bacteria 2037
155 Ga0209813_10001566 3300027866 Unclassified 5129
156 Ga0209974_10006304 3300027876 Bacteria 4146
157 Ga0207428_10538398 3300027907 Bacteria 845
158 Ga0268265_10332448 3300028380 Bacteria 1380
159 Ga0268265_10874136 3300028380 Bacteria 881
160 Ga0268264_10017635 3300028381 Bacteria 5845
161 Ga0268264_10020826 3300028381 Bacteria 5359
162 Ga0268264_10830531 3300028381 Bacteria 924
163 Ga0268264_11309097 3300028381 Unclassified 735
164 Ga0316176_1214907 3300030732 Bacteria 1328
165 Ga0314311_1222837 3300030733 Unclassified 593
166 Ga0316183_1015314 3300030742 Bacteria 5107
167 Ga0316183_1065715 3300030742 Bacteria 7417
168 Ga0316181_1025253 3300030744 Bacteria 23214
169 Ga0316182_1244816 3300030745 Bacteria 31106
170 Ga0316182_1451305 3300030745 Bacteria 1046
171 Ga0307408_100022501 3300031548 Bacteria 4284
172 Ga0307406_10000001 3300031901 Bacteria 638191
173 Ga0307414_10000023 3300032004 Bacteria 208037
174 Ga0307414_10007271 3300032004 Bacteria 6219
175 Ga0307414_10403052 3300032004 Bacteria 1188
176 Ga0307414_11386506 3300032004 Bacteria 653
177 Ga0395900_1694677 3300037418 Bacteria 543
178 Ga0439438_009042 3300041405 Bacteria 3250
179 Ga0439447_037904 3300041407 Bacteria 1186
180 Ga0439461_0001924 3300041410 Bacteria 3273
181 Ga0439466_0030746 3300041411 Bacteria 1839
182 Ga0451807_2236018 3300041486 Bacteria 646
183 Ga0451853_3858419 3300041512 Unclassified 590
184 Ga0439431_0056961 3300041997 Bacteria 1022
185 Ga0439442_139849 3300042002 Bacteria 535
186 Ga0439445_0001920 3300042004 Bacteria 4584
187 Ga0439445_0148497 3300042004 Bacteria 682
188 Ga0439432_000494 3300042006 Bacteria 14714
189 Ga0439452_116997 3300042010 Bacteria 568
190 Ga0439457_156644 3300042014 Bacteria 549
191 Ga0450919_030215 3300042121 Bacteria 620
192 Ga0439446_0005200 3300042156 Bacteria 3337
193 Ga0439434_0001631 3300042435 Bacteria 6484
194 Ga0450893_0068824 3300042532 Bacteria 685
195 Ga0451577_0765248 3300042876 Bacteria 873
196 Ga0453683_0003285 3300044673 Bacteria 12002
197 Ga0453683_0313072 3300044673 Bacteria 1005
198 Ga0453683_0316692 3300044673 Unclassified 999
199 Ga0453684_0003629 3300044712 Bacteria 34363
200 Ga0453684_0040562 3300044712 Bacteria 6318
201 Ga0453684_0044716 3300044712 Archaea 5919
202 Ga0453684_0387631 3300044712 Bacteria 1568
203 Ga0451576_0004675 3300045051 Bacteria 17630
204 Ga0451576_1056064 3300045051 Bacteria 851
205 Ga0451576_1086386 3300045051 Archaea 837
206 Ga0495638_0000108 3300046460 Bacteria 132914
207 Ga0495583_0021505 3300046506 Bacteria 3317
208 Ga0495672_0307203 3300047320 Bacteria 749
209 Ga0496118_0078479 3300048921 Bacteria 2336
210 Ga0496124_0222595 3300048927 Bacteria 1418
211 Ga0496125_0225512 3300048928 Unclassified 1203
212 Ga0501033_0689758 3300049570 Bacteria 695
213 Ga0501034_0001886 3300049571 Bacteria 26544
214 Ga0501034_0241852 3300049571 Bacteria 1751
215 Ga0501036_0201984 3300049572 Bacteria 1672
216 Ga0501036_0394649 3300049572 Unclassified 1154
217 Ga0501046_0073776 3300049580 Bacteria 2648
218 Ga0501047_0000310 3300049581 Bacteria 56101
219 Ga0501047_0229943 3300049581 Bacteria 1708
220 Ga0501048_0095898 3300049582 Bacteria 2092
221 Ga0501070_0037850 3300049586 Bacteria 4026
222 Ga0501080_0000520 3300049742 Bacteria 30275
