F391461

General Info

Members Datasets Scaffolds Average Seq Length
293 192 293 106

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10000223|Ga0105245_100002233
Length 125
Sequence MSDAGGMTLMLTQKMRYIAPMDEATFDTTAHAELQAIEDAFADVDPDQVEITVSDGVLRLDLRDGTRIVINSHRAARQIWMAAIATAWHFDPTSAGSWVAPKTGEELRATLKGLLRERIGIAVTL

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
152 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
167 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
171 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
172 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
175 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
178 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
179 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
180 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
186 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
187 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
188 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.63
Nodule 0
Rhizoplane 1.37
Rhizosphere 78.16
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10024812 3300003320 Bacteria 1720
2 rootH1_10169057 3300003323 Bacteria 1429
3 Ga0070658_10093517 3300005327 Bacteria 2480
4 Ga0070683_100876549 3300005329 Bacteria 861
5 Ga0070683_100914085 3300005329 Bacteria 842
6 Ga0070690_100095670 3300005330 Bacteria 1962
7 Ga0068869_100042573 3300005334 Bacteria 3256
8 Ga0068869_100121139 3300005334 Bacteria 2001
9 Ga0068869_100284372 3300005334 Bacteria 1331
10 Ga0068869_100436601 3300005334 Unclassified 1083
11 Ga0070680_100059017 3300005336 Bacteria 3138
12 Ga0070689_100032006 3300005340 Bacteria 3999
13 Ga0070689_100047788 3300005340 Bacteria 3300
14 Ga0070689_100073761 3300005340 Bacteria 2669
15 Ga0070692_10714663 3300005345 Bacteria 676
16 Ga0070668_101581330 3300005347 Unclassified 600
17 Ga0070688_100064456 3300005365 Bacteria 2326
18 Ga0070688_100636227 3300005365 Bacteria 820
19 Ga0070688_101241999 3300005365 Bacteria 600
20 Ga0070667_100064951 3300005367 Bacteria 3098
21 Ga0070709_10567537 3300005434 Bacteria 870
22 Ga0070713_101243534 3300005436 Unclassified 721
23 Ga0070705_100257732 3300005440 Bacteria 1228
24 Ga0070700_100260355 3300005441 Archaea 1249
25 Ga0070678_100002853 3300005456 Bacteria 9565
26 Ga0070681_10141329 3300005458 Unclassified 2337
27 Ga0070681_10687455 3300005458 Bacteria 939
28 Ga0070681_11088461 3300005458 Bacteria 720
29 Ga0070685_11343061 3300005466 Unclassified 547
30 Ga0070706_100035278 3300005467 Bacteria 4620
31 Ga0070698_100001138 3300005471 Bacteria 29427
32 Ga0070698_100344927 3300005471 Bacteria 1420
33 Ga0070698_101286658 3300005471 Bacteria 681
34 Ga0070679_100033128 3300005530 Bacteria 5115
35 Ga0070679_101547643 3300005530 Unclassified 610
36 Ga0070684_100027448 3300005535 Bacteria 4806
37 Ga0070697_100566151 3300005536 Bacteria 997
38 Ga0070665_100005561 3300005548 Bacteria 12962
39 Ga0070665_101266202 3300005548 Unclassified 748
40 Ga0068855_100498165 3300005563 Unclassified 1324
41 Ga0068857_101206268 3300005577 Bacteria 733
42 Ga0068856_100014588 3300005614 Bacteria 7591
43 Ga0068856_101287556 3300005614 Bacteria 746
44 Ga0070702_100321307 3300005615 Bacteria 1079
45 Ga0070702_101887598 3300005615 Bacteria 501
46 Ga0068859_100636584 3300005617 Bacteria 1159
47 Ga0068864_100024485 3300005618 Bacteria 5079
48 Ga0068864_101361854 3300005618 Bacteria 711
49 Ga0068866_10087153 3300005718 Bacteria 1691
50 Ga0068861_100035201 3300005719 Bacteria 3708
51 Ga0068870_10352539 3300005840 Bacteria 945
52 Ga0068863_100092274 3300005841 Bacteria 2873
53 Ga0068860_100090682 3300005843 Bacteria 2912
54 Ga0068860_100289244 3300005843 Bacteria 1603
55 Ga0068860_101187936 3300005843 Bacteria 783
56 Ga0068862_100409152 3300005844 Unclassified 1270
57 Ga0081455_10384421 3300005937 Bacteria 979
58 Ga0070717_10154621 3300006028 Bacteria 1986
59 Ga0070717_10286619 3300006028 Bacteria 1461
60 Ga0097621_100621850 3300006237 Bacteria 989
61 Ga0097621_100621884 3300006237 Viruses 989
62 Ga0097621_100851840 3300006237 Bacteria 847
63 Ga0097621_100874032 3300006237 Bacteria 836
64 Ga0068871_100356971 3300006358 Bacteria 1294
65 Ga0068871_100407411 3300006358 Bacteria 1212
66 Ga0075430_100499052 3300006846 Bacteria 1004
67 Ga0075434_101118215 3300006871 Bacteria 801
68 Ga0075429_100006189 3300006880 Bacteria 10349
