F391600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 293 | 223 | 265 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0011040|Ga0373925_0011040_5218_6351 |
| Length | 377 |
| Sequence | MAVARHLTALEWAEGCAGNVREPAKMLVDWPYKKRANRSGFSLRGGNFMDPSRRNAILGTAAVAAAPLLTSTQIRAEAPAADKQAPSFYRYKVGDIIVTVVSDGKNVFPLTDAFIPNAKKDDINAALEKAFMPRDMVTIWFAPLVIQSGGKVIVIDTGTGPVAKANSKGANGLFVDNMIAAGFDPKAVDMVVISHFHTDHVNGLLAADGTPAFANAEVLVPAAEWKFWSDDGEMSRAKGDRMVGLFKSNRNVFENGLKKKVTPYEWHKEIAPGLTAVETTGHTPGHTSYLLSSGSGKVFIQSDVTNNPNLFAANPGWRGAFDQDGEMAEKTRRRVYDMVVAEKLLVQGFHYPFPGLGNVVKDGDGYRVIPTPWNPVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 4 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 5 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 6 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 7 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 8 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 9 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 10 | 2904699407 | |||
| 11 | 2906610324 | |||
| 12 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 13 | 2922425934 | |||
| 14 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 15 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 16 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 17 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 18 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 19 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 20 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 21 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 22 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 75 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 76 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 128 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 129 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 130 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 140 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 143 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 157 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 188 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 189 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 194 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 197 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 198 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 199 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 208 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 209 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 210 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 211 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 212 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 213 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 214 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 215 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 216 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 217 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 218 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 219 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 220 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 221 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 222 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 223 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.03 |
| Metatranscriptomes | 1.03 |
| Isolates | 7.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.6 |
| Nodule | 8.19 |
| Rhizoplane | 2.73 |
| Rhizosphere | 73.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10000225 | 3300003659 | Bacteria | 6962 |
| 2 | Ga0058862_12551834 | 3300004803 | Bacteria | 1219 |
| 3 | Ga0065712_10133578 | 3300005290 | Bacteria | 1507 |
| 4 | Ga0070683_100130279 | 3300005329 | Bacteria | 2380 |
| 5 | Ga0070670_100090557 | 3300005331 | Bacteria | 2629 |
| 6 | Ga0068869_100078280 | 3300005334 | Bacteria | 2462 |
| 7 | Ga0070680_100152400 | 3300005336 | Bacteria | 1941 |
| 8 | Ga0070682_100288000 | 3300005337 | Bacteria | 1200 |
| 9 | Ga0068868_100224978 | 3300005338 | Bacteria | 1572 |
| 10 | Ga0070689_100117881 | 3300005340 | Bacteria | 2118 |
| 11 | Ga0070709_10012838 | 3300005434 | Bacteria | 4696 |
| 12 | Ga0070714_100030514 | 3300005435 | Bacteria | 4487 |
| 13 | Ga0070714_100040157 | 3300005435 | Bacteria | 3943 |
| 14 | Ga0070714_100088868 | 3300005435 | Bacteria | 2704 |
| 15 | Ga0070713_100010599 | 3300005436 | Bacteria | 6667 |
| 16 | Ga0070713_100038449 | 3300005436 | Bacteria | 3877 |
| 17 | Ga0070713_100064587 | 3300005436 | Bacteria | 3073 |
| 18 | Ga0070713_100211243 | 3300005436 | Bacteria | 1757 |
| 19 | Ga0070710_10028027 | 3300005437 | Bacteria | 3009 |
| 20 | Ga0070711_100009552 | 3300005439 | Bacteria | 5982 |
| 21 | Ga0070711_100015580 | 3300005439 | Bacteria | 4812 |
| 22 | Ga0070708_100285936 | 3300005445 | Bacteria | 1552 |
| 23 | Ga0070663_100052277 | 3300005455 | Bacteria | 2913 |
| 24 | Ga0070681_10148355 | 3300005458 | Bacteria | 2273 |
| 25 | Ga0070706_100322391 | 3300005467 | Bacteria | 1441 |
| 26 | Ga0070698_100064913 | 3300005471 | Bacteria | 3677 |
| 27 | Ga0070679_100121903 | 3300005530 | Bacteria | 2592 |
| 28 | Ga0070679_100395887 | 3300005530 | Bacteria | 1327 |
| 29 | Ga0070684_100171666 | 3300005535 | Bacteria | 1969 |
