F391508

General Info

Members Datasets Scaffolds Average Seq Length
293 127 586 366

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10002495|Ga0157380_1000249510
Length 392
Sequence MHIAEPGVVPYPSGPMCARRFLMLIFILTLIVVGGAFALYQWGGNVLLKSATPQGHFVAAEAGSGPDYGKAESWIARPEIAGNPSTWAPEGYVNGATKSPDDYPGQTPPPVRAAAFFIHPTTYLERDRWNAPLTDKASQDRAALFVRSQASAFGDVADVWAPKYRHAAYGAFLLKSEDASKALGMAYGDVSRSFDEFLRRNPAGPIILAGHSQGSLHLLRLLAERKDQLKGRLVAAYVIGWPVGIQADLPATGLPACARAGETGCVLSWQSFGEPANMSLITDAWVGTRGLTGNMRNRDDMLCVNPVSGAKDGNSIARDNPGTLVPAADLTNASLAPGQVGSRCDHGFLMIGGQIPAMGPYVLPGNNYHVYDYALFWAAIARDAFQRSIAWR

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.46
Rhizosphere 94.54
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10002495 3300014326 Bacteria 12405
2 MBSR1b_contig_926991 2162886012 Bacteria 1724
3 JGI24740J21852_10031848 3300001979 Bacteria 1694
4 Ga0070658_10008029 3300005327 Bacteria 8487
5 Ga0070658_10042722 3300005327 Bacteria 3661
6 Ga0070658_10055054 3300005327 Bacteria 3231
7 Ga0070658_10088668 3300005327 Bacteria 2547
8 Ga0070658_10106256 3300005327 Bacteria 2322
9 Ga0070683_100365821 3300005329 Bacteria 1373
10 Ga0070670_100005458 3300005331 Bacteria 10724
11 Ga0070670_100007770 3300005331 Bacteria 9125
12 Ga0070670_100010746 3300005331 Bacteria 7820
13 Ga0070670_100266297 3300005331 Bacteria 1495
14 Ga0070677_10053778 3300005333 Bacteria 1638
15 Ga0070666_10044676 3300005335 Bacteria 2968
16 Ga0070682_100120931 3300005337 Bacteria 1758
17 Ga0070660_100017490 3300005339 Bacteria 5228
18 Ga0070661_100006070 3300005344 Bacteria 8315
19 Ga0070661_100056834 3300005344 Bacteria 2867
20 Ga0070668_100027304 3300005347 Bacteria 4334
21 Ga0070668_100237993 3300005347 Bacteria 1507
22 Ga0070669_100001885 3300005353 Bacteria 15125
23 Ga0070669_100045447 3300005353 Bacteria 3200
24 Ga0070669_100204715 3300005353 Bacteria 1554
25 Ga0070675_100000759 3300005354 Bacteria 22530
26 Ga0070675_100001861 3300005354 Bacteria 15546
27 Ga0070675_100076683 3300005354 Bacteria 2781
28 Ga0070671_100007873 3300005355 Bacteria 8519
29 Ga0070671_100015478 3300005355 Bacteria 6164
30 Ga0070671_100041502 3300005355 Bacteria 3824
31 Ga0070671_100079722 3300005355 Bacteria 2737
32 Ga0070671_100081312 3300005355 Bacteria 2709
33 Ga0070671_100105385 3300005355 Bacteria 2366
34 Ga0070674_100021743 3300005356 Bacteria 4126
35 Ga0070674_100022158 3300005356 Bacteria 4093
36 Ga0070674_100023070 3300005356 Bacteria 4021
37 Ga0070674_100052365 3300005356 Bacteria 2816
38 Ga0070673_100006519 3300005364 Bacteria 7592
39 Ga0070673_100213629 3300005364 Bacteria 1667
40 Ga0070667_100048875 3300005367 Bacteria 3562
41 Ga0070667_100088022 3300005367 Bacteria 2666
42 Ga0070709_10185564 3300005434 Bacteria 1464
43 Ga0070714_100060703 3300005435 Bacteria 3245
44 Ga0070713_100151813 3300005436 Bacteria 2061
45 Ga0070663_100027460 3300005455 Bacteria 3866
46 Ga0070678_100231661 3300005456 Bacteria 1540
