F391600

General Info

Members Datasets Scaffolds Average Seq Length
293 223 265 325

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0011040|Ga0373925_0011040_5218_6351
Length 377
Sequence MAVARHLTALEWAEGCAGNVREPAKMLVDWPYKKRANRSGFSLRGGNFMDPSRRNAILGTAAVAAAPLLTSTQIRAEAPAADKQAPSFYRYKVGDIIVTVVSDGKNVFPLTDAFIPNAKKDDINAALEKAFMPRDMVTIWFAPLVIQSGGKVIVIDTGTGPVAKANSKGANGLFVDNMIAAGFDPKAVDMVVISHFHTDHVNGLLAADGTPAFANAEVLVPAAEWKFWSDDGEMSRAKGDRMVGLFKSNRNVFENGLKKKVTPYEWHKEIAPGLTAVETTGHTPGHTSYLLSSGSGKVFIQSDVTNNPNLFAANPGWRGAFDQDGEMAEKTRRRVYDMVVAEKLLVQGFHYPFPGLGNVVKDGDGYRVIPTPWNPVI

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
7 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
8 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
9 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
10 2904699407
11 2906610324
12 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
13 2922425934
14 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
15 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
16 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
17 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
18 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
19 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
20 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
21 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
75 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
76 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
129 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
214 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
215 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
216 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
217 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
218 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
219 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
220 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
221 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
222 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
223 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.03
Metatranscriptomes 1.03
Isolates 7.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.6
Nodule 8.19
Rhizoplane 2.73
Rhizosphere 73.72
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10000225 3300003659 Bacteria 6962
2 Ga0058862_12551834 3300004803 Bacteria 1219
3 Ga0065712_10133578 3300005290 Bacteria 1507
4 Ga0070683_100130279 3300005329 Bacteria 2380
5 Ga0070670_100090557 3300005331 Bacteria 2629
6 Ga0068869_100078280 3300005334 Bacteria 2462
7 Ga0070680_100152400 3300005336 Bacteria 1941
8 Ga0070682_100288000 3300005337 Bacteria 1200
9 Ga0068868_100224978 3300005338 Bacteria 1572
10 Ga0070689_100117881 3300005340 Bacteria 2118
11 Ga0070709_10012838 3300005434 Bacteria 4696
12 Ga0070714_100030514 3300005435 Bacteria 4487
13 Ga0070714_100040157 3300005435 Bacteria 3943
14 Ga0070714_100088868 3300005435 Bacteria 2704
15 Ga0070713_100010599 3300005436 Bacteria 6667
16 Ga0070713_100038449 3300005436 Bacteria 3877
17 Ga0070713_100064587 3300005436 Bacteria 3073
18 Ga0070713_100211243 3300005436 Bacteria 1757
19 Ga0070710_10028027 3300005437 Bacteria 3009
20 Ga0070711_100009552 3300005439 Bacteria 5982
21 Ga0070711_100015580 3300005439 Bacteria 4812
22 Ga0070708_100285936 3300005445 Bacteria 1552
23 Ga0070663_100052277 3300005455 Bacteria 2913
24 Ga0070681_10148355 3300005458 Bacteria 2273
25 Ga0070706_100322391 3300005467 Bacteria 1441
26 Ga0070698_100064913 3300005471 Bacteria 3677
27 Ga0070679_100121903 3300005530 Bacteria 2592
28 Ga0070679_100395887 3300005530 Bacteria 1327
29 Ga0070684_100171666 3300005535 Bacteria 1969
30 Ga0068857_100022478 3300005577 Bacteria 5549
31 Ga0068856_100000451 3300005614 Bacteria 45442
32 Ga0068856_100038993 3300005614 Bacteria 4665
33 Ga0070702_100030348 3300005615 Bacteria 2947
34 Ga0068852_100067584 3300005616 Bacteria 3125
35 Ga0068859_100188691 3300005617 Bacteria 2145
36 Ga0068861_100050943 3300005719 Bacteria 3141
37 Ga0068863_100205125 3300005841 Bacteria 1897
38 Ga0068860_100149055 3300005843 Bacteria 2252
39 Ga0081455_10009701 3300005937 Bacteria 9871
40 Ga0081455_10121167 3300005937 Bacteria 2061
41 Ga0081455_10219861 3300005937 Bacteria 1408