| 30 | Ga0068857_100022478 | 3300005577 | Bacteria | 5549 |
| 31 | Ga0068856_100000451 | 3300005614 | Bacteria | 45442 |
| 32 | Ga0068856_100038993 | 3300005614 | Bacteria | 4665 |
| 33 | Ga0070702_100030348 | 3300005615 | Bacteria | 2947 |
| 34 | Ga0068852_100067584 | 3300005616 | Bacteria | 3125 |
| 35 | Ga0068859_100188691 | 3300005617 | Bacteria | 2145 |
| 36 | Ga0068861_100050943 | 3300005719 | Bacteria | 3141 |
| 37 | Ga0068863_100205125 | 3300005841 | Bacteria | 1897 |
| 38 | Ga0068860_100149055 | 3300005843 | Bacteria | 2252 |
| 39 | Ga0081455_10009701 | 3300005937 | Bacteria | 9871 |
| 40 | Ga0081455_10121167 | 3300005937 | Bacteria | 2061 |
| 41 | Ga0081455_10219861 | 3300005937 | Bacteria | 1408 |
| 42 | Ga0081540_1000045 | 3300005983 | Bacteria | 134124 |
| 43 | Ga0081540_1015402 | 3300005983 | Bacteria | 4843 |
| 44 | Ga0081539_10003563 | 3300005985 | Bacteria | 18911 |
| 45 | Ga0070717_10087902 | 3300006028 | Bacteria | 2618 |
| 46 | Ga0075365_10267059 | 3300006038 | Bacteria | 1203 |
| 47 | Ga0075368_10056349 | 3300006042 | Bacteria | 1568 |
| 48 | Ga0075363_100007678 | 3300006048 | Bacteria | 4975 |
| 49 | Ga0075364_10000739 | 3300006051 | Bacteria | 17119 |
| 50 | Ga0075432_10035886 | 3300006058 | Bacteria | 1722 |
| 51 | Ga0070716_100005883 | 3300006173 | Bacteria | 5965 |
| 52 | Ga0070712_100053156 | 3300006175 | Bacteria | 2828 |
| 53 | Ga0075362_10002626 | 3300006177 | Bacteria | 6087 |
| 54 | Ga0075367_10031580 | 3300006178 | Bacteria | 3042 |
| 55 | Ga0075367_10212063 | 3300006178 | Bacteria | 1211 |
| 56 | Ga0075369_10056893 | 3300006186 | Bacteria | 1700 |
| 57 | Ga0075369_10056895 | 3300006186 | Bacteria | 1700 |
| 58 | Ga0075366_10001614 | 3300006195 | Bacteria | 11295 |
| 59 | Ga0075366_10004105 | 3300006195 | Bacteria | 7791 |
| 60 | Ga0097621_100317977 | 3300006237 | Bacteria | 1378 |
| 61 | Ga0075428_100189269 | 3300006844 | Bacteria | 2226 |
| 62 | Ga0075428_100412378 | 3300006844 | Unclassified | 1447 |
| 63 | Ga0075430_100000082 | 3300006846 | Bacteria | 53500 |
| 64 | Ga0075430_100209132 | 3300006846 | Bacteria | 1619 |
| 65 | Ga0075431_100101969 | 3300006847 | Bacteria | 2962 |
| 66 | Ga0075431_100141651 | 3300006847 | Bacteria | 2478 |
| 67 | Ga0075431_100158358 | 3300006847 | Bacteria | 2329 |
| 68 | Ga0075433_10100121 | 3300006852 | Bacteria | 2566 |
| 69 | Ga0075433_10131340 | 3300006852 | Bacteria | 2225 |
| 70 | Ga0075433_10171105 | 3300006852 | Bacteria | 1933 |
| 71 | Ga0075434_100001461 | 3300006871 | Bacteria | 19887 |
| 72 | Ga0075434_100015728 | 3300006871 | Bacteria | 7261 |
| 73 | Ga0075434_100043258 | 3300006871 | Bacteria | 4466 |
| 74 | Ga0075434_100261446 | 3300006871 | Bacteria | 1750 |
| 75 | Ga0075429_100125406 | 3300006880 | Bacteria | 2245 |
| 76 | Ga0097620_100188711 | 3300006931 | Bacteria | 2145 |
| 77 | Ga0099825_1033435 | 3300006941 | Bacteria | 1995 |
| 78 | Ga0099824_1006683 | 3300006942 | Bacteria | 15693 |
| 79 | Ga0099822_1000418 | 3300006943 | Bacteria | 38171 |
| 80 | Ga0075435_100053482 | 3300007076 | Bacteria | 3256 |
| 81 | Ga0075435_100113612 | 3300007076 | Unclassified | 2254 |
| 82 | Ga0099795_10008550 | 3300007788 | Bacteria | 2925 |
| 83 | Ga0111539_10218516 | 3300009094 | Bacteria | 2220 |
| 84 | Ga0105245_10276928 | 3300009098 | Bacteria | 1638 |
| 85 | Ga0105247_10053344 | 3300009101 | Bacteria | 2494 |
| 86 | Ga0114129_10060363 | 3300009147 | Bacteria | 5302 |
| 87 | Ga0114129_10369264 | 3300009147 | Bacteria | 1897 |
| 88 | Ga0114129_10703911 | 3300009147 | Bacteria | 1298 |
| 89 | Ga0105248_10194080 | 3300009177 | Bacteria | 2288 |
| 90 | Ga0105237_10006382 | 3300009545 | Bacteria | 13085 |
| 91 | Ga0105238_10005609 | 3300009551 | Bacteria | 12405 |
| 92 | Ga0105238_10006417 | 3300009551 | Bacteria | 11705 |
| 93 | Ga0105238_10204644 | 3300009551 | Bacteria | 1950 |
| 94 | Ga0105249_10312767 | 3300009553 | Bacteria | 1580 |
| 95 | Ga0105249_10328281 | 3300009553 | Bacteria | 1543 |
| 96 | Ga0099796_10001204 | 3300010159 | Bacteria | 5039 |
| 97 | Ga0105239_10405102 | 3300010375 | Bacteria | 1544 |
| 98 | Ga0157370_10123309 | 3300013104 | Bacteria | 2419 |
| 99 | Ga0157369_10011122 | 3300013105 | Bacteria | 10232 |
| 100 | Ga0157369_10148657 | 3300013105 | Bacteria | 2476 |
| 101 | Ga0157374_10025504 | 3300013296 | Bacteria | 5309 |
| 102 | Ga0157372_10067936 | 3300013307 | Bacteria | 4007 |
| 103 | Ga0157375_10118124 | 3300013308 | Bacteria | 2758 |
| 104 | Ga0163163_10172693 | 3300014325 | Bacteria | 2208 |
| 105 | Ga0157379_10142142 | 3300014968 | Bacteria | 2163 |
| 106 | Ga0157376_10057387 | 3300014969 | Bacteria | 3256 |
| 107 | Ga0206350_10328410 | 3300020080 | Bacteria | 1196 |
| 108 | Ga0224712_10085686 | 3300022467 | Bacteria | 1309 |
| 109 | Ga0209233_1007368 | 3300025261 | Bacteria | 3490 |
| 110 | Ga0207692_10056122 | 3300025898 | Bacteria | 2019 |
| 111 | Ga0207699_10016224 | 3300025906 | Bacteria | 3890 |
| 112 | Ga0207699_10225541 | 3300025906 | Bacteria | 1281 |
| 113 | Ga0207699_10303365 | 3300025906 | Bacteria | 1116 |
| 114 | Ga0207707_10001473 | 3300025912 | Bacteria | 21780 |
| 115 | Ga0207707_10116980 | 3300025912 | Bacteria | 2330 |
| 116 | Ga0207695_10039200 | 3300025913 | Bacteria | 5093 |
| 117 | Ga0207695_10253104 | 3300025913 | Bacteria | 1660 |