223 Ga0501276_000337 3300049773 Unclassified 2786
224 Ga0501035_0000005 3300049822 Bacteria 392980
225 Ga0501035_0107877 3300049822 Bacteria 2441
226 Ga0501044_0053488 3300049823 Bacteria 4154
227 Ga0501044_0122826 3300049823 Unclassified 2596
228 Ga0501045_0323934 3300049824 Unclassified 1147
229 nmdc:mga03683_1757_c2 3300050489 Bacteria 5411
230 nmdc:mga03683_239925_c1 3300050489 Bacteria 840
231 nmdc:mga03683_277309_c1 3300050489 Bacteria 783
232 nmdc:mga03n38_33577_c1 3300050490 Unclassified 2184
233 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
234 nmdc:mga00v17_1244_c1 3300050491 Bacteria 13338
235 nmdc:mga00v17_1523_c1 3300050491 Bacteria 12097
236 nmdc:mga00v17_172_c1 3300050491 Bacteria 37851
237 nmdc:mga00v17_8738_c1 3300050491 Bacteria 5456
238 nmdc:mga0yw44_145836_c1 3300050492 Bacteria 1541
239 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
240 nmdc:mga0yw44_399533_c1 3300050492 Bacteria 929
241 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
242 nmdc:mga0yw44_4266_c1 3300050492 Bacteria 6519
243 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
244 nmdc:mga0k408_10_c3 3300050493 Bacteria 47011
245 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
246 nmdc:mga0k408_2066_c1 3300050493 Bacteria 10743
247 nmdc:mga0k408_24366_c1 3300050493 Bacteria 3420
248 nmdc:mga0k408_27948_c1 3300050493 Bacteria 3205
249 nmdc:mga06z11_2231_c1 3300050494 Bacteria 7371
250 nmdc:mga04h51_1691_c1 3300050495 Bacteria 5149
251 nmdc:mga07m45_20608_c1 3300050496 Viruses 3086
252 nmdc:mga07m45_2409_c1 3300050496 Bacteria 8772
253 nmdc:mga07m45_29852_c1 3300050496 Bacteria 1850
254 nmdc:mga08y16_3563_c1 3300050511 Bacteria 16166
255 nmdc:mga0sz30_131942_c1 3300050516 Bacteria 1101
256 nmdc:mga0sz30_13778_c1 3300050516 Bacteria 3171
257 nmdc:mga0sz30_3_c8 3300050516 Bacteria 110150
258 nmdc:mga0sz30_7037_c1 3300050516 Bacteria 4206
259 Ga0500643_000022 3300053087 Bacteria 277519
260 Ga0500643_000202 3300053087 Bacteria 56591
261 Ga0500644_0000627 3300053088 Bacteria 13205
262 Ga0500646_0000007 3300053090 Bacteria 115744
263 Ga0500583_0014598 3300053092 Bacteria 3082
264 Ga0500651_0000098 3300053093 Bacteria 53738
265 Ga0500651_0658810 3300053093 Bacteria 563
266 Ga0500650_0125429 3300053098 Unclassified 1195
267 Ga0500555_000009 3300053103 Bacteria 263998
268 Ga0500555_011932 3300053103 Bacteria 2497
269 Ga0500555_108018 3300053103 Bacteria 702
270 Ga0500556_0241214 3300053104 Bacteria 712
271 Ga0500562_000002 3300053108 Bacteria 977234
272 Ga0500593_000001 3300053117 Bacteria 784404
273 Ga0500594_0005796 3300053118 Unclassified 2749
274 Ga0500628_000008 3300053129 Bacteria 151664
275 Ga0500628_000152 3300053129 Bacteria 13235
276 Ga0500652_166394 3300053131 Bacteria 909
277 Ga0500568_0003867 3300053139 Bacteria 8165
278 Ga0500568_0010469 3300053139 Bacteria 4343
279 Ga0500568_0087036 3300053139 Bacteria 1181
280 Ga0500568_0318182 3300053139 Bacteria 564
281 Ga0500577_0001061 3300053142 Bacteria 7083
282 Ga0500589_102040 3300053147 Bacteria 1244
283 Ga0500603_011762 3300053150 Unclassified 1999
284 Ga0500604_0080020 3300053151 Bacteria 1054
285 Ga0500616_0000005 3300053153 Bacteria 961725
286 Ga0500616_0000012 3300053153 Bacteria 681798
287 Ga0500616_0091195 3300053153 Bacteria 1509