69 Ga0075429_100422412 3300006880 Bacteria 1168
70 Ga0075429_101178754 3300006880 Unclassified 669
71 Ga0075429_101955237 3300006880 Bacteria 508
72 Ga0097620_100636513 3300006931 Bacteria 1159
73 Ga0075435_100087979 3300007076 Bacteria 2560
74 Ga0075435_100159751 3300007076 Bacteria 1898
75 Ga0075435_100894403 3300007076 Bacteria 774
76 Ga0105240_11280607 3300009093 Unclassified 774
77 Ga0111539_10001247 3300009094 Bacteria 33877
78 Ga0111539_10273514 3300009094 Bacteria 1966
79 Ga0111539_13393410 3300009094 Unclassified 512
80 Ga0105245_10000223 3300009098 Bacteria 53966
81 Ga0105245_10800694 3300009098 Bacteria 980
82 Ga0114129_10919357 3300009147 Bacteria 1107
83 Ga0105243_10412053 3300009148 Bacteria 1258
84 Ga0105243_11265255 3300009148 Bacteria 753
85 Ga0105241_10309586 3300009174 Unclassified 1358
86 Ga0105241_11138450 3300009174 Bacteria 736
87 Ga0105242_10503008 3300009176 Bacteria 1153
88 Ga0105242_11502471 3300009176 Unclassified 704
89 Ga0105248_11305332 3300009177 Bacteria 821
90 Ga0105248_12028599 3300009177 Bacteria 654
91 Ga0105248_12780372 3300009177 Bacteria 558
92 Ga0105249_10257608 3300009553 Unclassified 1732
93 Ga0105239_10280223 3300010375 Unclassified 1877
94 Ga0105239_12191774 3300010375 Unclassified 642
95 Ga0157374_10081510 3300013296 Bacteria 3070
96 Ga0157374_12743577 3300013296 Bacteria 520
97 Ga0163163_12378992 3300014325 Bacteria 588
98 Ga0157376_10005449 3300014969 Bacteria 8896
99 Ga0157376_11227135 3300014969 Bacteria 778
100 Ga0157376_12092568 3300014969 Unclassified 604
101 Ga0213876_10031332 3300021384 Bacteria 2806
102 Ga0207656_10660792 3300025321 Bacteria 535
103 Ga0207643_10398582 3300025908 Bacteria 870
104 Ga0207643_10948609 3300025908 Bacteria 557
105 Ga0207684_10115316 3300025910 Unclassified 2301
106 Ga0207707_10768616 3300025912 Bacteria 804
107 Ga0207660_10055238 3300025917 Unclassified 2837
108 Ga0207660_10366554 3300025917 Bacteria 1156
109 Ga0207662_10182607 3300025918 Bacteria 1350
110 Ga0207662_10562094 3300025918 Unclassified 791
111 Ga0207652_10035724 3300025921 Bacteria 4197
112 Ga0207687_10000120 3300025927 Bacteria 54782
113 Ga0207687_10654061 3300025927 Bacteria 889
114 Ga0207709_10736763 3300025935 Bacteria 791
115 Ga0207670_10030775 3300025936 Bacteria 3431
116 Ga0207670_10031316 3300025936 Bacteria 3407
117 Ga0207670_10046719 3300025936 Bacteria 2878
118 Ga0207669_10070338 3300025937 Unclassified 2194
119 Ga0207704_10571171 3300025938 Unclassified 922
120 Ga0207711_10560919 3300025941 Bacteria 1065
121 Ga0207711_10707178 3300025941 Bacteria 940
122 Ga0207689_10027406 3300025942 Bacteria 4770
123 Ga0207689_10088347 3300025942 Bacteria 2546
124 Ga0207689_10118102 3300025942 Bacteria 2181
125 Ga0207661_10434621 3300025944 Unclassified 1194
126 Ga0207661_10459079 3300025944 Unclassified 1161
127 Ga0207667_10898549 3300025949 Bacteria 878
128 Ga0207712_10171170 3300025961 Unclassified 1698
129 Ga0207658_10047608 3300025986 Bacteria 3139
130 Ga0207677_10548640 3300026023 Unclassified 1007
131 Ga0207677_11913022 3300026023 Bacteria 551
132 Ga0207708_10314338 3300026075 Unclassified 1277
133 Ga0207708_10939101 3300026075 Bacteria 750
134 Ga0207702_10069770 3300026078 Bacteria 3022
135 Ga0207702_10849886 3300026078 Bacteria 903
136 Ga0207641_10366729 3300026088 Unclassified 1376
137 Ga0207648_10892218 3300026089 Bacteria 830
138 Ga0207676_10831684 3300026095 Bacteria 902
139 Ga0207676_10957713 3300026095 Unclassified 842
140 Ga0207676_12189743 3300026095 Bacteria 551
141 Ga0207674_10826628 3300026116 Bacteria 894
142 Ga0207674_11063590 3300026116 Bacteria 778
143 Ga0207675_100036310 3300026118 Bacteria 4598
144 Ga0207675_101245210 3300026118 Bacteria 764
145 Ga0207683_10002224 3300026121 Bacteria 17070
146 Ga0207428_10014733 3300027907 Bacteria 6773
147 Ga0268266_10004111 3300028379 Bacteria 14054
148 Ga0268265_10979466 3300028380 Unclassified 834
149 Ga0268264_10129906 3300028381 Bacteria 2231
150 Ga0268264_10902314 3300028381 Bacteria 887
151 Ga0307517_10036718 3300028786 Bacteria 5500
152 Ga0307515_10025712 3300028794 Bacteria 10172
153 Ga0265338_10047162 3300028800 Bacteria 3939
154 Ga0265338_10097142 3300028800 Unclassified 2414
155 Ga0265332_10005666 3300031238 Bacteria 5741
156 Ga0265331_10391203 3300031250 Unclassified 623
157 Ga0307513_10091917 3300031456 Bacteria 3091
158 Ga0307513_10429310 3300031456 Bacteria 1050