42 Ga0081540_1000045 3300005983 Bacteria 134124
43 Ga0081540_1015402 3300005983 Bacteria 4843
44 Ga0081539_10003563 3300005985 Bacteria 18911
45 Ga0070717_10087902 3300006028 Bacteria 2618
46 Ga0075365_10267059 3300006038 Bacteria 1203
47 Ga0075368_10056349 3300006042 Bacteria 1568
48 Ga0075363_100007678 3300006048 Bacteria 4975
49 Ga0075364_10000739 3300006051 Bacteria 17119
50 Ga0075432_10035886 3300006058 Bacteria 1722
51 Ga0070716_100005883 3300006173 Bacteria 5965
52 Ga0070712_100053156 3300006175 Bacteria 2828
53 Ga0075362_10002626 3300006177 Bacteria 6087
54 Ga0075367_10031580 3300006178 Bacteria 3042
55 Ga0075367_10212063 3300006178 Bacteria 1211
56 Ga0075369_10056893 3300006186 Bacteria 1700
57 Ga0075369_10056895 3300006186 Bacteria 1700
58 Ga0075366_10001614 3300006195 Bacteria 11295
59 Ga0075366_10004105 3300006195 Bacteria 7791
60 Ga0097621_100317977 3300006237 Bacteria 1378
61 Ga0075428_100189269 3300006844 Bacteria 2226
62 Ga0075428_100412378 3300006844 Unclassified 1447
63 Ga0075430_100000082 3300006846 Bacteria 53500
64 Ga0075430_100209132 3300006846 Bacteria 1619
65 Ga0075431_100101969 3300006847 Bacteria 2962
66 Ga0075431_100141651 3300006847 Bacteria 2478
67 Ga0075431_100158358 3300006847 Bacteria 2329
68 Ga0075433_10100121 3300006852 Bacteria 2566
69 Ga0075433_10131340 3300006852 Bacteria 2225
70 Ga0075433_10171105 3300006852 Bacteria 1933
71 Ga0075434_100001461 3300006871 Bacteria 19887
72 Ga0075434_100015728 3300006871 Bacteria 7261
73 Ga0075434_100043258 3300006871 Bacteria 4466
74 Ga0075434_100261446 3300006871 Bacteria 1750
75 Ga0075429_100125406 3300006880 Bacteria 2245
76 Ga0097620_100188711 3300006931 Bacteria 2145
77 Ga0099825_1033435 3300006941 Bacteria 1995
78 Ga0099824_1006683 3300006942 Bacteria 15693
79 Ga0099822_1000418 3300006943 Bacteria 38171
80 Ga0075435_100053482 3300007076 Bacteria 3256
81 Ga0075435_100113612 3300007076 Unclassified 2254
82 Ga0099795_10008550 3300007788 Bacteria 2925
83 Ga0111539_10218516 3300009094 Bacteria 2220
84 Ga0105245_10276928 3300009098 Bacteria 1638
85 Ga0105247_10053344 3300009101 Bacteria 2494
86 Ga0114129_10060363 3300009147 Bacteria 5302
87 Ga0114129_10369264 3300009147 Bacteria 1897
88 Ga0114129_10703911 3300009147 Bacteria 1298
89 Ga0105248_10194080 3300009177 Bacteria 2288
90 Ga0105237_10006382 3300009545 Bacteria 13085
91 Ga0105238_10005609 3300009551 Bacteria 12405
92 Ga0105238_10006417 3300009551 Bacteria 11705
93 Ga0105238_10204644 3300009551 Bacteria 1950
94 Ga0105249_10312767 3300009553 Bacteria 1580
95 Ga0105249_10328281 3300009553 Bacteria 1543
96 Ga0099796_10001204 3300010159 Bacteria 5039
97 Ga0105239_10405102 3300010375 Bacteria 1544
98 Ga0157370_10123309 3300013104 Bacteria 2419
99 Ga0157369_10011122 3300013105 Bacteria 10232
100 Ga0157369_10148657 3300013105 Bacteria 2476
101 Ga0157374_10025504 3300013296 Bacteria 5309
102 Ga0157372_10067936 3300013307 Bacteria 4007
103 Ga0157375_10118124 3300013308 Bacteria 2758
104 Ga0163163_10172693 3300014325 Bacteria 2208
105 Ga0157379_10142142 3300014968 Bacteria 2163
106 Ga0157376_10057387 3300014969 Bacteria 3256
107 Ga0206350_10328410 3300020080 Bacteria 1196
108 Ga0224712_10085686 3300022467 Bacteria 1309
109 Ga0209233_1007368 3300025261 Bacteria 3490
110 Ga0207692_10056122 3300025898 Bacteria 2019
111 Ga0207699_10016224 3300025906 Bacteria 3890
112 Ga0207699_10225541 3300025906 Bacteria 1281
113 Ga0207699_10303365 3300025906 Bacteria 1116
114 Ga0207707_10001473 3300025912 Bacteria 21780
115 Ga0207707_10116980 3300025912 Bacteria 2330
116 Ga0207695_10039200 3300025913 Bacteria 5093
117 Ga0207695_10253104 3300025913 Bacteria 1660
118 Ga0207671_10005731 3300025914 Bacteria 11325
119 Ga0207671_10025672 3300025914 Bacteria 4423
120 Ga0207693_10004235 3300025915 Bacteria 12167
121 Ga0207660_10003205 3300025917 Bacteria 10703
122 Ga0207662_10118009 3300025918 Bacteria 1661
123 Ga0207652_10006959 3300025921 Bacteria 9111
124 Ga0207652_10096482 3300025921 Bacteria 2605
125 Ga0207694_10013900 3300025924 Bacteria 6069
126 Ga0207650_10062915 3300025925 Bacteria 2773
127 Ga0207687_10027434 3300025927 Bacteria 3821
128 Ga0207687_10266669 3300025927 Bacteria 1367
129 Ga0207700_10002748 3300025928 Bacteria 10145
130 Ga0207700_10023903 3300025928 Bacteria 4223