288 Ga0500620_065975 3300053155 Bacteria 1239
289 Ga0500570_000069 3300053724 Bacteria 26960
290 Ga0500570_059359 3300053724 Bacteria 1863
291 Ga0500599_020710 3300053736 Bacteria 932
292 Ga0501084_0561055 3300054114 Bacteria 965
293 Ga0501082_1552008 3300060353 Bacteria 578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0053488 Ga0501044_0053488_2345_2668 105
2 3300009982 Ga0105147_107590 Ga0105147_1075902 113
3 3300053103 Ga0500555_011932 Ga0500555_011932_1562_1939 114
4 3300030732 Ga0316176_1214907 Ga0316176_12149073 115
5 3300030742 Ga0316183_1015314 Ga0316183_10153149 115
6 3300030744 Ga0316181_1025253 Ga0316181_10252536 115
7 3300030745 Ga0316182_1244816 Ga0316182_12448161 115
8 3300042002 Ga0439442_139849 Ga0439442_139849_161_508 115
9 3300053093 Ga0500651_0658810 Ga0500651_0658810_39_386 115
10 3300009979 Ga0105032_113567 Ga0105032_1135671 116
11 3300030745 Ga0316182_1451305 Ga0316182_14513052 117
12 3300049570 Ga0501033_0689758 Ga0501033_0689758_176_538 117
13 3300049571 Ga0501034_0241852 Ga0501034_0241852_597_956 117
14 3300049572 Ga0501036_0201984 Ga0501036_0201984_66_425 117
15 3300049580 Ga0501046_0073776 Ga0501046_0073776_2123_2482 117
16 3300049581 Ga0501047_0229943 Ga0501047_0229943_1310_1669 117
17 3300049586 Ga0501070_0037850 Ga0501070_0037850_1113_1472 117
18 3300049822 Ga0501035_0107877 Ga0501035_0107877_1934_2293 117
19 3300005441 Ga0070700_101095226 Ga0070700_1010952261 118
20 3300031548 Ga0307408_100022501 Ga0307408_1000225014 118
21 3300032004 Ga0307414_10000023 Ga0307414_1000002393 118
22 3300032004 Ga0307414_10007271 Ga0307414_100072717 118
23 3300032004 Ga0307414_10403052 Ga0307414_104030521 118
24 3300042532 Ga0450893_0068824 Ga0450893_0068824_204_572 118
25 3300049824 Ga0501045_0323934 Ga0501045_0323934_329_691 118
26 3300009094 Ga0111539_11307989 Ga0111539_113079892 119
27 3300026095 Ga0207676_11049746 Ga0207676_110497461 119
28 3300041405 Ga0439438_009042 Ga0439438_009042_818_1198 119
29 3300041407 Ga0439447_037904 Ga0439447_037904_402_782 119
30 3300041410 Ga0439461_0001924 Ga0439461_0001924_2845_3225 119
31 3300041411 Ga0439466_0030746 Ga0439466_0030746_429_809 119
32 3300041997 Ga0439431_0056961 Ga0439431_0056961_257_637 119
33 3300042010 Ga0439452_116997 Ga0439452_116997_107_487 119
34 3300042014 Ga0439457_156644 Ga0439457_156644_90_470 119
35 3300042121 Ga0450919_030215 Ga0450919_030215_122_502 119
36 3300042156 Ga0439446_0005200 Ga0439446_0005200_112_492 119
37 3300042435 Ga0439434_0001631 Ga0439434_0001631_679_1059 119
38 3300025960 Ga0207651_11043015 Ga0207651_110430151 120
39 3300026116 Ga0207674_10482650 Ga0207674_104826501 120
40 3300044712 Ga0453684_0040562 Ga0453684_0040562_4188_4568 120
41 3300044712 Ga0453684_0044716 Ga0453684_0044716_2433_2804 120
42 3300053092 Ga0500583_0014598 Ga0500583_0014598_2319_2699 121
43 3300053147 Ga0500589_102040 Ga0500589_102040_670_1050 121
44 3300003320 rootH2_10106823 rootH2_101068235 124
45 3300009979 Ga0105032_100020 Ga0105032_10002040 124
46 3300009986 Ga0105033_100049 Ga0105033_1000493 124
47 3300009988 Ga0105035_111458 Ga0105035_1114581 124
48 3300030742 Ga0316183_1065715 Ga0316183_10657152 124
49 3300048921 Ga0496118_0078479 Ga0496118_0078479_1866_2240 124
50 3300005843 Ga0068860_100764262 Ga0068860_1007642622 125