47 Ga0070662_100100609 3300005457 Bacteria 2187
48 Ga0070681_10403229 3300005458 Bacteria 1279
49 Ga0068853_100028438 3300005539 Bacteria 4702
50 Ga0068853_100134504 3300005539 Bacteria 2215
51 Ga0070672_100019224 3300005543 Bacteria 4956
52 Ga0070672_100062606 3300005543 Bacteria 2936
53 Ga0070665_100026017 3300005548 Bacteria 5894
54 Ga0070665_100106812 3300005548 Bacteria 2801
55 Ga0070664_100005797 3300005564 Bacteria 9967
56 Ga0070664_100101390 3300005564 Bacteria 2503
57 Ga0070664_100116067 3300005564 Bacteria 2341
58 Ga0068854_100290358 3300005578 Bacteria 1319
59 Ga0068856_100137277 3300005614 Bacteria 2451
60 Ga0068852_100079160 3300005616 Bacteria 2910
61 Ga0068852_100081564 3300005616 Bacteria 2871
62 Ga0068859_100217451 3300005617 Bacteria 1998
63 Ga0068864_100319391 3300005618 Bacteria 1458
64 Ga0068861_100010280 3300005719 Bacteria 6495
65 Ga0068851_10029665 3300005834 Bacteria 2709
66 Ga0068851_10047177 3300005834 Bacteria 2181
67 Ga0068870_10114634 3300005840 Bacteria 1544
68 Ga0068862_100033017 3300005844 Bacteria 4372
69 Ga0068862_100227016 3300005844 Bacteria 1692
70 Ga0070717_10070159 3300006028 Bacteria 2919
71 Ga0075431_100037244 3300006847 Bacteria 5013
72 Ga0097620_100217449 3300006931 Bacteria 1998
73 Ga0111539_10578926 3300009094 Bacteria 1307
74 Ga0105248_10067391 3300009177 Bacteria 4019
75 Ga0105248_10069784 3300009177 Bacteria 3946
76 Ga0105238_10165789 3300009551 Bacteria 2185
77 Ga0105238_10419438 3300009551 Bacteria 1333
78 Ga0105249_10196752 3300009553 Bacteria 1970
79 Ga0157373_10053182 3300013100 Bacteria 2879
80 Ga0157373_10126862 3300013100 Bacteria 1795
81 Ga0157370_10083376 3300013104 Bacteria 3006
82 Ga0157370_10147590 3300013104 Bacteria 2189
83 Ga0163162_10104225 3300013306 Bacteria 2931
84 Ga0157375_10028876 3300013308 Bacteria 5207
85 Ga0163163_10245948 3300014325 Bacteria 1839
86 Ga0157380_10011027 3300014326 Bacteria 6519
87 Ga0157380_10057239 3300014326 Bacteria 3103
88 Ga0157380_10103311 3300014326 Bacteria 2378
89 Ga0157380_10384658 3300014326 Bacteria 1325
90 Ga0163161_10003370 3300017792 Bacteria 11209
91 Ga0207697_10015123 3300025315 Bacteria 3191
92 Ga0207656_10058729 3300025321 Bacteria 1681
93 Ga0207688_10177013 3300025901 Bacteria 1271
94 Ga0207647_10033806 3300025904 Bacteria 3270
95 Ga0207645_10007774 3300025907 Bacteria 7544
96 Ga0207705_10201638 3300025909 Bacteria 1507
97 Ga0207693_10013827 3300025915 Bacteria 6499
98 Ga0207660_10005814 3300025917 Bacteria 8004
99 Ga0207657_10055610 3300025919 Bacteria 3418
100 Ga0207657_10119330 3300025919 Bacteria 2170
101 Ga0207657_10158743 3300025919 Bacteria 1838
102 Ga0207649_10078946 3300025920 Bacteria 2125
103 Ga0207649_10138239 3300025920 Bacteria 1663
104 Ga0207681_10018230 3300025923 Bacteria 4421
105 Ga0207650_10064167 3300025925 Bacteria 2748
106 Ga0207650_10077102 3300025925 Bacteria 2519