131 Ga0207700_10281407 3300025928 Bacteria 1431
132 Ga0207664_10063366 3300025929 Bacteria 2955
133 Ga0207664_10080490 3300025929 Bacteria 2648
134 Ga0207709_10062132 3300025935 Bacteria 2336
135 Ga0207665_10015310 3300025939 Bacteria 5035
136 Ga0207689_10348297 3300025942 Bacteria 1231
137 Ga0207661_10003495 3300025944 Bacteria 10912
138 Ga0207667_10006677 3300025949 Bacteria 13949
139 Ga0207667_10379825 3300025949 Bacteria 1440
140 Ga0207712_10193069 3300025961 Bacteria 1608
141 Ga0207712_10323330 3300025961 Bacteria 1273
142 Ga0207677_10378060 3300026023 Bacteria 1195
143 Ga0207678_10041710 3300026067 Bacteria 3979
144 Ga0207702_10000478 3300026078 Bacteria 44978
145 Ga0207641_10289814 3300026088 Bacteria 1543
146 Ga0207641_10603899 3300026088 Bacteria 1074
147 Ga0207676_10130135 3300026095 Bacteria 2138
148 Ga0207674_10010523 3300026116 Bacteria 10471
149 Ga0207674_10028212 3300026116 Bacteria 5927
150 Ga0207698_10046992 3300026142 Bacteria 3265
151 Ga0207698_10176853 3300026142 Bacteria 1886
152 Ga0209589_1000003 3300027357 Bacteria 629130
153 Ga0209489_100003 3300027361 Bacteria 663105
154 Ga0209700_100003 3300027363 Bacteria 663105
155 Ga0209179_1013306 3300027512 Bacteria 1492
156 Ga0207428_10116613 3300027907 Bacteria 2050
157 Ga0268264_10247712 3300028381 Bacteria 1654
158 Ga0265330_10008412 3300031235 Bacteria 4968
159 Ga0265320_10011520 3300031240 Bacteria 5199
160 Ga0265325_10081202 3300031241 Bacteria 1611
161 Ga0265329_10031683 3300031242 Bacteria 1716
162 Ga0265339_10052363 3300031249 Bacteria 2224
163 Ga0265331_10022702 3300031250 Bacteria 3199
164 Ga0307508_10048742 3300031616 Bacteria 3773
165 Ga0265342_10043367 3300031712 Bacteria 2715
166 Ga0373950_0014813 3300034818 Unclassified 1316
167 Ga0373926_0029640 3300035083 Bacteria 1924
168 Ga0373944_0005144 3300035089 Bacteria 3437
169 Ga0373936_0023023 3300035113 Bacteria 2426
170 Ga0373936_0045090 3300035113 Bacteria 1775
171 Ga0373939_0007860 3300035114 Bacteria 2600
172 Ga0373954_0026705 3300035118 Bacteria 2648
173 Ga0373957_0008993 3300035120 Bacteria 3257
174 Ga0373931_0015608 3300035691 Bacteria 3728
175 Ga0373935_0057209 3300035692 Bacteria 2487
176 Ga0373935_0106119 3300035692 Bacteria 1859
177 Ga0373927_0066335 3300035695 Bacteria 2334
178 Ga0373947_0007586 3300035725 Bacteria 6278
179 Ga0373947_0016591 3300035725 Bacteria 4233
180 Ga0373937_0026658 3300036401 Bacteria 5221
181 Ga0373925_0011040 3300037068 Bacteria 6559
182 Ga0395898_0094119 3300037466 Bacteria 2880
183 Ga0395905_0022828 3300037471 Bacteria 5915
184 Ga0395905_0210353 3300037471 Bacteria 1822
185 Ga0436361_0376360 3300039447 Bacteria 2321
186 Ga0495592_0090715 3300046454 Bacteria 2192
187 Ga0495651_0261787 3300046462 Bacteria 1177
188 Ga0495580_0073931 3300046472 Bacteria 2379
189 Ga0495580_0218435 3300046472 Bacteria 1310
190 Ga0495582_0059967 3300046473 Bacteria 2099
191 Ga0495639_0011078 3300046475 Bacteria 3886
192 Ga0495664_0009752 3300046477 Bacteria 5381
193 Ga0495584_0021181 3300046491 Bacteria 3301
194 Ga0495648_0011167 3300046524 Bacteria 6785
195 Ga0495666_0163027 3300046526 Bacteria 1033
196 Ga0495652_0120839 3300046529 Bacteria 2090
197 Ga0495665_0014092 3300046531 Bacteria 4317
198 Ga0495665_0132989 3300046531 Bacteria 1302
199 Ga0495645_0037238 3300046543 Bacteria 3545
200 Ga0495634_0032302 3300046642 Bacteria 3600
201 Ga0495635_0060142 3300046663 Bacteria 2612
202 Ga0495659_0017915 3300046664 Bacteria 2354
203 Ga0495599_0159282 3300046678 Bacteria 1395
204 Ga0495658_0044643 3300046683 Bacteria 2484
205 Ga0495658_0169542 3300046683 Bacteria 1350
206 Ga0495669_0122917 3300046684 Bacteria 1218
207 Ga0495613_0058282 3300046689 Bacteria 2835
208 Ga0495613_0217215 3300046689 Bacteria 1343
209 Ga0495674_0189381 3300047319 Bacteria 1710
210 Ga0495672_0064754 3300047320 Bacteria 2091
211 Ga0495676_0044964 3300047321 Bacteria 3599
212 Ga0495602_0271724 3300048088 Bacteria 1253
213 Ga0496102_0402372 3300048905 Bacteria 1287
214 Ga0496104_0000082 3300048907 Bacteria 93223
215 Ga0496105_0000523 3300048908 Bacteria 25375
216 Ga0496107_0020595 3300048910 Bacteria 4660
217 Ga0496109_0209815 3300048912 Bacteria 1832
218 Ga0496112_0067443 3300048915 Bacteria 3532
219 Ga0496115_0035343 3300048918 Bacteria 3953