51 3300009993 Ga0105028_100043 Ga0105028_1000434 125
52 3300028381 Ga0268264_10830531 Ga0268264_108305312 125
53 3300044673 Ga0453683_0003285 Ga0453683_0003285_11447_11824 125
54 3300044673 Ga0453683_0316692 Ga0453683_0316692_41_418 125
55 3300045051 Ga0451576_1086386 Ga0451576_1086386_222_599 125
56 3300001979 JGI24740J21852_10076013 JGI24740J21852_100760131 126
57 3300001990 JGI24737J22298_10000019 JGI24737J22298_100000199 126
58 3300002067 JGI24735J21928_10000069 JGI24735J21928_1000006927 126
59 3300003322 rootL2_10068225 rootL2_100682252 126
60 3300003322 rootL2_10295161 rootL2_102951612 126
61 3300003911 JGI25405J52794_10116740 JGI25405J52794_101167401 126
62 3300005333 Ga0070677_10096840 Ga0070677_100968402 126
63 3300005334 Ga0068869_100836115 Ga0068869_1008361151 126
64 3300005335 Ga0070666_10418230 Ga0070666_104182302 126
65 3300005335 Ga0070666_11481159 Ga0070666_114811591 126
66 3300005339 Ga0070660_100263698 Ga0070660_1002636981 126
67 3300005344 Ga0070661_100002102 Ga0070661_1000021021 126
68 3300005347 Ga0070668_100049590 Ga0070668_1000495904 126
69 3300005347 Ga0070668_100488604 Ga0070668_1004886042 126
70 3300005354 Ga0070675_101446225 Ga0070675_1014462251 126
71 3300005355 Ga0070671_100000001 Ga0070671_100000001790 126
72 3300005366 Ga0070659_100003665 Ga0070659_10000366513 126
73 3300005367 Ga0070667_100000001 Ga0070667_100000001503 126
74 3300005367 Ga0070667_100012079 Ga0070667_1000120792 126
75 3300005367 Ga0070667_100068983 Ga0070667_1000689837 126
76 3300005455 Ga0070663_100470709 Ga0070663_1004707092 126
77 3300005457 Ga0070662_100297465 Ga0070662_1002974652 126
78 3300005459 Ga0068867_100203042 Ga0068867_1002030422 126
79 3300005466 Ga0070685_10276613 Ga0070685_102766131 126
80 3300005544 Ga0070686_100593682 Ga0070686_1005936822 126
81 3300005563 Ga0068855_100000663 Ga0068855_10000066315 126
82 3300005564 Ga0070664_100000060 Ga0070664_1000000607 126
83 3300005564 Ga0070664_100618396 Ga0070664_1006183961 126
84 3300005617 Ga0068859_100510503 Ga0068859_1005105033 126
85 3300005840 Ga0068870_10297800 Ga0068870_102978002 126
86 3300005843 Ga0068860_100022202 Ga0068860_1000222029 126
87 3300005843 Ga0068860_101353496 Ga0068860_1013534961 126
88 3300005844 Ga0068862_100288884 Ga0068862_1002888841 126
89 3300005844 Ga0068862_100866116 Ga0068862_1008661162 126
90 3300005937 Ga0081455_10000001 Ga0081455_10000001337 126
91 3300005937 Ga0081455_10000008 Ga0081455_1000000825 126
92 3300006038 Ga0075365_10000001 Ga0075365_1000000163 126
93 3300006038 Ga0075365_10000029 Ga0075365_1000002954 126
94 3300006038 Ga0075365_10000098 Ga0075365_1000009820 126
95 3300006038 Ga0075365_10009234 Ga0075365_100092345 126
96 3300006038 Ga0075365_10012977 Ga0075365_100129777 126
97 3300006038 Ga0075365_10176138 Ga0075365_101761382 126
98 3300006038 Ga0075365_10431674 Ga0075365_104316742 126
99 3300006048 Ga0075363_100018601 Ga0075363_1000186012 126
100 3300006048 Ga0075363_100304515 Ga0075363_1003045152 126
101 3300006051 Ga0075364_10000247 Ga0075364_1000024731 126
102 3300006051 Ga0075364_10002450 Ga0075364_100024506 126
103 3300006051 Ga0075364_10008229 Ga0075364_100082294 126
104 3300006051 Ga0075364_10023967 Ga0075364_100239675 126
105 3300006051 Ga0075364_10061832 Ga0075364_100618322 126