| 118 | Ga0207671_10005731 | 3300025914 | Bacteria | 11325 |
| 119 | Ga0207671_10025672 | 3300025914 | Bacteria | 4423 |
| 120 | Ga0207693_10004235 | 3300025915 | Bacteria | 12167 |
| 121 | Ga0207660_10003205 | 3300025917 | Bacteria | 10703 |
| 122 | Ga0207662_10118009 | 3300025918 | Bacteria | 1661 |
| 123 | Ga0207652_10006959 | 3300025921 | Bacteria | 9111 |
| 124 | Ga0207652_10096482 | 3300025921 | Bacteria | 2605 |
| 125 | Ga0207694_10013900 | 3300025924 | Bacteria | 6069 |
| 126 | Ga0207650_10062915 | 3300025925 | Bacteria | 2773 |
| 127 | Ga0207687_10027434 | 3300025927 | Bacteria | 3821 |
| 128 | Ga0207687_10266669 | 3300025927 | Bacteria | 1367 |
| 129 | Ga0207700_10002748 | 3300025928 | Bacteria | 10145 |
| 130 | Ga0207700_10023903 | 3300025928 | Bacteria | 4223 |
| 131 | Ga0207700_10281407 | 3300025928 | Bacteria | 1431 |
| 132 | Ga0207664_10063366 | 3300025929 | Bacteria | 2955 |
| 133 | Ga0207664_10080490 | 3300025929 | Bacteria | 2648 |
| 134 | Ga0207709_10062132 | 3300025935 | Bacteria | 2336 |
| 135 | Ga0207665_10015310 | 3300025939 | Bacteria | 5035 |
| 136 | Ga0207689_10348297 | 3300025942 | Bacteria | 1231 |
| 137 | Ga0207661_10003495 | 3300025944 | Bacteria | 10912 |
| 138 | Ga0207667_10006677 | 3300025949 | Bacteria | 13949 |
| 139 | Ga0207667_10379825 | 3300025949 | Bacteria | 1440 |
| 140 | Ga0207712_10193069 | 3300025961 | Bacteria | 1608 |
| 141 | Ga0207712_10323330 | 3300025961 | Bacteria | 1273 |
| 142 | Ga0207677_10378060 | 3300026023 | Bacteria | 1195 |
| 143 | Ga0207678_10041710 | 3300026067 | Bacteria | 3979 |
| 144 | Ga0207702_10000478 | 3300026078 | Bacteria | 44978 |
| 145 | Ga0207641_10289814 | 3300026088 | Bacteria | 1543 |
| 146 | Ga0207641_10603899 | 3300026088 | Bacteria | 1074 |
| 147 | Ga0207676_10130135 | 3300026095 | Bacteria | 2138 |
| 148 | Ga0207674_10010523 | 3300026116 | Bacteria | 10471 |
| 149 | Ga0207674_10028212 | 3300026116 | Bacteria | 5927 |
| 150 | Ga0207698_10046992 | 3300026142 | Bacteria | 3265 |
| 151 | Ga0207698_10176853 | 3300026142 | Bacteria | 1886 |
| 152 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 153 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 154 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 155 | Ga0209179_1013306 | 3300027512 | Bacteria | 1492 |
| 156 | Ga0207428_10116613 | 3300027907 | Bacteria | 2050 |
| 157 | Ga0268264_10247712 | 3300028381 | Bacteria | 1654 |
| 158 | Ga0265330_10008412 | 3300031235 | Bacteria | 4968 |
| 159 | Ga0265320_10011520 | 3300031240 | Bacteria | 5199 |
| 160 | Ga0265325_10081202 | 3300031241 | Bacteria | 1611 |
| 161 | Ga0265329_10031683 | 3300031242 | Bacteria | 1716 |
| 162 | Ga0265339_10052363 | 3300031249 | Bacteria | 2224 |
| 163 | Ga0265331_10022702 | 3300031250 | Bacteria | 3199 |
| 164 | Ga0307508_10048742 | 3300031616 | Bacteria | 3773 |
| 165 | Ga0265342_10043367 | 3300031712 | Bacteria | 2715 |
| 166 | Ga0373950_0014813 | 3300034818 | Unclassified | 1316 |
| 167 | Ga0373926_0029640 | 3300035083 | Bacteria | 1924 |
| 168 | Ga0373944_0005144 | 3300035089 | Bacteria | 3437 |
| 169 | Ga0373936_0023023 | 3300035113 | Bacteria | 2426 |
| 170 | Ga0373936_0045090 | 3300035113 | Bacteria | 1775 |
| 171 | Ga0373939_0007860 | 3300035114 | Bacteria | 2600 |
| 172 | Ga0373954_0026705 | 3300035118 | Bacteria | 2648 |
| 173 | Ga0373957_0008993 | 3300035120 | Bacteria | 3257 |
| 174 | Ga0373931_0015608 | 3300035691 | Bacteria | 3728 |
| 175 | Ga0373935_0057209 | 3300035692 | Bacteria | 2487 |
| 176 | Ga0373935_0106119 | 3300035692 | Bacteria | 1859 |
| 177 | Ga0373927_0066335 | 3300035695 | Bacteria | 2334 |
| 178 | Ga0373947_0007586 | 3300035725 | Bacteria | 6278 |
| 179 | Ga0373947_0016591 | 3300035725 | Bacteria | 4233 |
| 180 | Ga0373937_0026658 | 3300036401 | Bacteria | 5221 |
| 181 | Ga0373925_0011040 | 3300037068 | Bacteria | 6559 |
| 182 | Ga0395898_0094119 | 3300037466 | Bacteria | 2880 |
| 183 | Ga0395905_0022828 | 3300037471 | Bacteria | 5915 |
| 184 | Ga0395905_0210353 | 3300037471 | Bacteria | 1822 |
| 185 | Ga0436361_0376360 | 3300039447 | Bacteria | 2321 |
| 186 | Ga0495592_0090715 | 3300046454 | Bacteria | 2192 |
| 187 | Ga0495651_0261787 | 3300046462 | Bacteria | 1177 |
| 188 | Ga0495580_0073931 | 3300046472 | Bacteria | 2379 |
| 189 | Ga0495580_0218435 | 3300046472 | Bacteria | 1310 |
| 190 | Ga0495582_0059967 | 3300046473 | Bacteria | 2099 |
| 191 | Ga0495639_0011078 | 3300046475 | Bacteria | 3886 |
| 192 | Ga0495664_0009752 | 3300046477 | Bacteria | 5381 |
| 193 | Ga0495584_0021181 | 3300046491 | Bacteria | 3301 |
| 194 | Ga0495648_0011167 | 3300046524 | Bacteria | 6785 |
| 195 | Ga0495666_0163027 | 3300046526 | Bacteria | 1033 |
| 196 | Ga0495652_0120839 | 3300046529 | Bacteria | 2090 |
| 197 | Ga0495665_0014092 | 3300046531 | Bacteria | 4317 |
| 198 | Ga0495665_0132989 | 3300046531 | Bacteria | 1302 |
| 199 | Ga0495645_0037238 | 3300046543 | Bacteria | 3545 |
| 200 | Ga0495634_0032302 | 3300046642 | Bacteria | 3600 |
| 201 | Ga0495635_0060142 | 3300046663 | Bacteria | 2612 |
| 202 | Ga0495659_0017915 | 3300046664 | Bacteria | 2354 |
| 203 | Ga0495599_0159282 | 3300046678 | Bacteria | 1395 |
| 204 | Ga0495658_0044643 | 3300046683 | Bacteria | 2484 |
| 205 | Ga0495658_0169542 | 3300046683 | Bacteria | 1350 |
| 206 | Ga0495669_0122917 | 3300046684 | Bacteria | 1218 |