220 Ga0496119_0036243 3300048922 Bacteria 3223
221 Ga0496126_0003422 3300048929 Bacteria 20029
222 Ga0496126_0151194 3300048929 Bacteria 1990
223 Ga0501048_0123837 3300049582 Bacteria 1828
224 Ga0501069_0117415 3300049585 Bacteria 1518
225 Ga0501076_0318034 3300049592 Bacteria 1277
226 Ga0501080_0060732 3300049742 Bacteria 3519
227 nmdc:mga03n38_3290_c1 3300050490 Bacteria 5167
228 nmdc:mga03n38_72195_c1 3300050490 Bacteria 1600
229 nmdc:mga00v17_53601_c1 3300050491 Bacteria 2459
230 nmdc:mga0yw44_56022_c1 3300050492 Bacteria 2400
231 nmdc:mga0k408_1920_c1 3300050493 Bacteria 11131
232 nmdc:mga06z11_22199_c1 3300050494 Bacteria 2961
233 nmdc:mga06z11_98018_c1 3300050494 Bacteria 1603
234 nmdc:mga07m45_26364_c1 3300050496 Bacteria 3195
235 nmdc:mga05p37_192528_c1 3300050507 Bacteria 2475
236 nmdc:mga05p37_29287_c1 3300050507 Bacteria 6720
237 nmdc:mga05p37_409895_c1 3300050507 Bacteria 1580
238 nmdc:mga0qj67_112_c1 3300050509 Bacteria 53272
239 nmdc:mga06r32_133835_c1 3300050510 Bacteria 2453
240 nmdc:mga06r32_135535_c1 3300050510 Bacteria 2437
241 nmdc:mga06r32_299548_c1 3300050510 Bacteria 1594
242 nmdc:mga08y16_176284_c1 3300050511 Bacteria 2220
243 nmdc:mga0n895_263230_c1 3300050512 Bacteria 1750
244 nmdc:mga0n895_36740_c1 3300050512 Bacteria 4732
245 nmdc:mga0n895_6546_c1 3300050512 Bacteria 9911
246 nmdc:mga0rr50_95857_c1 3300050513 Unclassified 2320
247 nmdc:mga0a205_364315_c1 3300050515 Bacteria 1312
248 nmdc:mga0a205_87712_c1 3300050515 Bacteria 3006
249 nmdc:mga0a205_95220_c1 3300050515 Bacteria 2876
250 Ga0495601_0070824 3300053077 Bacteria 2226
251 Ga0495601_0288212 3300053077 Bacteria 1070
252 Ga0500651_0023605 3300053093 Bacteria 3851
253 Ga0500640_000055 3300053095 Bacteria 17705
254 Ga0500641_0010234 3300053096 Bacteria 3385
255 Ga0500641_0134660 3300053096 Bacteria 1067
256 Ga0500595_001717 3300053119 Bacteria 11435
257 Ga0500595_008847 3300053119 Bacteria 4092
258 Ga0500642_0017050 3300053130 Bacteria 2775
259 Ga0500559_0009374 3300053136 Bacteria 4237
260 Ga0500588_0053993 3300053146 Bacteria 1264
261 Ga0500603_000342 3300053150 Bacteria 12168
262 Ga0500630_054751 3300053159 Bacteria 1919
263 Ga0500639_000001 3300053163 Bacteria 244795
264 Ga0500639_163041 3300053163 Bacteria 1011
265 Ga0500596_000251 3300053735 Bacteria 9374

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025949 Ga0207667_10379825 Ga0207667_103798252 270
2 3300006847 Ga0075431_100101969 Ga0075431_1001019692 285
3 3300025918 Ga0207662_10118009 Ga0207662_101180092 285
4 3300050510 nmdc:mga06r32_133835_c1 nmdc:mga06r32_133835_c1_484_1479 285
5 3300053096 Ga0500641_0010234 Ga0500641_0010234_571_1428 285
6 3300006846 Ga0075430_100209132 Ga0075430_1002091323 290
7 3300005614 Ga0068856_100000451 Ga0068856_10000045136 298
8 3300026078 Ga0207702_10000478 Ga0207702_1000047835 298
9 3300039447 Ga0436361_0376360 Ga0436361_0376360_638_1627 301
10 3300046491 Ga0495584_0021181 Ga0495584_0021181_655_1650 302
11 3300046689 Ga0495613_0217215 Ga0495613_0217215_262_1185 303
12 3300009553 Ga0105249_10328281 Ga0105249_103282812 304
13 3300046472 Ga0495580_0218435 Ga0495580_0218435_10_999 304
14 3300006195 Ga0075366_10001614 Ga0075366_100016149 305
15 3300009147 Ga0114129_10703911 Ga0114129_107039111 305
16 3300025261 Ga0209233_1007368 Ga0209233_10073683 305
17 3300025961 Ga0207712_10193069 Ga0207712_101930693 305
18 3300050493 nmdc:mga0k408_1920_c1 nmdc:mga0k408_1920_c1_5294_6283 305
19 3300053096 Ga0500641_0134660 Ga0500641_0134660_134_1054 305
20 3300005290 Ga0065712_10133578 Ga0065712_101335781 306
21 3300005334 Ga0068869_100078280 Ga0068869_1000782802 306
22 3300005337 Ga0070682_100288000 Ga0070682_1002880001 306
23 3300005577 Ga0068857_100022478 Ga0068857_1000224785 306
24 3300013308 Ga0157375_10118124 Ga0157375_101181242 306
25 3300025942 Ga0207689_10348297 Ga0207689_103482972 306
26 3300026095 Ga0207676_10130135 Ga0207676_101301352 306
27 3300026116 Ga0207674_10010523 Ga0207674_100105232 306
28 3300005985 Ga0081539_10003563 Ga0081539_100035634 307
29 3300009147 Ga0114129_10369264 Ga0114129_103692642 307
30 3300048905 Ga0496102_0402372 Ga0496102_0402372_212_1201 307
31 3300050507 nmdc:mga05p37_409895_c1 nmdc:mga05p37_409895_c1_478_1485 307
32 3300050510 nmdc:mga06r32_299548_c1 nmdc:mga06r32_299548_c1_284_1291 307