106 3300006051 Ga0075364_11068351 Ga0075364_110683512 126
107 3300006177 Ga0075362_10004619 Ga0075362_100046193 126
108 3300006177 Ga0075362_10204733 Ga0075362_102047331 126
109 3300006177 Ga0075362_10452445 Ga0075362_104524451 126
110 3300006178 Ga0075367_10000055 Ga0075367_100000552 126
111 3300006178 Ga0075367_10187494 Ga0075367_101874942 126
112 3300006178 Ga0075367_11099664 Ga0075367_110996641 126
113 3300006186 Ga0075369_10000008 Ga0075369_1000000885 126
114 3300006186 Ga0075369_10006673 Ga0075369_100066738 126
115 3300006186 Ga0075369_10055390 Ga0075369_100553902 126
116 3300006195 Ga0075366_10000012 Ga0075366_1000001237 126
117 3300006195 Ga0075366_10000646 Ga0075366_1000064611 126
118 3300006195 Ga0075366_10002172 Ga0075366_100021728 126
119 3300006195 Ga0075366_10058131 Ga0075366_100581313 126
120 3300006237 Ga0097621_100086018 Ga0097621_1000860182 126
121 3300006237 Ga0097621_100662824 Ga0097621_1006628241 126
122 3300006237 Ga0097621_101238835 Ga0097621_1012388352 126
123 3300006353 Ga0075370_10077287 Ga0075370_100772872 126
124 3300006353 Ga0075370_10289502 Ga0075370_102895022 126
125 3300006358 Ga0068871_100100466 Ga0068871_1001004662 126
126 3300006844 Ga0075428_100009705 Ga0075428_10000970510 126
127 3300006844 Ga0075428_100510717 Ga0075428_1005107172 126
128 3300006844 Ga0075428_101234362 Ga0075428_1012343621 126
129 3300006881 Ga0068865_100015154 Ga0068865_1000151542 126
130 3300006881 Ga0068865_100016615 Ga0068865_1000166156 126
131 3300006931 Ga0097620_100510614 Ga0097620_1005106143 126
132 3300009093 Ga0105240_10000003 Ga0105240_10000003376 126
133 3300009093 Ga0105240_10001357 Ga0105240_1000135715 126
134 3300009094 Ga0111539_10005690 Ga0111539_1000569020 126
135 3300009094 Ga0111539_11449527 Ga0111539_114495271 126
136 3300009094 Ga0111539_11620066 Ga0111539_116200662 126
137 3300009098 Ga0105245_10000034 Ga0105245_1000003489 126
138 3300009147 Ga0114129_12101874 Ga0114129_121018741 126
139 3300009148 Ga0105243_10000001 Ga0105243_10000001874 126
140 3300009148 Ga0105243_10003210 Ga0105243_1000321020 126
141 3300009174 Ga0105241_11981891 Ga0105241_119818911 126
142 3300009176 Ga0105242_10000001 Ga0105242_10000001385 126
143 3300009177 Ga0105248_10717299 Ga0105248_107172992 126
144 3300009545 Ga0105237_10078612 Ga0105237_100786122 126
145 3300009553 Ga0105249_10150758 Ga0105249_101507582 126
146 3300009987 Ga0105030_100367 Ga0105030_1003671 126
147 3300009987 Ga0105030_101946 Ga0105030_1019461 126
148 3300009993 Ga0105028_100398 Ga0105028_1003982 126
149 3300009993 Ga0105028_102184 Ga0105028_1021842 126
150 3300010375 Ga0105239_10033415 Ga0105239_100334156 126
151 3300011119 Ga0105246_10004973 Ga0105246_100049737 126
152 3300011119 Ga0105246_11060705 Ga0105246_110607051 126
153 3300013100 Ga0157373_10033150 Ga0157373_100331502 126
154 3300013100 Ga0157373_10086178 Ga0157373_100861783 126
155 3300013102 Ga0157371_10000105 Ga0157371_10000105102 126
156 3300013102 Ga0157371_10110351 Ga0157371_101103512 126
157 3300013105 Ga0157369_10129495 Ga0157369_101294955 126
158 3300013296 Ga0157374_10172100 Ga0157374_101721003 126
159 3300013297 Ga0157378_10037037 Ga0157378_100370374 126
160 3300013306 Ga0163162_10268931 Ga0163162_102689312 126