107 Ga0207659_10014204 3300025926 Bacteria 5127
108 Ga0207700_10243646 3300025928 Bacteria 1533
109 Ga0207664_10053880 3300025929 Bacteria 3186
110 Ga0207644_10020664 3300025931 Bacteria 4480
111 Ga0207644_10056328 3300025931 Bacteria 2836
112 Ga0207644_10065580 3300025931 Bacteria 2641
113 Ga0207644_10085085 3300025931 Bacteria 2345
114 Ga0207644_10129904 3300025931 Bacteria 1927
115 Ga0207644_10294560 3300025931 Bacteria 1306
116 Ga0207690_10200121 3300025932 Bacteria 1516
117 Ga0207706_10054212 3300025933 Bacteria 3539
118 Ga0207706_10090880 3300025933 Bacteria 2684
119 Ga0207706_10223173 3300025933 Bacteria 1650
120 Ga0207706_10223468 3300025933 Bacteria 1648
121 Ga0207706_10301407 3300025933 Bacteria 1396
122 Ga0207669_10008599 3300025937 Bacteria 4802
123 Ga0207669_10017215 3300025937 Bacteria 3700
124 Ga0207669_10137604 3300025937 Bacteria 1690
125 Ga0207691_10027158 3300025940 Bacteria 5370
126 Ga0207691_10092329 3300025940 Bacteria 2711
127 Ga0207711_10062336 3300025941 Bacteria 3216
128 Ga0207711_10114871 3300025941 Bacteria 2398
129 Ga0207711_10327299 3300025941 Bacteria 1417
130 Ga0207679_10004650 3300025945 Bacteria 8546
131 Ga0207679_10061085 3300025945 Bacteria 2804
132 Ga0207679_10192328 3300025945 Bacteria 1698
133 Ga0207712_10238900 3300025961 Bacteria 1462
134 Ga0207668_10053616 3300025972 Bacteria 2795
135 Ga0207658_10033548 3300025986 Bacteria 3663
136 Ga0207639_10149276 3300026041 Bacteria 1956
137 Ga0207678_10002527 3300026067 Bacteria 16669
138 Ga0207678_10027849 3300026067 Bacteria 4934
139 Ga0207678_10167096 3300026067 Unclassified 1879
140 Ga0207675_100101668 3300026118 Bacteria 2708
141 Ga0207698_10056189 3300026142 Bacteria 3038
142 Ga0207698_10097985 3300026142 Bacteria 2421
143 Ga0209974_10005220 3300027876 Bacteria 4584
144 Ga0268266_10003671 3300028379 Bacteria 15155
145 Ga0268266_10060284 3300028379 Bacteria 3271
146 Ga0268266_10436245 3300028379 Bacteria 1243
147 Ga0316182_1239649 3300030745 Bacteria 2341
148 Ga0307408_100004067 3300031548 Bacteria 9974
149 Ga0307408_100073746 3300031548 Bacteria 2530
150 Ga0307405_10012604 3300031731 Bacteria 4485
151 Ga0307405_10043911 3300031731 Bacteria 2730
152 Ga0307405_10096632 3300031731 Bacteria 1970
153 Ga0307413_10006703 3300031824 Bacteria 5285
154 Ga0307413_10011908 3300031824 Bacteria 4302
155 Ga0307413_10017429 3300031824 Bacteria 3740
156 Ga0307413_10141884 3300031824 Bacteria 1661
157 Ga0307413_10143440 3300031824 Bacteria 1653
158 Ga0307410_10004367 3300031852 Bacteria 7296
159 Ga0307410_10008260 3300031852 Bacteria 5762
160 Ga0307410_10018252 3300031852 Bacteria 4236
161 Ga0307410_10057238 3300031852 Bacteria 2654
162 Ga0307410_10101984 3300031852 Bacteria 2058
163 Ga0307410_10127153 3300031852 Bacteria 1867
164 Ga0307410_10153599 3300031852 Bacteria 1716
165 Ga0307410_10160060 3300031852 Unclassified 1686
166 Ga0307410_10208384 3300031852 Unclassified 1496
167 Ga0307406_10074194 3300031901 Bacteria 2239
168 Ga0307406_10078929 3300031901 Bacteria 2182
169 Ga0307407_10056627 3300031903 Bacteria 2271
170 Ga0307407_10073983 3300031903 Bacteria 2037
171 Ga0307412_10010257 3300031911 Bacteria 5393
172 Ga0307412_10032354 3300031911 Bacteria 3313
173 Ga0307412_10186011 3300031911 Bacteria 1566
174 Ga0307412_10250669 3300031911 Bacteria 1374
175 Ga0307412_10259467 3300031911 Bacteria 1354
176 Ga0307409_100003074 3300031995 Bacteria 8931
177 Ga0307409_100034227 3300031995 Bacteria 3707
178 Ga0307409_100062391 3300031995 Bacteria 2917
179 Ga0307409_100085365 3300031995 Bacteria 2566
180 Ga0307409_100156312 3300031995 Bacteria 1987
181 Ga0307409_100269692 3300031995 Bacteria 1566
182 Ga0307409_100286894 3300031995 Bacteria 1524
183 Ga0307409_100306164 3300031995 Bacteria 1481
184 Ga0307409_100325253 3300031995 Bacteria 1441
185 Ga0307409_100439681 3300031995 Unclassified 1256
186 Ga0307416_100045203 3300032002 Bacteria 3466
187 Ga0307416_100138932 3300032002 Bacteria 2204
188 Ga0307416_100558585 3300032002 Bacteria 1219
189 Ga0307414_10012107 3300032004 Bacteria 5090
190 Ga0307414_10015377 3300032004 Bacteria 4617
191 Ga0307414_10035547 3300032004 Bacteria 3316
192 Ga0307414_10051131 3300032004 Bacteria 2867
193 Ga0307414_10068104 3300032004 Bacteria 2553
194 Ga0307414_10085887 3300032004 Bacteria 2320
195 Ga0307414_10105753 3300032004 Bacteria 2128
196 Ga0307414_10153299 3300032004 Bacteria 1821
197 Ga0307414_10173933 3300032004 Bacteria 1724
198 Ga0307414_10325120 3300032004 Bacteria 1310
199 Ga0307411_10014534 3300032005 Bacteria 4384
200 Ga0307411_10015716 3300032005 Bacteria 4261
201 Ga0307411_10020067 3300032005 Bacteria 3878
202 Ga0307411_10029768 3300032005 Bacteria 3340
203 Ga0307411_10039549 3300032005 Bacteria 2984
204 Ga0307411_10047219 3300032005 Bacteria 2782
205 Ga0307411_10047897 3300032005 Bacteria 2766
206 Ga0307411_10072201 3300032005 Bacteria 2343
207 Ga0307411_10076777 3300032005 Bacteria 2285
208 Ga0307411_10159262 3300032005 Bacteria 1688
209 Ga0307411_10190229 3300032005 Bacteria 1566
210 Ga0307415_100006296 3300032126 Bacteria 6383
211 Ga0307415_100006668 3300032126 Bacteria 6249
212 Ga0307415_100017560 3300032126 Bacteria 4294
213 Ga0307415_100019782 3300032126 Bacteria 4095
214 Ga0307415_100073643 3300032126 Bacteria 2411
215 Ga0307415_100092487 3300032126 Bacteria 2193
216 Ga0307415_100122009 3300032126 Bacteria 1956
217 Ga0307415_100205492 3300032126 Bacteria 1566
218 Ga0307415_100227548 3300032126 Bacteria 1499
219 Ga0373935_0053983 3300035692 Bacteria 2557
220 Ga0395899_0000387 3300037312 Bacteria 52472
221 Ga0395899_0001750 3300037312 Bacteria 18054
222 Ga0395899_0026793 3300037312 Bacteria 4349
223 Ga0395899_0034179 3300037312 Bacteria 3816
224 Ga0395900_0000130 3300037418 Bacteria 126231
225 Ga0395900_0022296 3300037418 Bacteria 6478
226 Ga0395900_0057885 3300037418 Bacteria 3990
227 Ga0395900_0074365 3300037418 Bacteria 3493
228 Ga0395900_0078629 3300037418 Bacteria 3389
229 Ga0395900_0160996 3300037418 Bacteria 2289
230 Ga0395900_0211079 3300037418 Bacteria 1960
231 Ga0395900_0364104 3300037418 Bacteria 1417
232 Ga0395900_0382445 3300037418 Bacteria 1375
233 Ga0395900_0430241 3300037418 Bacteria 1279
234 Ga0395898_0000274 3300037466 Bacteria 125922
235 Ga0395898_0013688 3300037466 Bacteria 8344
236 Ga0395898_0043682 3300037466 Bacteria 4415
237 Ga0395898_0208020 3300037466 Bacteria 1867
238 Ga0395905_0000287 3300037471 Bacteria 73803
239 Ga0395905_0004924 3300037471 Bacteria 13752
240 Ga0395905_0024359 3300037471 Bacteria 5713
241 Ga0395905_0024385 3300037471 Bacteria 5710
242 Ga0395905_0040866 3300037471 Bacteria 4351
243 Ga0395905_0069248 3300037471 Bacteria 3304
244 Ga0395905_0105795 3300037471 Bacteria 2642
245 Ga0395905_0106289 3300037471 Bacteria 2635
246 Ga0395905_0109685 3300037471 Bacteria 2591
247 Ga0395905_0135050 3300037471 Bacteria 2320
248 Ga0395905_0135067 3300037471 Bacteria 2320
249 Ga0395905_0335601 3300037471 Bacteria 1402
250 Ga0395901_0005970 3300038443 Bacteria 12329
251 Ga0395901_0006181 3300038443 Bacteria 12134
252 Ga0395901_0019051 3300038443 Bacteria 7017
253 Ga0395901_0037982 3300038443 Bacteria 4980
254 Ga0395901_0125080 3300038443 Bacteria 2702
255 Ga0395901_0144235 3300038443 Bacteria 2503
256 Ga0395901_0224781 3300038443 Bacteria 1961
257 Ga0395901_0536971 3300038443 Bacteria 1186
258 Ga0439445_0000030 3300042004 Bacteria 19033
259 Ga0466966_0054138 3300044684 Bacteria 2544
260 Ga0466971_0078626 3300044719 Bacteria 1503
261 Ga0466970_0023018 3300044765 Bacteria 3251
262 Ga0466957_0023980 3300044842 Bacteria 3610
263 Ga0466957_0054111 3300044842 Bacteria 2449
264 Ga0466959_0064469 3300045049 Unclassified 2660
265 Ga0466958_0093551 3300045836 Bacteria 1862
266 Ga0466967_0215840 3300045976 Bacteria 1821
267 Ga0495663_0002640 3300046525 Bacteria 5345
268 Ga0495621_0015995 3300046539 Bacteria 2400
269 Ga0495621_0056388 3300046539 Bacteria 1416
270 Ga0495659_0017712 3300046664 Bacteria 2365
271 Ga0495669_0036993 3300046684 Bacteria 2159
272 Ga0495669_0104762 3300046684 Bacteria 1316
273 Ga0495670_0067367 3300046691 Bacteria 1807
274 Ga0495670_0069397 3300046691 Bacteria 1782
275 Ga0495670_0153301 3300046691 Bacteria 1209
276 Ga0496100_0219418 3300048903 Bacteria 1395
277 Ga0496101_0073185 3300048904 Bacteria 2517
278 Ga0496101_0203900 3300048904 Bacteria 1530
279 Ga0496107_0021365 3300048910 Bacteria 4575
280 Ga0496108_0018815 3300048911 Bacteria 5662
281 Ga0496108_0108320 3300048911 Bacteria 2373
282 Ga0496109_0246593 3300048912 Bacteria 1682
283 Ga0496110_0065829 3300048913 Bacteria 3204
284 Ga0496111_0043593 3300048914 Bacteria 3225
285 Ga0496112_0008275 3300048915 Bacteria 9307
286 Ga0496112_0009308 3300048915 Bacteria 8836
287 Ga0496112_0019543 3300048915 Bacteria 6395
288 Ga0496113_0011197 3300048916 Bacteria 5970
289 Ga0496114_0051176 3300048917 Bacteria 3438
290 Ga0496114_0159200 3300048917 Bacteria 1962
291 Ga0496115_0002148 3300048918 Bacteria 14095
292 nmdc:mga06r32_46043_c1 3300050510 Bacteria 4161
293 Ga0466962_0070681 3300061719 Bacteria 1668
294 Ga0157380_10002495
295 MBSR1b_contig_926991
296 JGI24740J21852_10031848
297 Ga0070658_10008029
298 Ga0070658_10042722
299 Ga0070658_10055054
300 Ga0070658_10088668
301 Ga0070658_10106256
302 Ga0070683_100365821
303 Ga0070670_100005458
304 Ga0070670_100007770
305 Ga0070670_100010746
306 Ga0070670_100266297
307 Ga0070677_10053778
308 Ga0070666_10044676
309 Ga0070682_100120931
310 Ga0070660_100017490
311 Ga0070661_100006070
312 Ga0070661_100056834
313 Ga0070668_100027304
314 Ga0070668_100237993
315 Ga0070669_100001885
316 Ga0070669_100045447
317 Ga0070669_100204715
318 Ga0070675_100000759
319 Ga0070675_100001861
320 Ga0070675_100076683
321 Ga0070671_100007873
322 Ga0070671_100015478
323 Ga0070671_100041502
324 Ga0070671_100079722
325 Ga0070671_100081312
326 Ga0070671_100105385
327 Ga0070674_100021743
328 Ga0070674_100022158
329 Ga0070674_100023070
330 Ga0070674_100052365
331 Ga0070673_100006519
332 Ga0070673_100213629
333 Ga0070667_100048875
334 Ga0070667_100088022
335 Ga0070709_10185564
336 Ga0070714_100060703
337 Ga0070713_100151813
338 Ga0070663_100027460
339 Ga0070678_100231661
340 Ga0070662_100100609
341 Ga0070681_10403229
342 Ga0068853_100028438
343 Ga0068853_100134504
344 Ga0070672_100019224
345 Ga0070672_100062606
346 Ga0070665_100026017
347 Ga0070665_100106812
348 Ga0070664_100005797
349 Ga0070664_100101390
350 Ga0070664_100116067
351 Ga0068854_100290358
352 Ga0068856_100137277
353 Ga0068852_100079160
354 Ga0068852_100081564
355 Ga0068859_100217451
356 Ga0068864_100319391
357 Ga0068861_100010280
358 Ga0068851_10029665
359 Ga0068851_10047177
360 Ga0068870_10114634
361 Ga0068862_100033017
362 Ga0068862_100227016
363 Ga0070717_10070159
364 Ga0075431_100037244
365 Ga0097620_100217449
366 Ga0111539_10578926
367 Ga0105248_10067391
368 Ga0105248_10069784
369 Ga0105238_10165789
370 Ga0105238_10419438
371 Ga0105249_10196752
372 Ga0157373_10053182
373 Ga0157373_10126862
374 Ga0157370_10083376
375 Ga0157370_10147590
376 Ga0163162_10104225
377 Ga0157375_10028876
378 Ga0163163_10245948
379 Ga0157380_10011027
380 Ga0157380_10057239
381 Ga0157380_10103311
382 Ga0157380_10384658
383 Ga0163161_10003370
384 Ga0207697_10015123
385 Ga0207656_10058729
386 Ga0207688_10177013
387 Ga0207647_10033806
388 Ga0207645_10007774
389 Ga0207705_10201638
390 Ga0207693_10013827
391 Ga0207660_10005814
392 Ga0207657_10055610
393 Ga0207657_10119330
394 Ga0207657_10158743
395 Ga0207649_10078946
396 Ga0207649_10138239
397 Ga0207681_10018230
398 Ga0207650_10064167
399 Ga0207650_10077102
400 Ga0207659_10014204
401 Ga0207700_10243646
402 Ga0207664_10053880
403 Ga0207644_10020664
404 Ga0207644_10056328
405 Ga0207644_10065580
406 Ga0207644_10085085
407 Ga0207644_10129904
408 Ga0207644_10294560
409 Ga0207690_10200121
410 Ga0207706_10054212
411 Ga0207706_10090880
412 Ga0207706_10223173
413 Ga0207706_10223468
414 Ga0207706_10301407
415 Ga0207669_10008599
416 Ga0207669_10017215
417 Ga0207669_10137604
418 Ga0207691_10027158
419 Ga0207691_10092329
420 Ga0207711_10062336
421 Ga0207711_10114871
422 Ga0207711_10327299
423 Ga0207679_10004650
424 Ga0207679_10061085
425 Ga0207679_10192328
426 Ga0207712_10238900
427 Ga0207668_10053616
428 Ga0207658_10033548
429 Ga0207639_10149276
430 Ga0207678_10002527
431 Ga0207678_10027849
432 Ga0207678_10167096
433 Ga0207675_100101668
434 Ga0207698_10056189
435 Ga0207698_10097985
436 Ga0209974_10005220
437 Ga0268266_10003671
438 Ga0268266_10060284
439 Ga0268266_10436245
440 Ga0316182_1239649
441 Ga0307408_100004067
442 Ga0307408_100073746
443 Ga0307405_10012604
444 Ga0307405_10043911
445 Ga0307405_10096632
446 Ga0307413_10006703
447 Ga0307413_10011908
448 Ga0307413_10017429
449 Ga0307413_10141884
450 Ga0307413_10143440
451 Ga0307410_10004367
452 Ga0307410_10008260
453 Ga0307410_10018252
454 Ga0307410_10057238
455 Ga0307410_10101984
456 Ga0307410_10127153
457 Ga0307410_10153599
458 Ga0307410_10160060
459 Ga0307410_10208384
460 Ga0307406_10074194
461 Ga0307406_10078929
462 Ga0307407_10056627
463 Ga0307407_10073983
464 Ga0307412_10010257
465 Ga0307412_10032354
466 Ga0307412_10186011
467 Ga0307412_10250669
468 Ga0307412_10259467
469 Ga0307409_100003074
470 Ga0307409_100034227
471 Ga0307409_100062391
472 Ga0307409_100085365
473 Ga0307409_100156312
474 Ga0307409_100269692
475 Ga0307409_100286894
476 Ga0307409_100306164
477 Ga0307409_100325253
478 Ga0307409_100439681
479 Ga0307416_100045203
480 Ga0307416_100138932
481 Ga0307416_100558585
482 Ga0307414_10012107
483 Ga0307414_10015377
484 Ga0307414_10035547
485 Ga0307414_10051131
486 Ga0307414_10068104
487 Ga0307414_10085887
488 Ga0307414_10105753
489 Ga0307414_10153299
490 Ga0307414_10173933
491 Ga0307414_10325120
492 Ga0307411_10014534
493 Ga0307411_10015716
494 Ga0307411_10020067
495 Ga0307411_10029768
496 Ga0307411_10039549
497 Ga0307411_10047219
498 Ga0307411_10047897
499 Ga0307411_10072201
500 Ga0307411_10076777
501 Ga0307411_10159262
502 Ga0307411_10190229
503 Ga0307415_100006296
504 Ga0307415_100006668
505 Ga0307415_100017560
506 Ga0307415_100019782
507 Ga0307415_100073643
508 Ga0307415_100092487
509 Ga0307415_100122009
510 Ga0307415_100205492
511 Ga0307415_100227548
512 Ga0373935_0053983
513 Ga0395899_0000387
514 Ga0395899_0001750
515 Ga0395899_0026793
516 Ga0395899_0034179
517 Ga0395900_0000130
518 Ga0395900_0022296
519 Ga0395900_0057885
520 Ga0395900_0074365
521 Ga0395900_0078629
522 Ga0395900_0160996
523 Ga0395900_0211079
524 Ga0395900_0364104
525 Ga0395900_0382445
526 Ga0395900_0430241
527 Ga0395898_0000274
528 Ga0395898_0013688
529 Ga0395898_0043682
530 Ga0395898_0208020
531 Ga0395905_0000287
532 Ga0395905_0004924
533 Ga0395905_0024359
534 Ga0395905_0024385
535 Ga0395905_0040866
536 Ga0395905_0069248
537 Ga0395905_0105795
538 Ga0395905_0106289
539 Ga0395905_0109685
540 Ga0395905_0135050
541 Ga0395905_0135067
542 Ga0395905_0335601
543 Ga0395901_0005970
544 Ga0395901_0006181
545 Ga0395901_0019051
546 Ga0395901_0037982
547 Ga0395901_0125080
548 Ga0395901_0144235
549 Ga0395901_0224781
550 Ga0395901_0536971
551 Ga0439445_0000030
552 Ga0466966_0054138
553 Ga0466971_0078626
554 Ga0466970_0023018
555 Ga0466957_0023980
556 Ga0466957_0054111
557 Ga0466959_0064469
558 Ga0466958_0093551
559 Ga0466967_0215840
560 Ga0495663_0002640
561 Ga0495621_0015995
562 Ga0495621_0056388
563 Ga0495659_0017712
564 Ga0495669_0036993
565 Ga0495669_0104762
566 Ga0495670_0067367
567 Ga0495670_0069397
568 Ga0495670_0153301
569 Ga0496100_0219418
570 Ga0496101_0073185
571 Ga0496101_0203900
572 Ga0496107_0021365
573 Ga0496108_0018815
574 Ga0496108_0108320
575 Ga0496109_0246593
576 Ga0496110_0065829
577 Ga0496111_0043593
578 Ga0496112_0008275
579 Ga0496112_0009308
580 Ga0496112_0019543
581 Ga0496113_0011197
582 Ga0496114_0051176
583 Ga0496114_0159200
584 Ga0496115_0002148
585 nmdc:mga06r32_46043_c1
586 Ga0466962_0070681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11288

DUF3089

Protein of unknown function (DUF3089)

113

312

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wtm-assembly2.cif.gz_D est1e from butyrivibrio proteoclasticus 0.728 85 217
7e0n-assembly4.cif.gz_D crystal structure of monoacylglycerol lipase chimera 0.7005 87 217
2psj-assembly2.cif.gz_B crystal structures of the luciferase and green fluorescent protein from renilla reniformis 0.6968 89 216
2bjh-assembly3.cif.gz_C crystal structure of s133a anfaea-ferulic acid complex 0.6808 158 219
7e04-assembly1.cif.gz_A crystal structure of bomgl, a monoacylglycerol lipase from marine bacillus sp. 0.6782 84 217
ID Description Score Start End Superfamily
af_Q3TNH5_101_359_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8119 162 217 3.40.50.1820
af_Q0DGS8_1_242_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7915 164 217 3.40.50.1820
af_A0A0R0IFF4_3_207_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7462 164 215 3.40.50.1820
af_Q965S2_53_331_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7248 88 217 3.40.50.1820
af_A4IDK6_165_383_3.40.367.20 Alpha Beta;3-Layer(aba) Sandwich;Hexokinase; domain 1; 0.7214 148 187 3.40.367.20
ID Description Score Start End GO Terms
AF-A0A6G7ZNL4-F1-model_v4 DUF3089 domain-containing protein 0.9695 1 368
AF-A0A4Q5T5X0-F1-model_v4 DUF3089 domain-containing protein 0.9651 182 370
AF-A0A6G7ZNL4-F1-model_v4 DUF3089 domain-containing protein 0.9617 1 368
AF-A0A2W5DNS1-F1-model_v4 deleted 0.9615 118 368
AF-A0A2R7IPP1-F1-model_v4 DUF3089 domain-containing protein 0.9527 145 368

Map