| 207 | Ga0495613_0058282 | 3300046689 | Bacteria | 2835 |
| 208 | Ga0495613_0217215 | 3300046689 | Bacteria | 1343 |
| 209 | Ga0495674_0189381 | 3300047319 | Bacteria | 1710 |
| 210 | Ga0495672_0064754 | 3300047320 | Bacteria | 2091 |
| 211 | Ga0495676_0044964 | 3300047321 | Bacteria | 3599 |
| 212 | Ga0495602_0271724 | 3300048088 | Bacteria | 1253 |
| 213 | Ga0496102_0402372 | 3300048905 | Bacteria | 1287 |
| 214 | Ga0496104_0000082 | 3300048907 | Bacteria | 93223 |
| 215 | Ga0496105_0000523 | 3300048908 | Bacteria | 25375 |
| 216 | Ga0496107_0020595 | 3300048910 | Bacteria | 4660 |
| 217 | Ga0496109_0209815 | 3300048912 | Bacteria | 1832 |
| 218 | Ga0496112_0067443 | 3300048915 | Bacteria | 3532 |
| 219 | Ga0496115_0035343 | 3300048918 | Bacteria | 3953 |
| 220 | Ga0496119_0036243 | 3300048922 | Bacteria | 3223 |
| 221 | Ga0496126_0003422 | 3300048929 | Bacteria | 20029 |
| 222 | Ga0496126_0151194 | 3300048929 | Bacteria | 1990 |
| 223 | Ga0501048_0123837 | 3300049582 | Bacteria | 1828 |
| 224 | Ga0501069_0117415 | 3300049585 | Bacteria | 1518 |
| 225 | Ga0501076_0318034 | 3300049592 | Bacteria | 1277 |
| 226 | Ga0501080_0060732 | 3300049742 | Bacteria | 3519 |
| 227 | nmdc:mga03n38_3290_c1 | 3300050490 | Bacteria | 5167 |
| 228 | nmdc:mga03n38_72195_c1 | 3300050490 | Bacteria | 1600 |
| 229 | nmdc:mga00v17_53601_c1 | 3300050491 | Bacteria | 2459 |
| 230 | nmdc:mga0yw44_56022_c1 | 3300050492 | Bacteria | 2400 |
| 231 | nmdc:mga0k408_1920_c1 | 3300050493 | Bacteria | 11131 |
| 232 | nmdc:mga06z11_22199_c1 | 3300050494 | Bacteria | 2961 |
| 233 | nmdc:mga06z11_98018_c1 | 3300050494 | Bacteria | 1603 |
| 234 | nmdc:mga07m45_26364_c1 | 3300050496 | Bacteria | 3195 |
| 235 | nmdc:mga05p37_192528_c1 | 3300050507 | Bacteria | 2475 |
| 236 | nmdc:mga05p37_29287_c1 | 3300050507 | Bacteria | 6720 |
| 237 | nmdc:mga05p37_409895_c1 | 3300050507 | Bacteria | 1580 |
| 238 | nmdc:mga0qj67_112_c1 | 3300050509 | Bacteria | 53272 |
| 239 | nmdc:mga06r32_133835_c1 | 3300050510 | Bacteria | 2453 |
| 240 | nmdc:mga06r32_135535_c1 | 3300050510 | Bacteria | 2437 |
| 241 | nmdc:mga06r32_299548_c1 | 3300050510 | Bacteria | 1594 |
| 242 | nmdc:mga08y16_176284_c1 | 3300050511 | Bacteria | 2220 |
| 243 | nmdc:mga0n895_263230_c1 | 3300050512 | Bacteria | 1750 |
| 244 | nmdc:mga0n895_36740_c1 | 3300050512 | Bacteria | 4732 |
| 245 | nmdc:mga0n895_6546_c1 | 3300050512 | Bacteria | 9911 |
| 246 | nmdc:mga0rr50_95857_c1 | 3300050513 | Unclassified | 2320 |
| 247 | nmdc:mga0a205_364315_c1 | 3300050515 | Bacteria | 1312 |
| 248 | nmdc:mga0a205_87712_c1 | 3300050515 | Bacteria | 3006 |
| 249 | nmdc:mga0a205_95220_c1 | 3300050515 | Bacteria | 2876 |
| 250 | Ga0495601_0070824 | 3300053077 | Bacteria | 2226 |
| 251 | Ga0495601_0288212 | 3300053077 | Bacteria | 1070 |
| 252 | Ga0500651_0023605 | 3300053093 | Bacteria | 3851 |
| 253 | Ga0500640_000055 | 3300053095 | Bacteria | 17705 |
| 254 | Ga0500641_0010234 | 3300053096 | Bacteria | 3385 |
| 255 | Ga0500641_0134660 | 3300053096 | Bacteria | 1067 |
| 256 | Ga0500595_001717 | 3300053119 | Bacteria | 11435 |
| 257 | Ga0500595_008847 | 3300053119 | Bacteria | 4092 |
| 258 | Ga0500642_0017050 | 3300053130 | Bacteria | 2775 |
| 259 | Ga0500559_0009374 | 3300053136 | Bacteria | 4237 |
| 260 | Ga0500588_0053993 | 3300053146 | Bacteria | 1264 |
| 261 | Ga0500603_000342 | 3300053150 | Bacteria | 12168 |
| 262 | Ga0500630_054751 | 3300053159 | Bacteria | 1919 |
| 263 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 264 | Ga0500639_163041 | 3300053163 | Bacteria | 1011 |
| 265 | Ga0500596_000251 | 3300053735 | Bacteria | 9374 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025949 | Ga0207667_10379825 | Ga0207667_103798252 | 270 |
| 2 | 3300006847 | Ga0075431_100101969 | Ga0075431_1001019692 | 285 |
| 3 | 3300025918 | Ga0207662_10118009 | Ga0207662_101180092 | 285 |
| 4 | 3300050510 | nmdc:mga06r32_133835_c1 | nmdc:mga06r32_133835_c1_484_1479 | 285 |
| 5 | 3300053096 | Ga0500641_0010234 | Ga0500641_0010234_571_1428 | 285 |
| 6 | 3300006846 | Ga0075430_100209132 | Ga0075430_1002091323 | 290 |
| 7 | 3300005614 | Ga0068856_100000451 | Ga0068856_10000045136 | 298 |
| 8 | 3300026078 | Ga0207702_10000478 | Ga0207702_1000047835 | 298 |
| 9 | 3300039447 | Ga0436361_0376360 | Ga0436361_0376360_638_1627 | 301 |
| 10 | 3300046491 | Ga0495584_0021181 | Ga0495584_0021181_655_1650 | 302 |
| 11 | 3300046689 | Ga0495613_0217215 | Ga0495613_0217215_262_1185 | 303 |
| 12 | 3300009553 | Ga0105249_10328281 | Ga0105249_103282812 | 304 |
| 13 | 3300046472 | Ga0495580_0218435 | Ga0495580_0218435_10_999 | 304 |
| 14 | 3300006195 | Ga0075366_10001614 | Ga0075366_100016149 | 305 |
| 15 | 3300009147 | Ga0114129_10703911 | Ga0114129_107039111 | 305 |
| 16 | 3300025261 | Ga0209233_1007368 | Ga0209233_10073683 | 305 |
| 17 | 3300025961 | Ga0207712_10193069 | Ga0207712_101930693 | 305 |
| 18 | 3300050493 | nmdc:mga0k408_1920_c1 | nmdc:mga0k408_1920_c1_5294_6283 | 305 |
| 19 | 3300053096 | Ga0500641_0134660 | Ga0500641_0134660_134_1054 | 305 |
| 20 | 3300005290 | Ga0065712_10133578 | Ga0065712_101335781 | 306 |
| 21 | 3300005334 | Ga0068869_100078280 | Ga0068869_1000782802 | 306 |
| 22 | 3300005337 | Ga0070682_100288000 | Ga0070682_1002880001 | 306 |