161 3300013307 Ga0157372_10072819 Ga0157372_100728196 126
162 3300014325 Ga0163163_10015010 Ga0163163_100150104 126
163 3300014326 Ga0157380_10816951 Ga0157380_108169513 126
164 3300014326 Ga0157380_13278202 Ga0157380_132782021 126
165 3300025315 Ga0207697_10246116 Ga0207697_102461161 126
166 3300025893 Ga0207682_10095646 Ga0207682_100956462 126
167 3300025903 Ga0207680_10186748 Ga0207680_101867482 126
168 3300025913 Ga0207695_10000005 Ga0207695_10000005384 126
169 3300025913 Ga0207695_10004153 Ga0207695_100041533 126
170 3300025914 Ga0207671_10207194 Ga0207671_102071943 126
171 3300025919 Ga0207657_10457459 Ga0207657_104574591 126
172 3300025920 Ga0207649_10015078 Ga0207649_100150781 126
173 3300025921 Ga0207652_11172040 Ga0207652_111720401 126
174 3300025927 Ga0207687_10000701 Ga0207687_100007016 126
175 3300025931 Ga0207644_10000001 Ga0207644_10000001645 126
176 3300025932 Ga0207690_10085238 Ga0207690_100852382 126
177 3300025933 Ga0207706_10423375 Ga0207706_104233752 126
178 3300025934 Ga0207686_10000001 Ga0207686_10000001267 126
179 3300025934 Ga0207686_10984904 Ga0207686_109849042 126
180 3300025935 Ga0207709_10000002 Ga0207709_10000002384 126
181 3300025935 Ga0207709_10050382 Ga0207709_100503825 126
182 3300025936 Ga0207670_10485718 Ga0207670_104857182 126
183 3300025938 Ga0207704_10001832 Ga0207704_1000183215 126
184 3300025938 Ga0207704_10938264 Ga0207704_109382642 126
185 3300025941 Ga0207711_10537700 Ga0207711_105377003 126
186 3300025942 Ga0207689_11491690 Ga0207689_114916902 126
187 3300025945 Ga0207679_10000142 Ga0207679_1000014269 126
188 3300025945 Ga0207679_10523337 Ga0207679_105233372 126
189 3300025949 Ga0207667_10000756 Ga0207667_1000075615 126
190 3300025972 Ga0207668_10506634 Ga0207668_105066342 126
191 3300025986 Ga0207658_10000003 Ga0207658_10000003877 126
192 3300025986 Ga0207658_10063051 Ga0207658_100630514 126
193 3300025986 Ga0207658_10071222 Ga0207658_100712222 126
194 3300026089 Ga0207648_10017062 Ga0207648_100170622 126
195 3300027526 Ga0209968_1016554 Ga0209968_10165541 126
196 3300027617 Ga0210002_1004708 Ga0210002_10047083 126
197 3300027866 Ga0209813_10001566 Ga0209813_100015665 126
198 3300027876 Ga0209974_10006304 Ga0209974_100063043 126
199 3300027907 Ga0207428_10538398 Ga0207428_105383981 126
200 3300028380 Ga0268265_10332448 Ga0268265_103324481 126
201 3300028380 Ga0268265_10874136 Ga0268265_108741362 126
202 3300028381 Ga0268264_10017635 Ga0268264_100176357 126
203 3300028381 Ga0268264_10020826 Ga0268264_100208265 126
204 3300028381 Ga0268264_11309097 Ga0268264_113090971 126
205 3300030733 Ga0314311_1222837 Ga0314311_12228371 126
206 3300031901 Ga0307406_10000001 Ga0307406_10000001237 126
207 3300032004 Ga0307414_11386506 Ga0307414_113865061 126
208 3300037418 Ga0395900_1694677 Ga0395900_1694677_29_409 126
209 3300041486 Ga0451807_2236018 Ga0451807_2236018_94_474 126
210 3300041512 Ga0451853_3858419 Ga0451853_3858419_173_553 126
211 3300042004 Ga0439445_0001920 Ga0439445_0001920_533_913 126
212 3300042004 Ga0439445_0148497 Ga0439445_0148497_33_461 126
213 3300042006 Ga0439432_000494 Ga0439432_000494_9832_10212 126
214 3300042876 Ga0451577_0765248 Ga0451577_0765248_192_572 126
215 3300044673 Ga0453683_0313072 Ga0453683_0313072_537_917 126