33 3300004803 Ga0058862_12551834 Ga0058862_125518341 308
34 3300005530 Ga0070679_100395887 Ga0070679_1003958872 308
35 3300005616 Ga0068852_100067584 Ga0068852_1000675842 308
36 3300010159 Ga0099796_10001204 Ga0099796_100012041 308
37 3300025912 Ga0207707_10001473 Ga0207707_1000147312 308
38 3300025913 Ga0207695_10039200 Ga0207695_100392004 308
39 3300025914 Ga0207671_10005731 Ga0207671_100057313 308
40 3300025917 Ga0207660_10003205 Ga0207660_1000320512 308
41 3300025921 Ga0207652_10006959 Ga0207652_100069592 308
42 3300026142 Ga0207698_10046992 Ga0207698_100469924 308
43 3300046543 Ga0495645_0037238 Ga0495645_0037238_1339_2268 308
44 3300046678 Ga0495599_0159282 Ga0495599_0159282_455_1384 308
45 3300053077 Ga0495601_0070824 Ga0495601_0070824_770_1699 308
46 3300053163 Ga0500639_163041 Ga0500639_163041_71_1000 308
47 3300005455 Ga0070663_100052277 Ga0070663_1000522771 309
48 3300020080 Ga0206350_10328410 Ga0206350_103284101 309
49 3300022467 Ga0224712_10085686 Ga0224712_100856861 309
50 3300026067 Ga0207678_10041710 Ga0207678_100417103 309
51 3300006038 Ga0075365_10267059 Ga0075365_102670591 310
52 3300014325 Ga0163163_10172693 Ga0163163_101726932 311
53 3300050494 nmdc:mga06z11_98018_c1 nmdc:mga06z11_98018_c1_534_1541 311
54 3300006175 Ga0070712_100053156 Ga0070712_1000531562 312
55 3300025928 Ga0207700_10281407 Ga0207700_102814072 312
56 3300037471 Ga0395905_0022828 Ga0395905_0022828_1489_2478 312
57 3300048912 Ga0496109_0209815 Ga0496109_0209815_78_1064 312
58 3300053093 Ga0500651_0023605 Ga0500651_0023605_1526_2515 312
59 3300053130 Ga0500642_0017050 Ga0500642_0017050_1237_2226 312
60 3300006844 Ga0075428_100412378 Ga0075428_1004123782 314
61 3300006847 Ga0075431_100158358 Ga0075431_1001583584 314
62 3300050507 nmdc:mga05p37_192528_c1 nmdc:mga05p37_192528_c1_141_1133 314
63 3300035725 Ga0373947_0016591 Ga0373947_0016591_1277_2236 316
64 3300046473 Ga0495582_0059967 Ga0495582_0059967_84_1043 316
65 3300046531 Ga0495665_0132989 Ga0495665_0132989_291_1250 316
66 3300046683 Ga0495658_0169542 Ga0495658_0169542_68_1027 316
67 3300046689 Ga0495613_0058282 Ga0495613_0058282_1384_2343 316
68 3300006178 Ga0075367_10212063 Ga0075367_102120632 317
69 3300049585 Ga0501069_0117415 Ga0501069_0117415_472_1437 317
70 3300049742 Ga0501080_0060732 Ga0501080_0060732_274_1239 317
71 3300048907 Ga0496104_0000082 Ga0496104_0000082_76093_77190 318
72 3300048908 Ga0496105_0000523 Ga0496105_0000523_23375_24472 318
73 3300048918 Ga0496115_0035343 Ga0496115_0035343_1325_2422 318
74 3300005340 Ga0070689_100117881 Ga0070689_1001178812 319
75 3300005719 Ga0068861_100050943 Ga0068861_1000509432 319
76 3300006852 Ga0075433_10100121 Ga0075433_101001213 319
77 3300007076 Ga0075435_100053482 Ga0075435_1000534823 319
78 3300026088 Ga0207641_10289814 Ga0207641_102898142 319
79 3300031616 Ga0307508_10048742 Ga0307508_100487421 319
80 3300048915 Ga0496112_0067443 Ga0496112_0067443_1420_2424 319
81 3300050515 nmdc:mga0a205_364315_c1 nmdc:mga0a205_364315_c1_221_1225 319
82 3300053119 Ga0500595_008847 Ga0500595_008847_1396_2385 319
83 3300005331 Ga0070670_100090557 Ga0070670_1000905571 320
84 3300005338 Ga0068868_100224978 Ga0068868_1002249781 320
85 3300005617 Ga0068859_100188691 Ga0068859_1001886912 320
86 3300006931 Ga0097620_100188711 Ga0097620_1001887112 320
87 3300009098 Ga0105245_10276928 Ga0105245_102769281 320
88 3300009101 Ga0105247_10053344 Ga0105247_100533442 320
89 3300009551 Ga0105238_10204644 Ga0105238_102046442 320
90 3300025925 Ga0207650_10062915 Ga0207650_100629153 320
91 3300025927 Ga0207687_10027434 Ga0207687_100274345 320
92 3300026023 Ga0207677_10378060 Ga0207677_103780601 320
93 3300048929 Ga0496126_0003422 Ga0496126_0003422_9846_10868 320
94 3300053146 Ga0500588_0053993 Ga0500588_0053993_66_1055 320
95 iso_pu_bacteria 2935630451 2935631770 320
96 iso_pu_bacteria 2941507105 2941513115 320
97 iso_pu_bacteria 2941515067 2941520981 320
98 iso_pu_bacteria 2941523033 2941526155 320
99 3300006042 Ga0075368_10056349 Ga0075368_100563491 321
100 3300006186 Ga0075369_10056895 Ga0075369_100568952 321
101 3300009177 Ga0105248_10194080 Ga0105248_101940802 321
102 3300035083 Ga0373926_0029640 Ga0373926_0029640_30_1007 321
103 3300035118 Ga0373954_0026705 Ga0373954_0026705_1377_2498 321