| 23 | 3300005577 | Ga0068857_100022478 | Ga0068857_1000224785 | 306 |
| 24 | 3300013308 | Ga0157375_10118124 | Ga0157375_101181242 | 306 |
| 25 | 3300025942 | Ga0207689_10348297 | Ga0207689_103482972 | 306 |
| 26 | 3300026095 | Ga0207676_10130135 | Ga0207676_101301352 | 306 |
| 27 | 3300026116 | Ga0207674_10010523 | Ga0207674_100105232 | 306 |
| 28 | 3300005985 | Ga0081539_10003563 | Ga0081539_100035634 | 307 |
| 29 | 3300009147 | Ga0114129_10369264 | Ga0114129_103692642 | 307 |
| 30 | 3300048905 | Ga0496102_0402372 | Ga0496102_0402372_212_1201 | 307 |
| 31 | 3300050507 | nmdc:mga05p37_409895_c1 | nmdc:mga05p37_409895_c1_478_1485 | 307 |
| 32 | 3300050510 | nmdc:mga06r32_299548_c1 | nmdc:mga06r32_299548_c1_284_1291 | 307 |
| 33 | 3300004803 | Ga0058862_12551834 | Ga0058862_125518341 | 308 |
| 34 | 3300005530 | Ga0070679_100395887 | Ga0070679_1003958872 | 308 |
| 35 | 3300005616 | Ga0068852_100067584 | Ga0068852_1000675842 | 308 |
| 36 | 3300010159 | Ga0099796_10001204 | Ga0099796_100012041 | 308 |
| 37 | 3300025912 | Ga0207707_10001473 | Ga0207707_1000147312 | 308 |
| 38 | 3300025913 | Ga0207695_10039200 | Ga0207695_100392004 | 308 |
| 39 | 3300025914 | Ga0207671_10005731 | Ga0207671_100057313 | 308 |
| 40 | 3300025917 | Ga0207660_10003205 | Ga0207660_1000320512 | 308 |
| 41 | 3300025921 | Ga0207652_10006959 | Ga0207652_100069592 | 308 |
| 42 | 3300026142 | Ga0207698_10046992 | Ga0207698_100469924 | 308 |
| 43 | 3300046543 | Ga0495645_0037238 | Ga0495645_0037238_1339_2268 | 308 |
| 44 | 3300046678 | Ga0495599_0159282 | Ga0495599_0159282_455_1384 | 308 |
| 45 | 3300053077 | Ga0495601_0070824 | Ga0495601_0070824_770_1699 | 308 |
| 46 | 3300053163 | Ga0500639_163041 | Ga0500639_163041_71_1000 | 308 |
| 47 | 3300005455 | Ga0070663_100052277 | Ga0070663_1000522771 | 309 |
| 48 | 3300020080 | Ga0206350_10328410 | Ga0206350_103284101 | 309 |
| 49 | 3300022467 | Ga0224712_10085686 | Ga0224712_100856861 | 309 |
| 50 | 3300026067 | Ga0207678_10041710 | Ga0207678_100417103 | 309 |
| 51 | 3300006038 | Ga0075365_10267059 | Ga0075365_102670591 | 310 |
| 52 | 3300014325 | Ga0163163_10172693 | Ga0163163_101726932 | 311 |
| 53 | 3300050494 | nmdc:mga06z11_98018_c1 | nmdc:mga06z11_98018_c1_534_1541 | 311 |
| 54 | 3300006175 | Ga0070712_100053156 | Ga0070712_1000531562 | 312 |
| 55 | 3300025928 | Ga0207700_10281407 | Ga0207700_102814072 | 312 |
| 56 | 3300037471 | Ga0395905_0022828 | Ga0395905_0022828_1489_2478 | 312 |
| 57 | 3300048912 | Ga0496109_0209815 | Ga0496109_0209815_78_1064 | 312 |
| 58 | 3300053093 | Ga0500651_0023605 | Ga0500651_0023605_1526_2515 | 312 |
| 59 | 3300053130 | Ga0500642_0017050 | Ga0500642_0017050_1237_2226 | 312 |
| 60 | 3300006844 | Ga0075428_100412378 | Ga0075428_1004123782 | 314 |
| 61 | 3300006847 | Ga0075431_100158358 | Ga0075431_1001583584 | 314 |
| 62 | 3300050507 | nmdc:mga05p37_192528_c1 | nmdc:mga05p37_192528_c1_141_1133 | 314 |
| 63 | 3300035725 | Ga0373947_0016591 | Ga0373947_0016591_1277_2236 | 316 |
| 64 | 3300046473 | Ga0495582_0059967 | Ga0495582_0059967_84_1043 | 316 |
| 65 | 3300046531 | Ga0495665_0132989 | Ga0495665_0132989_291_1250 | 316 |
| 66 | 3300046683 | Ga0495658_0169542 | Ga0495658_0169542_68_1027 | 316 |
| 67 | 3300046689 | Ga0495613_0058282 | Ga0495613_0058282_1384_2343 | 316 |
| 68 | 3300006178 | Ga0075367_10212063 | Ga0075367_102120632 | 317 |
| 69 | 3300049585 | Ga0501069_0117415 | Ga0501069_0117415_472_1437 | 317 |
| 70 | 3300049742 | Ga0501080_0060732 | Ga0501080_0060732_274_1239 | 317 |
| 71 | 3300048907 | Ga0496104_0000082 | Ga0496104_0000082_76093_77190 | 318 |
| 72 | 3300048908 | Ga0496105_0000523 | Ga0496105_0000523_23375_24472 | 318 |
| 73 | 3300048918 | Ga0496115_0035343 | Ga0496115_0035343_1325_2422 | 318 |
| 74 | 3300005340 | Ga0070689_100117881 | Ga0070689_1001178812 | 319 |
| 75 | 3300005719 | Ga0068861_100050943 | Ga0068861_1000509432 | 319 |
| 76 | 3300006852 | Ga0075433_10100121 | Ga0075433_101001213 | 319 |
| 77 | 3300007076 | Ga0075435_100053482 | Ga0075435_1000534823 | 319 |
| 78 | 3300026088 | Ga0207641_10289814 | Ga0207641_102898142 | 319 |
| 79 | 3300031616 | Ga0307508_10048742 | Ga0307508_100487421 | 319 |
| 80 | 3300048915 | Ga0496112_0067443 | Ga0496112_0067443_1420_2424 | 319 |
| 81 | 3300050515 | nmdc:mga0a205_364315_c1 | nmdc:mga0a205_364315_c1_221_1225 | 319 |
| 82 | 3300053119 | Ga0500595_008847 | Ga0500595_008847_1396_2385 | 319 |
| 83 | 3300005331 | Ga0070670_100090557 | Ga0070670_1000905571 | 320 |
| 84 | 3300005338 | Ga0068868_100224978 | Ga0068868_1002249781 | 320 |
| 85 | 3300005617 | Ga0068859_100188691 | Ga0068859_1001886912 | 320 |
| 86 | 3300006931 | Ga0097620_100188711 | Ga0097620_1001887112 | 320 |
| 87 | 3300009098 | Ga0105245_10276928 | Ga0105245_102769281 | 320 |
| 88 | 3300009101 | Ga0105247_10053344 | Ga0105247_100533442 | 320 |
| 89 | 3300009551 | Ga0105238_10204644 | Ga0105238_102046442 | 320 |
| 90 | 3300025925 | Ga0207650_10062915 | Ga0207650_100629153 | 320 |
| 91 | 3300025927 | Ga0207687_10027434 | Ga0207687_100274345 | 320 |
| 92 | 3300026023 | Ga0207677_10378060 | Ga0207677_103780601 | 320 |
| 93 | 3300048929 | Ga0496126_0003422 | Ga0496126_0003422_9846_10868 | 320 |
| 94 | 3300053146 | Ga0500588_0053993 | Ga0500588_0053993_66_1055 | 320 |
| 95 | iso_pu_bacteria | 2935630451 | 2935631770 | 320 |