216 3300044712 Ga0453684_0003629 Ga0453684_0003629_12259_12639 126
217 3300044712 Ga0453684_0387631 Ga0453684_0387631_501_881 126
218 3300045051 Ga0451576_0004675 Ga0451576_0004675_15335_15715 126
219 3300045051 Ga0451576_1056064 Ga0451576_1056064_318_698 126
220 3300046460 Ga0495638_0000108 Ga0495638_0000108_74629_75009 126
221 3300046506 Ga0495583_0021505 Ga0495583_0021505_2356_2736 126
222 3300047320 Ga0495672_0307203 Ga0495672_0307203_198_587 126
223 3300048927 Ga0496124_0222595 Ga0496124_0222595_696_1076 126
224 3300048928 Ga0496125_0225512 Ga0496125_0225512_424_804 126
225 3300049571 Ga0501034_0001886 Ga0501034_0001886_11468_11848 126
226 3300049572 Ga0501036_0394649 Ga0501036_0394649_352_732 126
227 3300049581 Ga0501047_0000310 Ga0501047_0000310_4517_4897 126
228 3300049582 Ga0501048_0095898 Ga0501048_0095898_1679_2059 126
229 3300049742 Ga0501080_0000520 Ga0501080_0000520_6010_6390 126
230 3300049773 Ga0501276_000337 Ga0501276_000337_772_1152 126
231 3300049822 Ga0501035_0000005 Ga0501035_0000005_390647_391027 126
232 3300049823 Ga0501044_0122826 Ga0501044_0122826_1416_1796 126
233 3300050489 nmdc:mga03683_1757_c2 nmdc:mga03683_1757_c2_2882_3262 126
234 3300050489 nmdc:mga03683_239925_c1 nmdc:mga03683_239925_c1_183_563 126
235 3300050489 nmdc:mga03683_277309_c1 nmdc:mga03683_277309_c1_130_510 126
236 3300050490 nmdc:mga03n38_33577_c1 nmdc:mga03n38_33577_c1_83_466 126
237 3300050491 nmdc:mga00v17_120_c1 nmdc:mga00v17_120_c1_43093_43476 126
238 3300050491 nmdc:mga00v17_1244_c1 nmdc:mga00v17_1244_c1_7119_7499 126
239 3300050491 nmdc:mga00v17_1523_c1 nmdc:mga00v17_1523_c1_10795_11175 126
240 3300050491 nmdc:mga00v17_172_c1 nmdc:mga00v17_172_c1_2938_3324 126
241 3300050491 nmdc:mga00v17_8738_c1 nmdc:mga00v17_8738_c1_546_971 126
242 3300050492 nmdc:mga0yw44_145836_c1 nmdc:mga0yw44_145836_c1_807_1187 126
243 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_162854_163234 126
244 3300050492 nmdc:mga0yw44_399533_c1 nmdc:mga0yw44_399533_c1_234_614 126
245 3300050492 nmdc:mga0yw44_3_c1 nmdc:mga0yw44_3_c1_38333_38713 126
246 3300050492 nmdc:mga0yw44_4266_c1 nmdc:mga0yw44_4266_c1_3345_3731 126
247 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_304025_304408 126
248 3300050493 nmdc:mga0k408_10_c3 nmdc:mga0k408_10_c3_40654_41034 126
249 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_449328_449708 126
250 3300050493 nmdc:mga0k408_2066_c1 nmdc:mga0k408_2066_c1_4023_4403 126
251 3300050493 nmdc:mga0k408_24366_c1 nmdc:mga0k408_24366_c1_1374_1754 126
252 3300050493 nmdc:mga0k408_27948_c1 nmdc:mga0k408_27948_c1_157_564 126
253 3300050494 nmdc:mga06z11_2231_c1 nmdc:mga06z11_2231_c1_4012_4395 126
254 3300050495 nmdc:mga04h51_1691_c1 nmdc:mga04h51_1691_c1_2425_2808 126
255 3300050496 nmdc:mga07m45_20608_c1 nmdc:mga07m45_20608_c1_520_900 126
256 3300050496 nmdc:mga07m45_2409_c1 nmdc:mga07m45_2409_c1_6751_7134 126
257 3300050496 nmdc:mga07m45_29852_c1 nmdc:mga07m45_29852_c1_713_1093 126
258 3300050511 nmdc:mga08y16_3563_c1 nmdc:mga08y16_3563_c1_14000_14380 126
259 3300050516 nmdc:mga0sz30_131942_c1 nmdc:mga0sz30_131942_c1_533_913 126
260 3300050516 nmdc:mga0sz30_13778_c1 nmdc:mga0sz30_13778_c1_1000_1380 126
261 3300050516 nmdc:mga0sz30_3_c8 nmdc:mga0sz30_3_c8_67980_68360 126
262 3300050516 nmdc:mga0sz30_7037_c1 nmdc:mga0sz30_7037_c1_3659_4042 126