104 3300036401 Ga0373937_0026658 Ga0373937_0026658_1400_2377 321
105 3300046454 Ga0495592_0090715 Ga0495592_0090715_641_1618 321
106 3300046472 Ga0495580_0073931 Ga0495580_0073931_20_1066 321
107 3300046475 Ga0495639_0011078 Ga0495639_0011078_1987_2964 321
108 3300046529 Ga0495652_0120839 Ga0495652_0120839_197_1174 321
109 3300047321 Ga0495676_0044964 Ga0495676_0044964_1270_2247 321
110 3300050490 nmdc:mga03n38_72195_c1 nmdc:mga03n38_72195_c1_471_1469 321
111 3300050494 nmdc:mga06z11_22199_c1 nmdc:mga06z11_22199_c1_1237_2235 321
112 3300050496 nmdc:mga07m45_26364_c1 nmdc:mga07m45_26364_c1_1848_2846 321
113 3300050507 nmdc:mga05p37_29287_c1 nmdc:mga05p37_29287_c1_1087_2079 321
114 3300050515 nmdc:mga0a205_87712_c1 nmdc:mga0a205_87712_c1_501_1493 321
115 3300053077 Ga0495601_0288212 Ga0495601_0288212_28_1005 321
116 iso_pu_bacteria 2513237098 2513678226 321
117 iso_pu_bacteria 2513237141 2513893555 321
118 iso_pu_bacteria 2517572143 2517892502 321
119 iso_pu_bacteria 2524023210 2524464105 321
120 iso_pu_bacteria 2524023228 2524540046 321
121 iso_pu_bacteria 2667528175 2671122388 321
122 iso_pu_bacteria 2791355197 2793068673 321
123 iso_pu_bacteria 2885374607 2885375315 321
124 iso_pu_bacteria 2885383462 2885385453 321
125 iso_pu_bacteria 2904699407 2904703304 321
126 iso_pu_bacteria 2906610324 2906618506 321
127 iso_pu_bacteria 2908739725 2908742823 321
128 iso_pu_bacteria 2922425934 2922430160 321
129 iso_pu_bacteria 3005474847 3005480101 321
130 iso_pu_bacteria 8006933436 8006940789 321
131 iso_pu_bacteria 8006973647 8006980479 321
132 iso_pu_bacteria 8019555841 8019556870 321
133 iso_pu_bacteria 8019565922 8019568427 321
134 iso_pu_bacteria 8056681323 8056688280 321
135 iso_pu_bacteria 8056689827 8056693635 321
136 iso_pu_bacteria 2935959822 2935959824 322
137 iso_pu_bacteria 3005710791 3005714627 322
138 3300006186 Ga0075369_10056893 Ga0075369_100568932 323
139 3300046524 Ga0495648_0011167 Ga0495648_0011167_4354_5337 323
140 3300005434 Ga0070709_10012838 Ga0070709_100128384 324
141 3300005435 Ga0070714_100088868 Ga0070714_1000888684 324
142 3300005436 Ga0070713_100038449 Ga0070713_1000384494 324
143 3300005436 Ga0070713_100211243 Ga0070713_1002112431 324
144 3300005439 Ga0070711_100009552 Ga0070711_1000095524 324
145 3300005615 Ga0070702_100030348 Ga0070702_1000303481 324
146 3300005841 Ga0068863_100205125 Ga0068863_1002051251 324
147 3300005843 Ga0068860_100149055 Ga0068860_1001490552 324
148 3300005937 Ga0081455_10219861 Ga0081455_102198612 324
149 3300006237 Ga0097621_100317977 Ga0097621_1003179771 324
150 3300014968 Ga0157379_10142142 Ga0157379_101421423 324
151 3300014969 Ga0157376_10057387 Ga0157376_100573872 324
152 3300025906 Ga0207699_10016224 Ga0207699_100162242 324
153 3300025906 Ga0207699_10303365 Ga0207699_103033651 324
154 3300025928 Ga0207700_10023903 Ga0207700_100239034 324
155 3300025939 Ga0207665_10015310 Ga0207665_100153104 324
156 3300026088 Ga0207641_10603899 Ga0207641_106038991 324
157 3300028381 Ga0268264_10247712 Ga0268264_102477122 324
158 3300035114 Ga0373939_0007860 Ga0373939_0007860_573_1556 324
159 3300035691 Ga0373931_0015608 Ga0373931_0015608_2338_3321 324
160 3300046664 Ga0495659_0017915 Ga0495659_0017915_907_1890 324
161 3300005329 Ga0070683_100130279 Ga0070683_1001302793 325
162 3300005336 Ga0070680_100152400 Ga0070680_1001524002 325
163 3300005435 Ga0070714_100030514 Ga0070714_1000305141 325
164 3300005436 Ga0070713_100064587 Ga0070713_1000645873 325
165 3300005445 Ga0070708_100285936 Ga0070708_1002859362 325
166 3300005458 Ga0070681_10148355 Ga0070681_101483551 325
167 3300005467 Ga0070706_100322391 Ga0070706_1003223911 325
168 3300005471 Ga0070698_100064913 Ga0070698_1000649133 325
169 3300005530 Ga0070679_100121903 Ga0070679_1001219032 325
170 3300005535 Ga0070684_100171666 Ga0070684_1001716662 325
171 3300005614 Ga0068856_100038993 Ga0068856_1000389934 325
172 3300005937 Ga0081455_10009701 Ga0081455_100097019 325
173 3300006846 Ga0075430_100000082 Ga0075430_10000008216 325
174 3300006871 Ga0075434_100015728 Ga0075434_1000157286 325
175 3300006941 Ga0099825_1033435 Ga0099825_10334352 325
176 3300006942 Ga0099824_1006683 Ga0099824_100668311 325
177 3300006943 Ga0099822_1000418 Ga0099822_100041811 325