159 Ga0307509_10000111 3300031507 Bacteria 117078
160 Ga0307509_10004236 3300031507 Bacteria 20915
161 Ga0307509_10031864 3300031507 Bacteria 5814
162 Ga0307509_10075203 3300031507 Bacteria 3509
163 Ga0307509_10207687 3300031507 Bacteria 1787
164 Ga0265313_10266065 3300031595 Bacteria 696
165 Ga0307508_10090060 3300031616 Bacteria 2654
166 Ga0265314_10255848 3300031711 Unclassified 1003
167 Ga0307516_10097810 3300031730 Bacteria 2754
168 Ga0307406_10420810 3300031901 Bacteria 1064
169 Ga0307407_11645830 3300031903 Bacteria 510
170 Ga0307415_100005501 3300032126 Bacteria 6733
171 Ga0307507_10588189 3300033179 Bacteria 578
172 Ga0373949_0000045 3300035090 Bacteria 45428
173 Ga0373936_0000005 3300035113 Bacteria 325848
174 Ga0373939_0081662 3300035114 Bacteria 1074
175 Ga0373941_0080476 3300035115 Bacteria 1099
176 Ga0373945_0394386 3300035116 Unclassified 606
177 Ga0373956_0077692 3300035119 Unclassified 1520
178 Ga0373961_0000039 3300035241 Bacteria 78101
179 Ga0395899_0383158 3300037312 Bacteria 934
180 Ga0395899_0655845 3300037312 Bacteria 663
181 Ga0395900_0021997 3300037418 Bacteria 6520
182 Ga0395900_1683022 3300037418 Unclassified 545
183 Ga0395898_1932198 3300037466 Bacteria 510
184 Ga0395905_0313897 3300037471 Bacteria 1456
185 Ga0395905_0448256 3300037471 Unclassified 1188
186 Ga0395905_1240395 3300037471 Unclassified 649
187 Ga0395901_0015341 3300038443 Bacteria 7797
188 Ga0395901_0352710 3300038443 Bacteria 1518
189 Ga0436365_0109887 3300039437 Unclassified 583
190 Ga0436365_0379180 3300039437 Bacteria 1218
191 Ga0436365_0659839 3300039437 Unclassified 1012
192 Ga0436365_1368064 3300039437 Bacteria 3997
193 Ga0436363_1717800 3300039450 Bacteria 1388
194 Ga0451793_0508308 3300041452 Bacteria 2277
195 Ga0451800_0882863 3300041459 Bacteria 592
196 Ga0451807_2711463 3300041486 Bacteria 542
197 Ga0451853_0481791 3300041512 Bacteria 633
198 Ga0451853_1945486 3300041512 Bacteria 715
199 Ga0451853_2114537 3300041512 Bacteria 944
200 Ga0453683_1076460 3300044673 Bacteria 535
201 Ga0466961_0116732 3300044693 Unclassified 1677
202 Ga0466963_0510995 3300044694 Bacteria 848
203 Ga0453684_1321188 3300044712 Bacteria 751
204 Ga0466971_0563161 3300044719 Unclassified 566
205 Ga0495650_0147979 3300046471 Unclassified 845
206 Ga0495632_0110039 3300046519 Bacteria 1294
207 Ga0495643_0287417 3300046522 Bacteria 754
208 Ga0495625_0120704 3300046660 Bacteria 1784
209 Ga0495658_0574847 3300046683 Bacteria 722
210 Ga0495672_0339708 3300047320 Unclassified 700
211 Ga0495686_0090806 3300047472 Unclassified 1854
212 Ga0495686_0182911 3300047472 Bacteria 1213
213 Ga0496104_0306337 3300048907 Bacteria 1501
214 Ga0501292_136233 3300049515 Unclassified 511
215 Ga0501032_1077366 3300049569 Unclassified 504
216 Ga0501034_0141218 3300049571 Bacteria 2388
217 Ga0501034_0243273 3300049571 Bacteria 1745
218 Ga0501034_1248508 3300049571 Unclassified 621
219 Ga0501036_0240076 3300049572 Bacteria 1520
220 Ga0501043_0131266 3300049579 Bacteria 1963
221 Ga0501046_0510697 3300049580 Bacteria 860
222 Ga0501047_0107043 3300049581 Bacteria 2677
223 Ga0501067_0060310 3300049583 Bacteria 2100
224 Ga0501067_0203441 3300049583 Bacteria 1103
225 Ga0501068_0123646 3300049584 Bacteria 1615
226 Ga0501068_0254481 3300049584 Bacteria 1120
227 Ga0501070_0024354 3300049586 Bacteria 5077
228 Ga0501070_0024498 3300049586 Bacteria 5061
229 Ga0501070_0084277 3300049586 Bacteria 2631
230 Ga0501070_0157887 3300049586 Bacteria 1870
231 Ga0501071_0873121 3300049587 Bacteria 694
232 Ga0501071_0998476 3300049587 Bacteria 646
233 Ga0501073_0641563 3300049589 Bacteria 733
234 Ga0501074_0116431 3300049590 Bacteria 1912
235 Ga0501074_0145671 3300049590 Bacteria 1694
236 Ga0501074_1212295 3300049590 Bacteria 529
237 Ga0501227_080919 3300049665 Unclassified 851
238 Ga0501233_238950 3300049668 Unclassified 542
239 Ga0501079_1152839 3300049741 Unclassified 611
240 Ga0501080_0351130 3300049742 Bacteria 1332
241 Ga0501083_0117365 3300049744 Bacteria 1746
242 Ga0501035_0849573 3300049822 Bacteria 726
243 Ga0501044_0063269 3300049823 Bacteria 3780
244 Ga0501044_1180872 3300049823 Bacteria 633
245 Ga0501044_1500027 3300049823 Unclassified 539
246 nmdc:mga05p37_1319619_c1 3300050507 Unclassified 734
247 nmdc:mga05p37_595544_c1 3300050507 Unclassified 1249
248 nmdc:mga09592_357556_c1 3300050508 Bacteria 961