263 3300053087 Ga0500643_000022 Ga0500643_000022_123081_123461 126
264 3300053087 Ga0500643_000202 Ga0500643_000202_29280_29660 126
265 3300053088 Ga0500644_0000627 Ga0500644_0000627_7782_8162 126
266 3300053090 Ga0500646_0000007 Ga0500646_0000007_39555_39935 126
267 3300053093 Ga0500651_0000098 Ga0500651_0000098_24208_24588 126
268 3300053098 Ga0500650_0125429 Ga0500650_0125429_754_1134 126
269 3300053103 Ga0500555_000009 Ga0500555_000009_240093_240473 126
270 3300053103 Ga0500555_108018 Ga0500555_108018_300_680 126
271 3300053104 Ga0500556_0241214 Ga0500556_0241214_129_509 126
272 3300053108 Ga0500562_000002 Ga0500562_000002_671536_671916 126
273 3300053117 Ga0500593_000001 Ga0500593_000001_705011_705391 126
274 3300053118 Ga0500594_0005796 Ga0500594_0005796_1267_1647 126
275 3300053129 Ga0500628_000008 Ga0500628_000008_31682_32062 126
276 3300053129 Ga0500628_000152 Ga0500628_000152_6932_7312 126
277 3300053131 Ga0500652_166394 Ga0500652_166394_151_531 126
278 3300053139 Ga0500568_0003867 Ga0500568_0003867_4453_4833 126
279 3300053139 Ga0500568_0010469 Ga0500568_0010469_759_1139 126
280 3300053139 Ga0500568_0087036 Ga0500568_0087036_167_547 126
281 3300053139 Ga0500568_0318182 Ga0500568_0318182_48_428 126
282 3300053142 Ga0500577_0001061 Ga0500577_0001061_3990_4370 126
283 3300053150 Ga0500603_011762 Ga0500603_011762_10_390 126
284 3300053151 Ga0500604_0080020 Ga0500604_0080020_560_940 126
285 3300053153 Ga0500616_0000005 Ga0500616_0000005_251431_251811 126
286 3300053153 Ga0500616_0000012 Ga0500616_0000012_369430_369810 126
287 3300053153 Ga0500616_0091195 Ga0500616_0091195_204_584 126
288 3300053155 Ga0500620_065975 Ga0500620_065975_386_766 126
289 3300053724 Ga0500570_000069 Ga0500570_000069_708_1088 126
290 3300053724 Ga0500570_059359 Ga0500570_059359_838_1218 126
291 3300053736 Ga0500599_020710 Ga0500599_020710_447_827 126
292 3300054114 Ga0501084_0561055 Ga0501084_0561055_186_566 126
293 3300060353 Ga0501082_1552008 Ga0501082_1552008_138_518 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

19

128

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8822 2 126
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8748 2 126
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8113 2 126
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8097 2 126
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.7855 1 125
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8667 3 126 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.853 3 126 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7855 1 125 3.30.70.100
1xbwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7581 2 126 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7566 1 125 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1F2UIB8-F1-model_v4 DUF1428 domain-containing protein 0.9782 1 126
AF-A0A0G1BE14-F1-model_v4 DUF1428 domain-containing protein 0.9577 3 93
AF-K2C123-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9495 1 126
AF-A0A3A4V003-F1-model_v4 DUF1428 domain-containing protein 0.9406 3 125
AF-A0A2W6TVG0-F1-model_v4 DUF1428 domain-containing protein 0.9377 3 93

Feature Viewer

pLDDT pTM Quality
92.53 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map