178 3300009094 Ga0111539_10218516 Ga0111539_102185162 325
179 3300009545 Ga0105237_10006382 Ga0105237_100063829 325
180 3300009551 Ga0105238_10005609 Ga0105238_100056096 325
181 3300009551 Ga0105238_10006417 Ga0105238_1000641710 325
182 3300010375 Ga0105239_10405102 Ga0105239_104051022 325
183 3300013104 Ga0157370_10123309 Ga0157370_101233093 325
184 3300013105 Ga0157369_10011122 Ga0157369_100111223 325
185 3300013105 Ga0157369_10148657 Ga0157369_101486571 325
186 3300013296 Ga0157374_10025504 Ga0157374_100255046 325
187 3300013307 Ga0157372_10067936 Ga0157372_100679362 325
188 3300025906 Ga0207699_10225541 Ga0207699_102255412 325
189 3300025912 Ga0207707_10116980 Ga0207707_101169803 325
190 3300025913 Ga0207695_10253104 Ga0207695_102531041 325
191 3300025914 Ga0207671_10025672 Ga0207671_100256722 325
192 3300025921 Ga0207652_10096482 Ga0207652_100964823 325
193 3300025924 Ga0207694_10013900 Ga0207694_100139005 325
194 3300025927 Ga0207687_10266669 Ga0207687_102666691 325
195 3300025929 Ga0207664_10080490 Ga0207664_100804902 325
196 3300025935 Ga0207709_10062132 Ga0207709_100621322 325
197 3300025944 Ga0207661_10003495 Ga0207661_1000349510 325
198 3300025949 Ga0207667_10006677 Ga0207667_100066771 325
199 3300026116 Ga0207674_10028212 Ga0207674_100282127 325
200 3300026142 Ga0207698_10176853 Ga0207698_101768532 325
201 3300027357 Ga0209589_1000003 Ga0209589_1000003466 325
202 3300027361 Ga0209489_100003 Ga0209489_100003517 325
203 3300027363 Ga0209700_100003 Ga0209700_100003517 325
204 3300027907 Ga0207428_10116613 Ga0207428_101166131 325
205 3300031235 Ga0265330_10008412 Ga0265330_100084123 325
206 3300031249 Ga0265339_10052363 Ga0265339_100523632 325
207 3300031250 Ga0265331_10022702 Ga0265331_100227021 325
208 3300035089 Ga0373944_0005144 Ga0373944_0005144_2294_3352 325
209 3300035113 Ga0373936_0045090 Ga0373936_0045090_578_1567 325
210 3300035120 Ga0373957_0008993 Ga0373957_0008993_1287_2345 325
211 3300035692 Ga0373935_0057209 Ga0373935_0057209_67_1056 325
212 3300035692 Ga0373935_0106119 Ga0373935_0106119_467_1456 325
213 3300035695 Ga0373927_0066335 Ga0373927_0066335_845_1834 325
214 3300035725 Ga0373947_0007586 Ga0373947_0007586_3982_4971 325
215 3300037068 Ga0373925_0011040 Ga0373925_0011040_5218_6351 325
216 3300037466 Ga0395898_0094119 Ga0395898_0094119_1163_2152 325
217 3300037471 Ga0395905_0210353 Ga0395905_0210353_224_1213 325
218 3300046462 Ga0495651_0261787 Ga0495651_0261787_109_1098 325
219 3300046477 Ga0495664_0009752 Ga0495664_0009752_12_1001 325
220 3300046526 Ga0495666_0163027 Ga0495666_0163027_18_1007 325
221 3300046531 Ga0495665_0014092 Ga0495665_0014092_1804_2793 325
222 3300046642 Ga0495634_0032302 Ga0495634_0032302_1017_2006 325
223 3300046663 Ga0495635_0060142 Ga0495635_0060142_1017_2075 325
224 3300046683 Ga0495658_0044643 Ga0495658_0044643_982_1971 325
225 3300047319 Ga0495674_0189381 Ga0495674_0189381_27_1016 325
226 3300047320 Ga0495672_0064754 Ga0495672_0064754_1083_2072 325
227 3300048088 Ga0495602_0271724 Ga0495602_0271724_64_1053 325
228 3300048922 Ga0496119_0036243 Ga0496119_0036243_296_1285 325
229 3300048929 Ga0496126_0151194 Ga0496126_0151194_565_1557 325
230 3300050509 nmdc:mga0qj67_112_c1 nmdc:mga0qj67_112_c1_19624_20613 325
231 3300050511 nmdc:mga08y16_176284_c1 nmdc:mga08y16_176284_c1_312_1298 325
232 3300050512 nmdc:mga0n895_36740_c1 nmdc:mga0n895_36740_c1_2492_3478 325
233 3300050515 nmdc:mga0a205_95220_c1 nmdc:mga0a205_95220_c1_1064_2050 325
234 3300053119 Ga0500595_001717 Ga0500595_001717_10282_11271 325
235 3300006048 Ga0075363_100007678 Ga0075363_1000076783 326
236 3300006051 Ga0075364_10000739 Ga0075364_100007399 326
237 3300006058 Ga0075432_10035886 Ga0075432_100358862 326
238 3300006177 Ga0075362_10002626 Ga0075362_100026263 326
239 3300006178 Ga0075367_10031580 Ga0075367_100315802 326
240 3300006195 Ga0075366_10004105 Ga0075366_100041053 326
241 3300006871 Ga0075434_100001461 Ga0075434_1000014619 326
242 3300007076 Ga0075435_100113612 Ga0075435_1001136122 326
243 3300007788 Ga0099795_10008550 Ga0099795_100085504 326
244 3300027512 Ga0209179_1013306 Ga0209179_10133062 326
245 3300031240 Ga0265320_10011520 Ga0265320_100115206 326
246 3300031241 Ga0265325_10081202 Ga0265325_100812022 326
247 3300031242 Ga0265329_10031683 Ga0265329_100316831 326