| 96 | iso_pu_bacteria | 2941507105 | 2941513115 | 320 |
| 97 | iso_pu_bacteria | 2941515067 | 2941520981 | 320 |
| 98 | iso_pu_bacteria | 2941523033 | 2941526155 | 320 |
| 99 | 3300006042 | Ga0075368_10056349 | Ga0075368_100563491 | 321 |
| 100 | 3300006186 | Ga0075369_10056895 | Ga0075369_100568952 | 321 |
| 101 | 3300009177 | Ga0105248_10194080 | Ga0105248_101940802 | 321 |
| 102 | 3300035083 | Ga0373926_0029640 | Ga0373926_0029640_30_1007 | 321 |
| 103 | 3300035118 | Ga0373954_0026705 | Ga0373954_0026705_1377_2498 | 321 |
| 104 | 3300036401 | Ga0373937_0026658 | Ga0373937_0026658_1400_2377 | 321 |
| 105 | 3300046454 | Ga0495592_0090715 | Ga0495592_0090715_641_1618 | 321 |
| 106 | 3300046472 | Ga0495580_0073931 | Ga0495580_0073931_20_1066 | 321 |
| 107 | 3300046475 | Ga0495639_0011078 | Ga0495639_0011078_1987_2964 | 321 |
| 108 | 3300046529 | Ga0495652_0120839 | Ga0495652_0120839_197_1174 | 321 |
| 109 | 3300047321 | Ga0495676_0044964 | Ga0495676_0044964_1270_2247 | 321 |
| 110 | 3300050490 | nmdc:mga03n38_72195_c1 | nmdc:mga03n38_72195_c1_471_1469 | 321 |
| 111 | 3300050494 | nmdc:mga06z11_22199_c1 | nmdc:mga06z11_22199_c1_1237_2235 | 321 |
| 112 | 3300050496 | nmdc:mga07m45_26364_c1 | nmdc:mga07m45_26364_c1_1848_2846 | 321 |
| 113 | 3300050507 | nmdc:mga05p37_29287_c1 | nmdc:mga05p37_29287_c1_1087_2079 | 321 |
| 114 | 3300050515 | nmdc:mga0a205_87712_c1 | nmdc:mga0a205_87712_c1_501_1493 | 321 |
| 115 | 3300053077 | Ga0495601_0288212 | Ga0495601_0288212_28_1005 | 321 |
| 116 | iso_pu_bacteria | 2513237098 | 2513678226 | 321 |
| 117 | iso_pu_bacteria | 2513237141 | 2513893555 | 321 |
| 118 | iso_pu_bacteria | 2517572143 | 2517892502 | 321 |
| 119 | iso_pu_bacteria | 2524023210 | 2524464105 | 321 |
| 120 | iso_pu_bacteria | 2524023228 | 2524540046 | 321 |
| 121 | iso_pu_bacteria | 2667528175 | 2671122388 | 321 |
| 122 | iso_pu_bacteria | 2791355197 | 2793068673 | 321 |
| 123 | iso_pu_bacteria | 2885374607 | 2885375315 | 321 |
| 124 | iso_pu_bacteria | 2885383462 | 2885385453 | 321 |
| 125 | iso_pu_bacteria | 2904699407 | 2904703304 | 321 |
| 126 | iso_pu_bacteria | 2906610324 | 2906618506 | 321 |
| 127 | iso_pu_bacteria | 2908739725 | 2908742823 | 321 |
| 128 | iso_pu_bacteria | 2922425934 | 2922430160 | 321 |
| 129 | iso_pu_bacteria | 3005474847 | 3005480101 | 321 |
| 130 | iso_pu_bacteria | 8006933436 | 8006940789 | 321 |
| 131 | iso_pu_bacteria | 8006973647 | 8006980479 | 321 |
| 132 | iso_pu_bacteria | 8019555841 | 8019556870 | 321 |
| 133 | iso_pu_bacteria | 8019565922 | 8019568427 | 321 |
| 134 | iso_pu_bacteria | 8056681323 | 8056688280 | 321 |
| 135 | iso_pu_bacteria | 8056689827 | 8056693635 | 321 |
| 136 | iso_pu_bacteria | 2935959822 | 2935959824 | 322 |
| 137 | iso_pu_bacteria | 3005710791 | 3005714627 | 322 |
| 138 | 3300006186 | Ga0075369_10056893 | Ga0075369_100568932 | 323 |
| 139 | 3300046524 | Ga0495648_0011167 | Ga0495648_0011167_4354_5337 | 323 |
| 140 | 3300005434 | Ga0070709_10012838 | Ga0070709_100128384 | 324 |
| 141 | 3300005435 | Ga0070714_100088868 | Ga0070714_1000888684 | 324 |
| 142 | 3300005436 | Ga0070713_100038449 | Ga0070713_1000384494 | 324 |
| 143 | 3300005436 | Ga0070713_100211243 | Ga0070713_1002112431 | 324 |
| 144 | 3300005439 | Ga0070711_100009552 | Ga0070711_1000095524 | 324 |
| 145 | 3300005615 | Ga0070702_100030348 | Ga0070702_1000303481 | 324 |
| 146 | 3300005841 | Ga0068863_100205125 | Ga0068863_1002051251 | 324 |
| 147 | 3300005843 | Ga0068860_100149055 | Ga0068860_1001490552 | 324 |
| 148 | 3300005937 | Ga0081455_10219861 | Ga0081455_102198612 | 324 |
| 149 | 3300006237 | Ga0097621_100317977 | Ga0097621_1003179771 | 324 |
| 150 | 3300014968 | Ga0157379_10142142 | Ga0157379_101421423 | 324 |
| 151 | 3300014969 | Ga0157376_10057387 | Ga0157376_100573872 | 324 |
| 152 | 3300025906 | Ga0207699_10016224 | Ga0207699_100162242 | 324 |
| 153 | 3300025906 | Ga0207699_10303365 | Ga0207699_103033651 | 324 |
| 154 | 3300025928 | Ga0207700_10023903 | Ga0207700_100239034 | 324 |
| 155 | 3300025939 | Ga0207665_10015310 | Ga0207665_100153104 | 324 |
| 156 | 3300026088 | Ga0207641_10603899 | Ga0207641_106038991 | 324 |
| 157 | 3300028381 | Ga0268264_10247712 | Ga0268264_102477122 | 324 |
| 158 | 3300035114 | Ga0373939_0007860 | Ga0373939_0007860_573_1556 | 324 |
| 159 | 3300035691 | Ga0373931_0015608 | Ga0373931_0015608_2338_3321 | 324 |
| 160 | 3300046664 | Ga0495659_0017915 | Ga0495659_0017915_907_1890 | 324 |
| 161 | 3300005329 | Ga0070683_100130279 | Ga0070683_1001302793 | 325 |
| 162 | 3300005336 | Ga0070680_100152400 | Ga0070680_1001524002 | 325 |
| 163 | 3300005435 | Ga0070714_100030514 | Ga0070714_1000305141 | 325 |
| 164 | 3300005436 | Ga0070713_100064587 | Ga0070713_1000645873 | 325 |
| 165 | 3300005445 | Ga0070708_100285936 | Ga0070708_1002859362 | 325 |
| 166 | 3300005458 | Ga0070681_10148355 | Ga0070681_101483551 | 325 |
| 167 | 3300005467 | Ga0070706_100322391 | Ga0070706_1003223911 | 325 |
| 168 | 3300005471 | Ga0070698_100064913 | Ga0070698_1000649133 | 325 |
| 169 | 3300005530 | Ga0070679_100121903 | Ga0070679_1001219032 | 325 |
| 170 | 3300005535 | Ga0070684_100171666 | Ga0070684_1001716662 | 325 |
| 171 | 3300005614 | Ga0068856_100038993 | Ga0068856_1000389934 | 325 |
| 172 | 3300005937 | Ga0081455_10009701 | Ga0081455_100097019 | 325 |