249 nmdc:mga09592_5486_c1 3300050508 Bacteria 10314
250 nmdc:mga09592_5923_c1 3300050508 Bacteria 9964
251 nmdc:mga0qj67_452149_c1 3300050509 Bacteria 1035
252 nmdc:mga08y16_9586_c1 3300050511 Bacteria 10165
253 nmdc:mga08y16_986624_c1 3300050511 Bacteria 823
254 nmdc:mga0rr50_1599067_c1 3300050513 Unclassified 550
255 nmdc:mga0rr50_180538_c1 3300050513 Unclassified 1725
256 Ga0500635_0003573 3300053080 Bacteria 3927
257 Ga0500578_0670937 3300053086 Bacteria 561
258 Ga0500578_0764748 3300053086 Bacteria 514
259 Ga0500646_0042382 3300053090 Unclassified 1285
260 Ga0500647_0184865 3300053091 Archaea 954
261 Ga0500583_0176516 3300053092 Bacteria 1064
262 Ga0500583_0226380 3300053092 Bacteria 926
263 Ga0500651_0382082 3300053093 Bacteria 794
264 Ga0500566_0001160 3300053094 Bacteria 15322
265 Ga0500566_0004252 3300053094 Bacteria 8546
266 Ga0500566_0100712 3300053094 Bacteria 1584
267 Ga0500640_006527 3300053095 Bacteria 4462
268 Ga0500554_000424 3300053102 Bacteria 8870
269 Ga0500558_219246 3300053106 Bacteria 648
270 Ga0500562_049834 3300053108 Unclassified 1119
271 Ga0500572_001055 3300053111 Bacteria 8184
272 Ga0500594_0122409 3300053118 Bacteria 818
273 Ga0500595_000145 3300053119 Bacteria 46383
274 Ga0500597_018566 3300053120 Bacteria 2699
275 Ga0500614_001272 3300053123 Bacteria 6100
276 Ga0500617_298345 3300053124 Unclassified 507
277 Ga0500642_0010480 3300053130 Bacteria 3270
278 Ga0500642_0098009 3300053130 Bacteria 1361
279 Ga0500652_058630 3300053131 Bacteria 1582
280 Ga0500652_362479 3300053131 Bacteria 545
281 Ga0500658_0211987 3300053134 Bacteria 887
282 Ga0500559_0004306 3300053136 Bacteria 6801
283 Ga0500559_0191869 3300053136 Bacteria 963
284 Ga0500568_0023937 3300053139 Bacteria 2591
285 Ga0500585_029399 3300053144 Bacteria 1879
286 Ga0500590_331761 3300053148 Bacteria 554
287 Ga0500603_007739 3300053150 Bacteria 2365
288 Ga0500620_188598 3300053155 Bacteria 708
289 Ga0500622_0186671 3300053156 Bacteria 953
290 Ga0500630_043722 3300053159 Unclassified 2181
291 Ga0500637_0111181 3300053178 Bacteria 1589
292 Ga0500637_0234165 3300053178 Unclassified 1033
293 Ga0501082_0653202 3300060353 Bacteria 920

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10093517 Ga0070658_100935172 102
2 3300028800 Ga0265338_10097142 Ga0265338_100971422 103
3 3300031595 Ga0265313_10266065 Ga0265313_102660652 103
4 3300031711 Ga0265314_10255848 Ga0265314_102558483 103
5 3300005347 Ga0070668_101581330 Ga0070668_1015813302 104
6 3300005440 Ga0070705_100257732 Ga0070705_1002577322 104
7 3300005471 Ga0070698_100344927 Ga0070698_1003449272 104
8 3300005471 Ga0070698_101286658 Ga0070698_1012866582 104
9 3300005536 Ga0070697_100566151 Ga0070697_1005661512 104
10 3300005719 Ga0068861_100035201 Ga0068861_1000352014 104
11 3300005843 Ga0068860_100289244 Ga0068860_1002892443 104
12 3300007076 Ga0075435_100087979 Ga0075435_1000879792 104
13 3300009094 Ga0111539_10001247 Ga0111539_1000124715 104
14 3300009094 Ga0111539_10273514 Ga0111539_102735142 104
15 3300009148 Ga0105243_11265255 Ga0105243_112652551 104
16 3300025935 Ga0207709_10736763 Ga0207709_107367632 104
17 3300026118 Ga0207675_100036310 Ga0207675_1000363103 104
18 3300027907 Ga0207428_10014733 Ga0207428_100147333 104
19 3300028381 Ga0268264_10129906 Ga0268264_101299062 104
20 3300031456 Ga0307513_10091917 Ga0307513_100919171 104
21 3300031901 Ga0307406_10420810 Ga0307406_104208102 104
22 3300049569 Ga0501032_1077366 Ga0501032_1077366_127_447 104
23 3300050511 nmdc:mga08y16_9586_c1 nmdc:mga08y16_9586_c1_3989_4327 104
24 3300050511 nmdc:mga08y16_986624_c1 nmdc:mga08y16_986624_c1_130_468 104
25 3300050513 nmdc:mga0rr50_180538_c1 nmdc:mga0rr50_180538_c1_1083_1421 104
26 3300003320 rootH2_10024812 rootH2_100248122 105
27 3300003323 rootH1_10169057 rootH1_101690572 105
28 3300005329 Ga0070683_100876549 Ga0070683_1008765492 105
29 3300005329 Ga0070683_100914085 Ga0070683_1009140851 105
30 3300005330 Ga0070690_100095670 Ga0070690_1000956703 105
31 3300005334 Ga0068869_100042573 Ga0068869_1000425732 105
32 3300005334 Ga0068869_100121139 Ga0068869_1001211393 105
33 3300005334 Ga0068869_100284372 Ga0068869_1002843722 105
34 3300005334 Ga0068869_100436601 Ga0068869_1004366012 105
35 3300005336 Ga0070680_100059017 Ga0070680_1000590174 105
36 3300005340 Ga0070689_100032006 Ga0070689_1000320065 105
37 3300005340 Ga0070689_100047788 Ga0070689_1000477882 105
38 3300005340 Ga0070689_100073761 Ga0070689_1000737613 105
39 3300005345 Ga0070692_10714663 Ga0070692_107146632 105
40 3300005365 Ga0070688_100064456 Ga0070688_1000644562 105
41 3300005365 Ga0070688_100636227 Ga0070688_1006362272 105
42 3300005365 Ga0070688_101241999 Ga0070688_1012419992 105
43 3300005367 Ga0070667_100064951 Ga0070667_1000649515 105
44 3300005434 Ga0070709_10567537 Ga0070709_105675372 105
45 3300005436 Ga0070713_101243534 Ga0070713_1012435342 105
46 3300005441 Ga0070700_100260355 Ga0070700_1002603551 105
47 3300005456 Ga0070678_100002853 Ga0070678_1000028536 105
48 3300005458 Ga0070681_10141329 Ga0070681_101413294 105
49 3300005458 Ga0070681_10687455 Ga0070681_106874552 105
50 3300005458 Ga0070681_11088461 Ga0070681_110884612 105
51 3300005466 Ga0070685_11343061 Ga0070685_113430611 105
52 3300005467 Ga0070706_100035278 Ga0070706_1000352784 105
53 3300005471 Ga0070698_100001138 Ga0070698_1000011382 105
54 3300005530 Ga0070679_100033128 Ga0070679_1000331285 105
55 3300005530 Ga0070679_101547643 Ga0070679_1015476431 105
56 3300005535 Ga0070684_100027448 Ga0070684_1000274486 105
57 3300005548 Ga0070665_100005561 Ga0070665_1000055612 105
58 3300005548 Ga0070665_101266202 Ga0070665_1012662023 105
59 3300005563 Ga0068855_100498165 Ga0068855_1004981652 105
60 3300005577 Ga0068857_101206268 Ga0068857_1012062682 105
61 3300005614 Ga0068856_100014588 Ga0068856_1000145886 105
62 3300005614 Ga0068856_101287556 Ga0068856_1012875562 105
63 3300005615 Ga0070702_100321307 Ga0070702_1003213072 105
64 3300005615 Ga0070702_101887598 Ga0070702_1018875981 105
65 3300005617 Ga0068859_100636584 Ga0068859_1006365842 105
66 3300005618 Ga0068864_100024485 Ga0068864_1000244855 105
67 3300005618 Ga0068864_101361854 Ga0068864_1013618541 105
68 3300005718 Ga0068866_10087153 Ga0068866_100871531 105
69 3300005840 Ga0068870_10352539 Ga0068870_103525392 105
70 3300005841 Ga0068863_100092274 Ga0068863_1000922744 105
71 3300005843 Ga0068860_100090682 Ga0068860_1000906823 105
72 3300005843 Ga0068860_101187936 Ga0068860_1011879362 105
73 3300005844 Ga0068862_100409152 Ga0068862_1004091522 105
74 3300005937 Ga0081455_10384421 Ga0081455_103844213 105
75 3300006028 Ga0070717_10154621 Ga0070717_101546212 105
76 3300006028 Ga0070717_10286619 Ga0070717_102866193 105
77 3300006237 Ga0097621_100621850 Ga0097621_1006218503 105
78 3300006237 Ga0097621_100621884 Ga0097621_1006218841 105
79 3300006237 Ga0097621_100851840 Ga0097621_1008518402 105
80 3300006237 Ga0097621_100874032 Ga0097621_1008740322 105
81 3300006358 Ga0068871_100356971 Ga0068871_1003569712 105
82 3300006358 Ga0068871_100407411 Ga0068871_1004074112 105
83 3300006846 Ga0075430_100499052 Ga0075430_1004990522 105
84 3300006871 Ga0075434_101118215 Ga0075434_1011182152 105
85 3300006880 Ga0075429_100006189 Ga0075429_1000061893 105
86 3300006880 Ga0075429_100422412 Ga0075429_1004224121 105
87 3300006880 Ga0075429_101178754 Ga0075429_1011787541 105
88 3300006880 Ga0075429_101955237 Ga0075429_1019552372 105
89 3300006931 Ga0097620_100636513 Ga0097620_1006365132 105
90 3300007076 Ga0075435_100159751 Ga0075435_1001597513 105
91 3300007076 Ga0075435_100894403 Ga0075435_1008944032 105
92 3300009093 Ga0105240_11280607 Ga0105240_112806072 105
93 3300009094 Ga0111539_13393410 Ga0111539_133934102 105
94 3300009098 Ga0105245_10000223 Ga0105245_100002233 105
95 3300009098 Ga0105245_10800694 Ga0105245_108006942 105
96 3300009147 Ga0114129_10919357 Ga0114129_109193572 105
97 3300009148 Ga0105243_10412053 Ga0105243_104120533 105
98 3300009174 Ga0105241_10309586 Ga0105241_103095862 105
99 3300009174 Ga0105241_11138450 Ga0105241_111384502 105
100 3300009176 Ga0105242_10503008 Ga0105242_105030081 105
101 3300009176 Ga0105242_11502471 Ga0105242_115024712 105
102 3300009177 Ga0105248_11305332 Ga0105248_113053322 105
103 3300009177 Ga0105248_12028599 Ga0105248_120285991 105
104 3300009177 Ga0105248_12780372 Ga0105248_127803722 105
105 3300009553 Ga0105249_10257608 Ga0105249_102576082 105
106 3300010375 Ga0105239_10280223 Ga0105239_102802232 105
107 3300010375 Ga0105239_12191774 Ga0105239_121917741 105
108 3300013296 Ga0157374_10081510 Ga0157374_100815104 105
109 3300013296 Ga0157374_12743577 Ga0157374_127435772 105
110 3300014325 Ga0163163_12378992 Ga0163163_123789922 105
111 3300014969 Ga0157376_10005449 Ga0157376_100054499 105
112 3300014969 Ga0157376_11227135 Ga0157376_112271352 105
113 3300014969 Ga0157376_12092568 Ga0157376_120925682 105
114 3300021384 Ga0213876_10031332 Ga0213876_100313322 105
115 3300025321 Ga0207656_10660792 Ga0207656_106607922 105
116 3300025908 Ga0207643_10398582 Ga0207643_103985822 105
117 3300025908 Ga0207643_10948609 Ga0207643_109486091 105
118 3300025910 Ga0207684_10115316 Ga0207684_101153162 105
119 3300025912 Ga0207707_10768616 Ga0207707_107686162 105
120 3300025917 Ga0207660_10055238 Ga0207660_100552382 105
121 3300025917 Ga0207660_10366554 Ga0207660_103665542 105
122 3300025918 Ga0207662_10182607 Ga0207662_101826073 105
123 3300025918 Ga0207662_10562094 Ga0207662_105620942 105
124 3300025921 Ga0207652_10035724 Ga0207652_100357246 105
125 3300025927 Ga0207687_10000120 Ga0207687_1000012023 105
126 3300025927 Ga0207687_10654061 Ga0207687_106540612 105
127 3300025936 Ga0207670_10030775 Ga0207670_100307752 105
128 3300025936 Ga0207670_10031316 Ga0207670_100313164 105
129 3300025936 Ga0207670_10046719 Ga0207670_100467192 105
130 3300025937 Ga0207669_10070338 Ga0207669_100703382 105
131 3300025938 Ga0207704_10571171 Ga0207704_105711713 105
132 3300025941 Ga0207711_10560919 Ga0207711_105609192 105
133 3300025941 Ga0207711_10707178 Ga0207711_107071782 105
134 3300025942 Ga0207689_10027406 Ga0207689_100274064 105
135 3300025942 Ga0207689_10088347 Ga0207689_100883473 105
136 3300025942 Ga0207689_10118102 Ga0207689_101181023 105
137 3300025944 Ga0207661_10434621 Ga0207661_104346213 105
138 3300025944 Ga0207661_10459079 Ga0207661_104590792 105
139 3300025949 Ga0207667_10898549 Ga0207667_108985492 105
140 3300025961 Ga0207712_10171170 Ga0207712_101711702 105
141 3300025986 Ga0207658_10047608 Ga0207658_100476082 105
142 3300026023 Ga0207677_10548640 Ga0207677_105486402 105
143 3300026023 Ga0207677_11913022 Ga0207677_119130221 105
144 3300026075 Ga0207708_10314338 Ga0207708_103143382 105
145 3300026075 Ga0207708_10939101 Ga0207708_109391012 105
146 3300026078 Ga0207702_10069770 Ga0207702_100697703 105
147 3300026078 Ga0207702_10849886 Ga0207702_108498863 105
148 3300026088 Ga0207641_10366729 Ga0207641_103667293 105
149 3300026089 Ga0207648_10892218 Ga0207648_108922182 105
150 3300026095 Ga0207676_10831684 Ga0207676_108316841 105
151 3300026095 Ga0207676_10957713 Ga0207676_109577132 105
152 3300026095 Ga0207676_12189743 Ga0207676_121897432 105
153 3300026116 Ga0207674_10826628 Ga0207674_108266282 105
154 3300026116 Ga0207674_11063590 Ga0207674_110635902 105
155 3300026118 Ga0207675_101245210 Ga0207675_1012452102 105
156 3300026121 Ga0207683_10002224 Ga0207683_100022245 105
157 3300028379 Ga0268266_10004111 Ga0268266_1000411111 105
158 3300028380 Ga0268265_10979466 Ga0268265_109794662 105
159 3300028381 Ga0268264_10902314 Ga0268264_109023142 105
160 3300028786 Ga0307517_10036718 Ga0307517_100367184 105
161 3300028794 Ga0307515_10025712 Ga0307515_100257125 105
162 3300028800 Ga0265338_10047162 Ga0265338_100471622 105
163 3300031238 Ga0265332_10005666 Ga0265332_100056663 105
164 3300031250 Ga0265331_10391203 Ga0265331_103912032 105
165 3300031456 Ga0307513_10429310 Ga0307513_104293103 105
166 3300031507 Ga0307509_10000111 Ga0307509_1000011121 105
167 3300031507 Ga0307509_10004236 Ga0307509_1000423623 105
168 3300031507 Ga0307509_10031864 Ga0307509_100318643 105
169 3300031507 Ga0307509_10075203 Ga0307509_100752034 105
170 3300031507 Ga0307509_10207687 Ga0307509_102076872 105
171 3300031616 Ga0307508_10090060 Ga0307508_100900603 105
172 3300031730 Ga0307516_10097810 Ga0307516_100978101 105
173 3300031903 Ga0307407_11645830 Ga0307407_116458301 105
174 3300032126 Ga0307415_100005501 Ga0307415_1000055014 105
175 3300033179 Ga0307507_10588189 Ga0307507_105881892 105
176 3300035090 Ga0373949_0000045 Ga0373949_0000045_17472_17789 105
177 3300035113 Ga0373936_0000005 Ga0373936_0000005_74761_75078 105
178 3300035114 Ga0373939_0081662 Ga0373939_0081662_333_650 105
179 3300035115 Ga0373941_0080476 Ga0373941_0080476_424_741 105
180 3300035116 Ga0373945_0394386 Ga0373945_0394386_224_541 105
181 3300035119 Ga0373956_0077692 Ga0373956_0077692_423_740 105
182 3300035241 Ga0373961_0000039 Ga0373961_0000039_4159_4476 105
183 3300037312 Ga0395899_0383158 Ga0395899_0383158_123_440 105
184 3300037312 Ga0395899_0655845 Ga0395899_0655845_43_360 105
185 3300037418 Ga0395900_0021997 Ga0395900_0021997_757_1074 105
186 3300037418 Ga0395900_1683022 Ga0395900_1683022_179_496 105
187 3300037466 Ga0395898_1932198 Ga0395898_1932198_138_455 105
188 3300037471 Ga0395905_0313897 Ga0395905_0313897_593_910 105
189 3300037471 Ga0395905_0448256 Ga0395905_0448256_152_469 105
190 3300037471 Ga0395905_1240395 Ga0395905_1240395_17_373 105
191 3300038443 Ga0395901_0015341 Ga0395901_0015341_5524_5841 105
192 3300038443 Ga0395901_0352710 Ga0395901_0352710_519_836 105
193 3300039437 Ga0436365_0109887 Ga0436365_0109887_66_383 105
194 3300039437 Ga0436365_0379180 Ga0436365_0379180_863_1198 105
195 3300039437 Ga0436365_0659839 Ga0436365_0659839_367_687 105
196 3300039437 Ga0436365_1368064 Ga0436365_1368064_1724_2041 105
197 3300039450 Ga0436363_1717800 Ga0436363_1717800_100_417 105
198 3300041452 Ga0451793_0508308 Ga0451793_0508308_997_1326 105
199 3300041459 Ga0451800_0882863 Ga0451800_0882863_86_406 105
200 3300041486 Ga0451807_2711463 Ga0451807_2711463_49_366 105
201 3300041512 Ga0451853_0481791 Ga0451853_0481791_296_616 105
202 3300041512 Ga0451853_1945486 Ga0451853_1945486_368_685 105
203 3300041512 Ga0451853_2114537 Ga0451853_2114537_425_742 105
204 3300044673 Ga0453683_1076460 Ga0453683_1076460_180_497 105
205 3300044693 Ga0466961_0116732 Ga0466961_0116732_1014_1331 105
206 3300044694 Ga0466963_0510995 Ga0466963_0510995_92_409 105
207 3300044712 Ga0453684_1321188 Ga0453684_1321188_86_403 105
208 3300044719 Ga0466971_0563161 Ga0466971_0563161_169_486 105
209 3300046471 Ga0495650_0147979 Ga0495650_0147979_325_660 105
210 3300046519 Ga0495632_0110039 Ga0495632_0110039_84_401 105
211 3300046522 Ga0495643_0287417 Ga0495643_0287417_115_432 105
212 3300046660 Ga0495625_0120704 Ga0495625_0120704_407_724 105
213 3300046683 Ga0495658_0574847 Ga0495658_0574847_349_690 105
214 3300047320 Ga0495672_0339708 Ga0495672_0339708_264_581 105
215 3300047472 Ga0495686_0090806 Ga0495686_0090806_457_774 105
216 3300047472 Ga0495686_0182911 Ga0495686_0182911_56_373 105
217 3300048907 Ga0496104_0306337 Ga0496104_0306337_13_330 105
218 3300049515 Ga0501292_136233 Ga0501292_136233_65_382 105
219 3300049571 Ga0501034_0141218 Ga0501034_0141218_881_1198 105
220 3300049571 Ga0501034_0243273 Ga0501034_0243273_103_423 105
221 3300049571 Ga0501034_1248508 Ga0501034_1248508_237_554 105
222 3300049572 Ga0501036_0240076 Ga0501036_0240076_828_1145 105
223 3300049579 Ga0501043_0131266 Ga0501043_0131266_62_379 105
224 3300049580 Ga0501046_0510697 Ga0501046_0510697_123_440 105
225 3300049581 Ga0501047_0107043 Ga0501047_0107043_503_820 105
226 3300049583 Ga0501067_0060310 Ga0501067_0060310_989_1306 105
227 3300049583 Ga0501067_0203441 Ga0501067_0203441_268_585 105
228 3300049584 Ga0501068_0123646 Ga0501068_0123646_658_975 105
229 3300049584 Ga0501068_0254481 Ga0501068_0254481_138_455 105
230 3300049586 Ga0501070_0024354 Ga0501070_0024354_3216_3533 105
231 3300049586 Ga0501070_0024498 Ga0501070_0024498_3226_3546 105
232 3300049586 Ga0501070_0084277 Ga0501070_0084277_372_689 105
233 3300049586 Ga0501070_0157887 Ga0501070_0157887_17_334 105
234 3300049587 Ga0501071_0873121 Ga0501071_0873121_182_499 105
235 3300049587 Ga0501071_0998476 Ga0501071_0998476_237_554 105
236 3300049589 Ga0501073_0641563 Ga0501073_0641563_15_332 105
237 3300049590 Ga0501074_0116431 Ga0501074_0116431_589_906 105
238 3300049590 Ga0501074_0145671 Ga0501074_0145671_472_789 105
239 3300049590 Ga0501074_1212295 Ga0501074_1212295_101_418 105
240 3300049665 Ga0501227_080919 Ga0501227_080919_298_615 105
241 3300049668 Ga0501233_238950 Ga0501233_238950_15_332 105
242 3300049741 Ga0501079_1152839 Ga0501079_1152839_234_551 105
243 3300049742 Ga0501080_0351130 Ga0501080_0351130_62_379 105
244 3300049744 Ga0501083_0117365 Ga0501083_0117365_696_1013 105
245 3300049822 Ga0501035_0849573 Ga0501035_0849573_387_704 105
246 3300049823 Ga0501044_0063269 Ga0501044_0063269_1499_1816 105
247 3300049823 Ga0501044_1180872 Ga0501044_1180872_245_562 105
248 3300049823 Ga0501044_1500027 Ga0501044_1500027_211_528 105
249 3300050507 nmdc:mga05p37_1319619_c1 nmdc:mga05p37_1319619_c1_276_605 105
250 3300050507 nmdc:mga05p37_595544_c1 nmdc:mga05p37_595544_c1_331_648 105
251 3300050508 nmdc:mga09592_357556_c1 nmdc:mga09592_357556_c1_336_653 105
252 3300050508 nmdc:mga09592_5486_c1 nmdc:mga09592_5486_c1_101_418 105
253 3300050508 nmdc:mga09592_5923_c1 nmdc:mga09592_5923_c1_8306_8623 105
254 3300050509 nmdc:mga0qj67_452149_c1 nmdc:mga0qj67_452149_c1_397_714 105
255 3300050513 nmdc:mga0rr50_1599067_c1 nmdc:mga0rr50_1599067_c1_46_363 105
256 3300053080 Ga0500635_0003573 Ga0500635_0003573_3397_3714 105
257 3300053086 Ga0500578_0670937 Ga0500578_0670937_41_358 105
258 3300053086 Ga0500578_0764748 Ga0500578_0764748_150_467 105
259 3300053090 Ga0500646_0042382 Ga0500646_0042382_440_757 105
260 3300053091 Ga0500647_0184865 Ga0500647_0184865_220_537 105
261 3300053092 Ga0500583_0176516 Ga0500583_0176516_86_403 105
262 3300053092 Ga0500583_0226380 Ga0500583_0226380_34_351 105
263 3300053093 Ga0500651_0382082 Ga0500651_0382082_397_714 105
264 3300053094 Ga0500566_0001160 Ga0500566_0001160_8745_9062 105
265 3300053094 Ga0500566_0004252 Ga0500566_0004252_6721_7038 105
266 3300053094 Ga0500566_0100712 Ga0500566_0100712_397_714 105
267 3300053095 Ga0500640_006527 Ga0500640_006527_3280_3597 105
268 3300053102 Ga0500554_000424 Ga0500554_000424_5886_6203 105
269 3300053106 Ga0500558_219246 Ga0500558_219246_37_354 105
270 3300053108 Ga0500562_049834 Ga0500562_049834_679_996 105
271 3300053111 Ga0500572_001055 Ga0500572_001055_861_1178 105
272 3300053118 Ga0500594_0122409 Ga0500594_0122409_108_425 105
273 3300053119 Ga0500595_000145 Ga0500595_000145_25529_25846 105
274 3300053120 Ga0500597_018566 Ga0500597_018566_913_1230 105
275 3300053123 Ga0500614_001272 Ga0500614_001272_5435_5752 105
276 3300053124 Ga0500617_298345 Ga0500617_298345_134_451 105
277 3300053130 Ga0500642_0010480 Ga0500642_0010480_30_347 105
278 3300053130 Ga0500642_0098009 Ga0500642_0098009_286_603 105
279 3300053131 Ga0500652_058630 Ga0500652_058630_811_1128 105
280 3300053131 Ga0500652_362479 Ga0500652_362479_177_494 105
281 3300053134 Ga0500658_0211987 Ga0500658_0211987_19_336 105
282 3300053136 Ga0500559_0004306 Ga0500559_0004306_4764_5081 105
283 3300053136 Ga0500559_0191869 Ga0500559_0191869_74_391 105
284 3300053139 Ga0500568_0023937 Ga0500568_0023937_702_1019 105
285 3300053144 Ga0500585_029399 Ga0500585_029399_302_619 105
286 3300053148 Ga0500590_331761 Ga0500590_331761_128_445 105
287 3300053150 Ga0500603_007739 Ga0500603_007739_259_576 105
288 3300053155 Ga0500620_188598 Ga0500620_188598_199_516 105
289 3300053156 Ga0500622_0186671 Ga0500622_0186671_118_435 105
290 3300053159 Ga0500630_043722 Ga0500630_043722_202_519 105
291 3300053178 Ga0500637_0111181 Ga0500637_0111181_804_1121 105
292 3300053178 Ga0500637_0234165 Ga0500637_0234165_520_837 105
293 3300060353 Ga0501082_0653202 Ga0501082_0653202_155_472 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01491

Frataxin_Cyay

Frataxin-like domain

21

123

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hs5-assembly2.cif.gz_B frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family 0.9361 1 103
1ew4-assembly1.cif.gz_A crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family 0.9111 1 105
1ew4-assembly1.cif.gz_A crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family 0.9029 1 105
3s5f-assembly1.cif.gz_A crystal structure of human frataxin variant w155f 0.8918 2 102
3t3l-assembly1.cif.gz_A 1.15 a structure of human frataxin variant q153a 0.8902 1 102
ID Description Score Start End Superfamily
af_Q54C45_74_193_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9159 2 102 3.30.920.10
af_Q07540_63_174_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9103 1 97 3.30.920.10
af_Q59PA3_59_177_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.9103 1 102 3.30.920.10
2p1xA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8989 1 103 3.30.920.10
af_Q59PA3_59_177_3.30.920.10 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.8777 1 102 3.30.920.10
ID Description Score Start End GO Terms
AF-A0A7J5ERV4-F1-model_v4 Iron donor protein CyaY 0.9902 1 105 GO:0005737
GO:0008199
GO:0016226
AF-A0A7W0ZXL4-F1-model_v4 Iron donor protein CyaY 0.9832 1 105 GO:0005737
GO:0008199
GO:0016226
AF-A0A661NUE5-F1-model_v4 Iron donor protein CyaY 0.9767 1 102 GO:0005737
GO:0008199
GO:0016226
AF-A0A7W0ZXL4-F1-model_v4 Iron donor protein CyaY 0.974 1 105 GO:0005737
GO:0008199
GO:0016226
AF-A0A0K1PG81-F1-model_v4 Frataxin CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly 0.9691 1 102 GO:0005829
GO:0008198
GO:0008199
GO:0016226

Feature Viewer

pLDDT pTM Quality
96.5 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map