248 3300031712 Ga0265342_10043367 Ga0265342_100433672 326
249 3300034818 Ga0373950_0014813 Ga0373950_0014813_100_1095 326
250 3300035113 Ga0373936_0023023 Ga0373936_0023023_1386_2399 326
251 3300050490 nmdc:mga03n38_3290_c1 nmdc:mga03n38_3290_c1_1949_2941 326
252 3300050491 nmdc:mga00v17_53601_c1 nmdc:mga00v17_53601_c1_1259_2251 326
253 3300050512 nmdc:mga0n895_6546_c1 nmdc:mga0n895_6546_c1_2887_3882 326
254 3300050513 nmdc:mga0rr50_95857_c1 nmdc:mga0rr50_95857_c1_1233_2228 326
255 3300053095 Ga0500640_000055 Ga0500640_000055_12573_13586 326
256 3300053136 Ga0500559_0009374 Ga0500559_0009374_621_1634 326
257 3300053150 Ga0500603_000342 Ga0500603_000342_2341_3354 326
258 3300053159 Ga0500630_054751 Ga0500630_054751_811_1824 326
259 3300053163 Ga0500639_000001 Ga0500639_000001_195534_196547 326
260 3300053735 Ga0500596_000251 Ga0500596_000251_3026_4039 326
261 3300006846 Ga0075430_100000082 Ga0075430_10000008218 327
262 3300006852 Ga0075433_10131340 Ga0075433_101313402 327
263 3300049582 Ga0501048_0123837 Ga0501048_0123837_479_1477 327
264 3300049592 Ga0501076_0318034 Ga0501076_0318034_102_1100 327
265 3300050509 nmdc:mga0qj67_112_c1 nmdc:mga0qj67_112_c1_21875_22873 327
266 3300006847 Ga0075431_100141651 Ga0075431_1001416511 328
267 3300009553 Ga0105249_10312767 Ga0105249_103127671 328
268 3300025961 Ga0207712_10323330 Ga0207712_103233302 328
269 3300050510 nmdc:mga06r32_135535_c1 nmdc:mga06r32_135535_c1_247_1341 328
270 3300005435 Ga0070714_100040157 Ga0070714_1000401572 329
271 3300005436 Ga0070713_100010599 Ga0070713_1000105993 329
272 3300005437 Ga0070710_10028027 Ga0070710_100280272 329
273 3300005439 Ga0070711_100015580 Ga0070711_1000155802 329
274 3300005937 Ga0081455_10121167 Ga0081455_101211671 329
275 3300005983 Ga0081540_1015402 Ga0081540_10154024 329
276 3300006028 Ga0070717_10087902 Ga0070717_100879022 329
277 3300006173 Ga0070716_100005883 Ga0070716_1000058832 329
278 3300006844 Ga0075428_100189269 Ga0075428_1001892692 329
279 3300006852 Ga0075433_10171105 Ga0075433_101711052 329
280 3300006871 Ga0075434_100043258 Ga0075434_1000432582 329
281 3300006871 Ga0075434_100261446 Ga0075434_1002614461 329
282 3300025898 Ga0207692_10056122 Ga0207692_100561222 329
283 3300025915 Ga0207693_10004235 Ga0207693_1000423511 329
284 3300025928 Ga0207700_10002748 Ga0207700_1000274810 329
285 3300025929 Ga0207664_10063366 Ga0207664_100633662 329
286 3300048910 Ga0496107_0020595 Ga0496107_0020595_1036_2037 329
287 3300050492 nmdc:mga0yw44_56022_c1 nmdc:mga0yw44_56022_c1_238_1245 329
288 3300050512 nmdc:mga0n895_263230_c1 nmdc:mga0n895_263230_c1_117_1118 329
289 3300003659 JGI25404J52841_10000225 JGI25404J52841_100002257 330
290 3300005983 Ga0081540_1000045 Ga0081540_100004591 330
291 3300006880 Ga0075429_100125406 Ga0075429_1001254062 330
292 3300009147 Ga0114129_10060363 Ga0114129_100603634 330
293 3300046684 Ga0495669_0122917 Ga0495669_0122917_183_1175 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

143

342

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.9515 40 326
1p9e-assembly1.cif.gz_A crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 0.9199 30 327
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.9196 40 326
4o98-assembly1.cif.gz_A crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w 0.9187 19 328
4le6-assembly2.cif.gz_C crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.9143 19 328
ID Description Score Start End Superfamily
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9141 36 327 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9121 40 326 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9092 19 328 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9081 36 327 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9057 24 327 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A327K0M8-F1-model_v4 MBL fold metallo-hydrolase 0.985 251 328 GO:0016787
AF-A0A127ETX6-F1-model_v4 Beta-lactamase-like protein 0.9821 38 324
AF-A0A257VC00-F1-model_v4 deleted 0.9818 235 327
AF-A0A4Q4CJR5-F1-model_v4 MBL fold metallo-hydrolase 0.9814 222 327 GO:0016787
AF-A8HUJ9-F1-model_v4 Twin-arginine translocation pathway signal 0.979 39 327

Feature Viewer

pLDDT pTM Quality
87.85 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map