| 173 | 3300006846 | Ga0075430_100000082 | Ga0075430_10000008216 | 325 |
| 174 | 3300006871 | Ga0075434_100015728 | Ga0075434_1000157286 | 325 |
| 175 | 3300006941 | Ga0099825_1033435 | Ga0099825_10334352 | 325 |
| 176 | 3300006942 | Ga0099824_1006683 | Ga0099824_100668311 | 325 |
| 177 | 3300006943 | Ga0099822_1000418 | Ga0099822_100041811 | 325 |
| 178 | 3300009094 | Ga0111539_10218516 | Ga0111539_102185162 | 325 |
| 179 | 3300009545 | Ga0105237_10006382 | Ga0105237_100063829 | 325 |
| 180 | 3300009551 | Ga0105238_10005609 | Ga0105238_100056096 | 325 |
| 181 | 3300009551 | Ga0105238_10006417 | Ga0105238_1000641710 | 325 |
| 182 | 3300010375 | Ga0105239_10405102 | Ga0105239_104051022 | 325 |
| 183 | 3300013104 | Ga0157370_10123309 | Ga0157370_101233093 | 325 |
| 184 | 3300013105 | Ga0157369_10011122 | Ga0157369_100111223 | 325 |
| 185 | 3300013105 | Ga0157369_10148657 | Ga0157369_101486571 | 325 |
| 186 | 3300013296 | Ga0157374_10025504 | Ga0157374_100255046 | 325 |
| 187 | 3300013307 | Ga0157372_10067936 | Ga0157372_100679362 | 325 |
| 188 | 3300025906 | Ga0207699_10225541 | Ga0207699_102255412 | 325 |
| 189 | 3300025912 | Ga0207707_10116980 | Ga0207707_101169803 | 325 |
| 190 | 3300025913 | Ga0207695_10253104 | Ga0207695_102531041 | 325 |
| 191 | 3300025914 | Ga0207671_10025672 | Ga0207671_100256722 | 325 |
| 192 | 3300025921 | Ga0207652_10096482 | Ga0207652_100964823 | 325 |
| 193 | 3300025924 | Ga0207694_10013900 | Ga0207694_100139005 | 325 |
| 194 | 3300025927 | Ga0207687_10266669 | Ga0207687_102666691 | 325 |
| 195 | 3300025929 | Ga0207664_10080490 | Ga0207664_100804902 | 325 |
| 196 | 3300025935 | Ga0207709_10062132 | Ga0207709_100621322 | 325 |
| 197 | 3300025944 | Ga0207661_10003495 | Ga0207661_1000349510 | 325 |
| 198 | 3300025949 | Ga0207667_10006677 | Ga0207667_100066771 | 325 |
| 199 | 3300026116 | Ga0207674_10028212 | Ga0207674_100282127 | 325 |
| 200 | 3300026142 | Ga0207698_10176853 | Ga0207698_101768532 | 325 |
| 201 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003466 | 325 |
| 202 | 3300027361 | Ga0209489_100003 | Ga0209489_100003517 | 325 |
| 203 | 3300027363 | Ga0209700_100003 | Ga0209700_100003517 | 325 |
| 204 | 3300027907 | Ga0207428_10116613 | Ga0207428_101166131 | 325 |
| 205 | 3300031235 | Ga0265330_10008412 | Ga0265330_100084123 | 325 |
| 206 | 3300031249 | Ga0265339_10052363 | Ga0265339_100523632 | 325 |
| 207 | 3300031250 | Ga0265331_10022702 | Ga0265331_100227021 | 325 |
| 208 | 3300035089 | Ga0373944_0005144 | Ga0373944_0005144_2294_3352 | 325 |
| 209 | 3300035113 | Ga0373936_0045090 | Ga0373936_0045090_578_1567 | 325 |
| 210 | 3300035120 | Ga0373957_0008993 | Ga0373957_0008993_1287_2345 | 325 |
| 211 | 3300035692 | Ga0373935_0057209 | Ga0373935_0057209_67_1056 | 325 |
| 212 | 3300035692 | Ga0373935_0106119 | Ga0373935_0106119_467_1456 | 325 |
| 213 | 3300035695 | Ga0373927_0066335 | Ga0373927_0066335_845_1834 | 325 |
| 214 | 3300035725 | Ga0373947_0007586 | Ga0373947_0007586_3982_4971 | 325 |
| 215 | 3300037068 | Ga0373925_0011040 | Ga0373925_0011040_5218_6351 | 325 |
| 216 | 3300037466 | Ga0395898_0094119 | Ga0395898_0094119_1163_2152 | 325 |
| 217 | 3300037471 | Ga0395905_0210353 | Ga0395905_0210353_224_1213 | 325 |
| 218 | 3300046462 | Ga0495651_0261787 | Ga0495651_0261787_109_1098 | 325 |
| 219 | 3300046477 | Ga0495664_0009752 | Ga0495664_0009752_12_1001 | 325 |
| 220 | 3300046526 | Ga0495666_0163027 | Ga0495666_0163027_18_1007 | 325 |
| 221 | 3300046531 | Ga0495665_0014092 | Ga0495665_0014092_1804_2793 | 325 |
| 222 | 3300046642 | Ga0495634_0032302 | Ga0495634_0032302_1017_2006 | 325 |
| 223 | 3300046663 | Ga0495635_0060142 | Ga0495635_0060142_1017_2075 | 325 |
| 224 | 3300046683 | Ga0495658_0044643 | Ga0495658_0044643_982_1971 | 325 |
| 225 | 3300047319 | Ga0495674_0189381 | Ga0495674_0189381_27_1016 | 325 |
| 226 | 3300047320 | Ga0495672_0064754 | Ga0495672_0064754_1083_2072 | 325 |
| 227 | 3300048088 | Ga0495602_0271724 | Ga0495602_0271724_64_1053 | 325 |
| 228 | 3300048922 | Ga0496119_0036243 | Ga0496119_0036243_296_1285 | 325 |
| 229 | 3300048929 | Ga0496126_0151194 | Ga0496126_0151194_565_1557 | 325 |
| 230 | 3300050509 | nmdc:mga0qj67_112_c1 | nmdc:mga0qj67_112_c1_19624_20613 | 325 |
| 231 | 3300050511 | nmdc:mga08y16_176284_c1 | nmdc:mga08y16_176284_c1_312_1298 | 325 |
| 232 | 3300050512 | nmdc:mga0n895_36740_c1 | nmdc:mga0n895_36740_c1_2492_3478 | 325 |
| 233 | 3300050515 | nmdc:mga0a205_95220_c1 | nmdc:mga0a205_95220_c1_1064_2050 | 325 |
| 234 | 3300053119 | Ga0500595_001717 | Ga0500595_001717_10282_11271 | 325 |
| 235 | 3300006048 | Ga0075363_100007678 | Ga0075363_1000076783 | 326 |
| 236 | 3300006051 | Ga0075364_10000739 | Ga0075364_100007399 | 326 |
| 237 | 3300006058 | Ga0075432_10035886 | Ga0075432_100358862 | 326 |
| 238 | 3300006177 | Ga0075362_10002626 | Ga0075362_100026263 | 326 |
| 239 | 3300006178 | Ga0075367_10031580 | Ga0075367_100315802 | 326 |
| 240 | 3300006195 | Ga0075366_10004105 | Ga0075366_100041053 | 326 |
| 241 | 3300006871 | Ga0075434_100001461 | Ga0075434_1000014619 | 326 |
| 242 | 3300007076 | Ga0075435_100113612 | Ga0075435_1001136122 | 326 |
| 243 | 3300007788 | Ga0099795_10008550 | Ga0099795_100085504 | 326 |
| 244 | 3300027512 | Ga0209179_1013306 | Ga0209179_10133062 | 326 |
| 245 | 3300031240 | Ga0265320_10011520 | Ga0265320_100115206 | 326 |
| 246 | 3300031241 | Ga0265325_10081202 | Ga0265325_100812022 | 326 |
| 247 | 3300031242 | Ga0265329_10031683 | Ga0265329_100316831 | 326 |
| 248 | 3300031712 | Ga0265342_10043367 | Ga0265342_100433672 | 326 |
| 249 | 3300034818 | Ga0373950_0014813 | Ga0373950_0014813_100_1095 | 326 |
| 250 | 3300035113 | Ga0373936_0023023 | Ga0373936_0023023_1386_2399 | 326 |
| 251 | 3300050490 | nmdc:mga03n38_3290_c1 | nmdc:mga03n38_3290_c1_1949_2941 | 326 |
| 252 | 3300050491 | nmdc:mga00v17_53601_c1 | nmdc:mga00v17_53601_c1_1259_2251 | 326 |
| 253 | 3300050512 | nmdc:mga0n895_6546_c1 | nmdc:mga0n895_6546_c1_2887_3882 | 326 |
| 254 | 3300050513 | nmdc:mga0rr50_95857_c1 | nmdc:mga0rr50_95857_c1_1233_2228 | 326 |
| 255 | 3300053095 | Ga0500640_000055 | Ga0500640_000055_12573_13586 | 326 |
| 256 | 3300053136 | Ga0500559_0009374 | Ga0500559_0009374_621_1634 | 326 |
| 257 | 3300053150 | Ga0500603_000342 | Ga0500603_000342_2341_3354 | 326 |
| 258 | 3300053159 | Ga0500630_054751 | Ga0500630_054751_811_1824 | 326 |
| 259 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_195534_196547 | 326 |
| 260 | 3300053735 | Ga0500596_000251 | Ga0500596_000251_3026_4039 | 326 |
| 261 | 3300006846 | Ga0075430_100000082 | Ga0075430_10000008218 | 327 |
| 262 | 3300006852 | Ga0075433_10131340 | Ga0075433_101313402 | 327 |
| 263 | 3300049582 | Ga0501048_0123837 | Ga0501048_0123837_479_1477 | 327 |
| 264 | 3300049592 | Ga0501076_0318034 | Ga0501076_0318034_102_1100 | 327 |
| 265 | 3300050509 | nmdc:mga0qj67_112_c1 | nmdc:mga0qj67_112_c1_21875_22873 | 327 |
| 266 | 3300006847 | Ga0075431_100141651 | Ga0075431_1001416511 | 328 |
| 267 | 3300009553 | Ga0105249_10312767 | Ga0105249_103127671 | 328 |
| 268 | 3300025961 | Ga0207712_10323330 | Ga0207712_103233302 | 328 |
| 269 | 3300050510 | nmdc:mga06r32_135535_c1 | nmdc:mga06r32_135535_c1_247_1341 | 328 |
| 270 | 3300005435 | Ga0070714_100040157 | Ga0070714_1000401572 | 329 |
| 271 | 3300005436 | Ga0070713_100010599 | Ga0070713_1000105993 | 329 |
| 272 | 3300005437 | Ga0070710_10028027 | Ga0070710_100280272 | 329 |
| 273 | 3300005439 | Ga0070711_100015580 | Ga0070711_1000155802 | 329 |
| 274 | 3300005937 | Ga0081455_10121167 | Ga0081455_101211671 | 329 |
| 275 | 3300005983 | Ga0081540_1015402 | Ga0081540_10154024 | 329 |
| 276 | 3300006028 | Ga0070717_10087902 | Ga0070717_100879022 | 329 |
| 277 | 3300006173 | Ga0070716_100005883 | Ga0070716_1000058832 | 329 |
| 278 | 3300006844 | Ga0075428_100189269 | Ga0075428_1001892692 | 329 |
| 279 | 3300006852 | Ga0075433_10171105 | Ga0075433_101711052 | 329 |
| 280 | 3300006871 | Ga0075434_100043258 | Ga0075434_1000432582 | 329 |
| 281 | 3300006871 | Ga0075434_100261446 | Ga0075434_1002614461 | 329 |
| 282 | 3300025898 | Ga0207692_10056122 | Ga0207692_100561222 | 329 |
| 283 | 3300025915 | Ga0207693_10004235 | Ga0207693_1000423511 | 329 |
| 284 | 3300025928 | Ga0207700_10002748 | Ga0207700_1000274810 | 329 |
| 285 | 3300025929 | Ga0207664_10063366 | Ga0207664_100633662 | 329 |
| 286 | 3300048910 | Ga0496107_0020595 | Ga0496107_0020595_1036_2037 | 329 |
| 287 | 3300050492 | nmdc:mga0yw44_56022_c1 | nmdc:mga0yw44_56022_c1_238_1245 | 329 |
| 288 | 3300050512 | nmdc:mga0n895_263230_c1 | nmdc:mga0n895_263230_c1_117_1118 | 329 |
| 289 | 3300003659 | JGI25404J52841_10000225 | JGI25404J52841_100002257 | 330 |
| 290 | 3300005983 | Ga0081540_1000045 | Ga0081540_100004591 | 330 |
| 291 | 3300006880 | Ga0075429_100125406 | Ga0075429_1001254062 | 330 |
| 292 | 3300009147 | Ga0114129_10060363 | Ga0114129_100603634 | 330 |
| 293 | 3300046684 | Ga0495669_0122917 | Ga0495669_0122917_183_1175 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7y7u-assembly1.cif.gz_B | dimeric structure of a quorum-quenching metallo-hydrolase, lrsl | 0.9515 | 40 | 326 |
| 1p9e-assembly1.cif.gz_A | crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 | 0.9199 | 30 | 327 |
| 7y7u-assembly1.cif.gz_B | dimeric structure of a quorum-quenching metallo-hydrolase, lrsl | 0.9196 | 40 | 326 |
| 4o98-assembly1.cif.gz_A | crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w | 0.9187 | 19 | 328 |
| 4le6-assembly2.cif.gz_C | crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes | 0.9143 | 19 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xukA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9141 | 36 | 327 | 3.60.15.10 |
| 4zo2A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9121 | 40 | 326 | 3.60.15.10 |
| 4le6E00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9092 | 19 | 328 | 3.60.15.10 |
| 4xukA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9081 | 36 | 327 | 3.60.15.10 |
| 6c2cA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9057 | 24 | 327 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327K0M8-F1-model_v4 | MBL fold metallo-hydrolase | 0.985 | 251 | 328 |
GO:0016787
|
| AF-A0A127ETX6-F1-model_v4 | Beta-lactamase-like protein | 0.9821 | 38 | 324 |
|
| AF-A0A257VC00-F1-model_v4 | deleted | 0.9818 | 235 | 327 |
|
| AF-A0A4Q4CJR5-F1-model_v4 | MBL fold metallo-hydrolase | 0.9814 | 222 | 327 |
GO:0016787
|
| AF-A8HUJ9-F1-model_v4 | Twin-arginine translocation pathway signal | 0.979 | 39 | 327 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar