F391461
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 293 | 192 | 293 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10000223|Ga0105245_100002233 |
| Length | 125 |
| Sequence | MSDAGGMTLMLTQKMRYIAPMDEATFDTTAHAELQAIEDAFADVDPDQVEITVSDGVLRLDLRDGTRIVINSHRAARQIWMAAIATAWHFDPTSAGSWVAPKTGEELRATLKGLLRERIGIAVTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 93 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 98 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 99 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 101 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 104 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 107 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 110 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 121 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 125 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 138 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 152 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 153 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 164 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 165 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 166 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 167 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 168 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 169 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 170 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 171 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 172 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 173 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 174 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 175 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 176 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 177 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 178 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 179 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 180 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 181 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 182 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 183 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 184 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 185 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 187 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 188 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 189 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 190 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 191 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.63 |
| Nodule | 0 |
| Rhizoplane | 1.37 |
| Rhizosphere | 78.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10024812 | 3300003320 | Bacteria | 1720 |
| 2 | rootH1_10169057 | 3300003323 | Bacteria | 1429 |
| 3 | Ga0070658_10093517 | 3300005327 | Bacteria | 2480 |
| 4 | Ga0070683_100876549 | 3300005329 | Bacteria | 861 |
| 5 | Ga0070683_100914085 | 3300005329 | Bacteria | 842 |
| 6 | Ga0070690_100095670 | 3300005330 | Bacteria | 1962 |
| 7 | Ga0068869_100042573 | 3300005334 | Bacteria | 3256 |
| 8 | Ga0068869_100121139 | 3300005334 | Bacteria | 2001 |
| 9 | Ga0068869_100284372 | 3300005334 | Bacteria | 1331 |
| 10 | Ga0068869_100436601 | 3300005334 | Unclassified | 1083 |
| 11 | Ga0070680_100059017 | 3300005336 | Bacteria | 3138 |
| 12 | Ga0070689_100032006 | 3300005340 | Bacteria | 3999 |
| 13 | Ga0070689_100047788 | 3300005340 | Bacteria | 3300 |
| 14 | Ga0070689_100073761 | 3300005340 | Bacteria | 2669 |
| 15 | Ga0070692_10714663 | 3300005345 | Bacteria | 676 |
| 16 | Ga0070668_101581330 | 3300005347 | Unclassified | 600 |
| 17 | Ga0070688_100064456 | 3300005365 | Bacteria | 2326 |
| 18 | Ga0070688_100636227 | 3300005365 | Bacteria | 820 |
| 19 | Ga0070688_101241999 | 3300005365 | Bacteria | 600 |
| 20 | Ga0070667_100064951 | 3300005367 | Bacteria | 3098 |
| 21 | Ga0070709_10567537 | 3300005434 | Bacteria | 870 |
| 22 | Ga0070713_101243534 | 3300005436 | Unclassified | 721 |
| 23 | Ga0070705_100257732 | 3300005440 | Bacteria | 1228 |
| 24 | Ga0070700_100260355 | 3300005441 | Archaea | 1249 |
| 25 | Ga0070678_100002853 | 3300005456 | Bacteria | 9565 |
| 26 | Ga0070681_10141329 | 3300005458 | Unclassified | 2337 |
| 27 | Ga0070681_10687455 | 3300005458 | Bacteria | 939 |
| 28 | Ga0070681_11088461 | 3300005458 | Bacteria | 720 |
| 29 | Ga0070685_11343061 | 3300005466 | Unclassified | 547 |
| 30 | Ga0070706_100035278 | 3300005467 | Bacteria | 4620 |
| 31 | Ga0070698_100001138 | 3300005471 | Bacteria | 29427 |
| 32 | Ga0070698_100344927 | 3300005471 | Bacteria | 1420 |
| 33 | Ga0070698_101286658 | 3300005471 | Bacteria | 681 |
| 34 | Ga0070679_100033128 | 3300005530 | Bacteria | 5115 |
| 35 | Ga0070679_101547643 | 3300005530 | Unclassified | 610 |
| 36 | Ga0070684_100027448 | 3300005535 | Bacteria | 4806 |
| 37 | Ga0070697_100566151 | 3300005536 | Bacteria | 997 |
| 38 | Ga0070665_100005561 | 3300005548 | Bacteria | 12962 |
| 39 | Ga0070665_101266202 | 3300005548 | Unclassified | 748 |
| 40 | Ga0068855_100498165 | 3300005563 | Unclassified | 1324 |
| 41 | Ga0068857_101206268 | 3300005577 | Bacteria | 733 |
| 42 | Ga0068856_100014588 | 3300005614 | Bacteria | 7591 |
| 43 | Ga0068856_101287556 | 3300005614 | Bacteria | 746 |
| 44 | Ga0070702_100321307 | 3300005615 | Bacteria | 1079 |
| 45 | Ga0070702_101887598 | 3300005615 | Bacteria | 501 |
| 46 | Ga0068859_100636584 | 3300005617 | Bacteria | 1159 |
| 47 | Ga0068864_100024485 | 3300005618 | Bacteria | 5079 |
| 48 | Ga0068864_101361854 | 3300005618 | Bacteria | 711 |
| 49 | Ga0068866_10087153 | 3300005718 | Bacteria | 1691 |
| 50 | Ga0068861_100035201 | 3300005719 | Bacteria | 3708 |
| 51 | Ga0068870_10352539 | 3300005840 | Bacteria | 945 |
| 52 | Ga0068863_100092274 | 3300005841 | Bacteria | 2873 |
| 53 | Ga0068860_100090682 | 3300005843 | Bacteria | 2912 |
| 54 | Ga0068860_100289244 | 3300005843 | Bacteria | 1603 |
| 55 | Ga0068860_101187936 | 3300005843 | Bacteria | 783 |
| 56 | Ga0068862_100409152 | 3300005844 | Unclassified | 1270 |
| 57 | Ga0081455_10384421 | 3300005937 | Bacteria | 979 |
| 58 | Ga0070717_10154621 | 3300006028 | Bacteria | 1986 |
| 59 | Ga0070717_10286619 | 3300006028 | Bacteria | 1461 |
| 60 | Ga0097621_100621850 | 3300006237 | Bacteria | 989 |
| 61 | Ga0097621_100621884 | 3300006237 | Viruses | 989 |
| 62 | Ga0097621_100851840 | 3300006237 | Bacteria | 847 |
| 63 | Ga0097621_100874032 | 3300006237 | Bacteria | 836 |
| 64 | Ga0068871_100356971 | 3300006358 | Bacteria | 1294 |
| 65 | Ga0068871_100407411 | 3300006358 | Bacteria | 1212 |
| 66 | Ga0075430_100499052 | 3300006846 | Bacteria | 1004 |
| 67 | Ga0075434_101118215 | 3300006871 | Bacteria | 801 |
| 68 | Ga0075429_100006189 | 3300006880 | Bacteria | 10349 |
| 69 | Ga0075429_100422412 | 3300006880 | Bacteria | 1168 |
| 70 | Ga0075429_101178754 | 3300006880 | Unclassified | 669 |
| 71 | Ga0075429_101955237 | 3300006880 | Bacteria | 508 |
| 72 | Ga0097620_100636513 | 3300006931 | Bacteria | 1159 |
| 73 | Ga0075435_100087979 | 3300007076 | Bacteria | 2560 |
| 74 | Ga0075435_100159751 | 3300007076 | Bacteria | 1898 |
| 75 | Ga0075435_100894403 | 3300007076 | Bacteria | 774 |
| 76 | Ga0105240_11280607 | 3300009093 | Unclassified | 774 |
| 77 | Ga0111539_10001247 | 3300009094 | Bacteria | 33877 |
| 78 | Ga0111539_10273514 | 3300009094 | Bacteria | 1966 |
| 79 | Ga0111539_13393410 | 3300009094 | Unclassified | 512 |
| 80 | Ga0105245_10000223 | 3300009098 | Bacteria | 53966 |
| 81 | Ga0105245_10800694 | 3300009098 | Bacteria | 980 |
| 82 | Ga0114129_10919357 | 3300009147 | Bacteria | 1107 |
| 83 | Ga0105243_10412053 | 3300009148 | Bacteria | 1258 |
| 84 | Ga0105243_11265255 | 3300009148 | Bacteria | 753 |
| 85 | Ga0105241_10309586 | 3300009174 | Unclassified | 1358 |
| 86 | Ga0105241_11138450 | 3300009174 | Bacteria | 736 |
| 87 | Ga0105242_10503008 | 3300009176 | Bacteria | 1153 |
| 88 | Ga0105242_11502471 | 3300009176 | Unclassified | 704 |
| 89 | Ga0105248_11305332 | 3300009177 | Bacteria | 821 |
| 90 | Ga0105248_12028599 | 3300009177 | Bacteria | 654 |
| 91 | Ga0105248_12780372 | 3300009177 | Bacteria | 558 |
| 92 | Ga0105249_10257608 | 3300009553 | Unclassified | 1732 |
| 93 | Ga0105239_10280223 | 3300010375 | Unclassified | 1877 |
| 94 | Ga0105239_12191774 | 3300010375 | Unclassified | 642 |
| 95 | Ga0157374_10081510 | 3300013296 | Bacteria | 3070 |
| 96 | Ga0157374_12743577 | 3300013296 | Bacteria | 520 |
| 97 | Ga0163163_12378992 | 3300014325 | Bacteria | 588 |
| 98 | Ga0157376_10005449 | 3300014969 | Bacteria | 8896 |
| 99 | Ga0157376_11227135 | 3300014969 | Bacteria | 778 |
| 100 | Ga0157376_12092568 | 3300014969 | Unclassified | 604 |
| 101 | Ga0213876_10031332 | 3300021384 | Bacteria | 2806 |
| 102 | Ga0207656_10660792 | 3300025321 | Bacteria | 535 |
| 103 | Ga0207643_10398582 | 3300025908 | Bacteria | 870 |
| 104 | Ga0207643_10948609 | 3300025908 | Bacteria | 557 |
| 105 | Ga0207684_10115316 | 3300025910 | Unclassified | 2301 |
| 106 | Ga0207707_10768616 | 3300025912 | Bacteria | 804 |
| 107 | Ga0207660_10055238 | 3300025917 | Unclassified | 2837 |
| 108 | Ga0207660_10366554 | 3300025917 | Bacteria | 1156 |
| 109 | Ga0207662_10182607 | 3300025918 | Bacteria | 1350 |
| 110 | Ga0207662_10562094 | 3300025918 | Unclassified | 791 |
| 111 | Ga0207652_10035724 | 3300025921 | Bacteria | 4197 |
| 112 | Ga0207687_10000120 | 3300025927 | Bacteria | 54782 |
| 113 | Ga0207687_10654061 | 3300025927 | Bacteria | 889 |
| 114 | Ga0207709_10736763 | 3300025935 | Bacteria | 791 |
| 115 | Ga0207670_10030775 | 3300025936 | Bacteria | 3431 |
| 116 | Ga0207670_10031316 | 3300025936 | Bacteria | 3407 |
| 117 | Ga0207670_10046719 | 3300025936 | Bacteria | 2878 |
| 118 | Ga0207669_10070338 | 3300025937 | Unclassified | 2194 |
| 119 | Ga0207704_10571171 | 3300025938 | Unclassified | 922 |
| 120 | Ga0207711_10560919 | 3300025941 | Bacteria | 1065 |
| 121 | Ga0207711_10707178 | 3300025941 | Bacteria | 940 |
| 122 | Ga0207689_10027406 | 3300025942 | Bacteria | 4770 |
| 123 | Ga0207689_10088347 | 3300025942 | Bacteria | 2546 |
| 124 | Ga0207689_10118102 | 3300025942 | Bacteria | 2181 |
| 125 | Ga0207661_10434621 | 3300025944 | Unclassified | 1194 |
| 126 | Ga0207661_10459079 | 3300025944 | Unclassified | 1161 |
| 127 | Ga0207667_10898549 | 3300025949 | Bacteria | 878 |
| 128 | Ga0207712_10171170 | 3300025961 | Unclassified | 1698 |
| 129 | Ga0207658_10047608 | 3300025986 | Bacteria | 3139 |
| 130 | Ga0207677_10548640 | 3300026023 | Unclassified | 1007 |
| 131 | Ga0207677_11913022 | 3300026023 | Bacteria | 551 |
| 132 | Ga0207708_10314338 | 3300026075 | Unclassified | 1277 |
| 133 | Ga0207708_10939101 | 3300026075 | Bacteria | 750 |
| 134 | Ga0207702_10069770 | 3300026078 | Bacteria | 3022 |
| 135 | Ga0207702_10849886 | 3300026078 | Bacteria | 903 |
| 136 | Ga0207641_10366729 | 3300026088 | Unclassified | 1376 |
| 137 | Ga0207648_10892218 | 3300026089 | Bacteria | 830 |
| 138 | Ga0207676_10831684 | 3300026095 | Bacteria | 902 |
| 139 | Ga0207676_10957713 | 3300026095 | Unclassified | 842 |
| 140 | Ga0207676_12189743 | 3300026095 | Bacteria | 551 |
| 141 | Ga0207674_10826628 | 3300026116 | Bacteria | 894 |
| 142 | Ga0207674_11063590 | 3300026116 | Bacteria | 778 |
| 143 | Ga0207675_100036310 | 3300026118 | Bacteria | 4598 |
| 144 | Ga0207675_101245210 | 3300026118 | Bacteria | 764 |
| 145 | Ga0207683_10002224 | 3300026121 | Bacteria | 17070 |
| 146 | Ga0207428_10014733 | 3300027907 | Bacteria | 6773 |
| 147 | Ga0268266_10004111 | 3300028379 | Bacteria | 14054 |
| 148 | Ga0268265_10979466 | 3300028380 | Unclassified | 834 |
| 149 | Ga0268264_10129906 | 3300028381 | Bacteria | 2231 |
| 150 | Ga0268264_10902314 | 3300028381 | Bacteria | 887 |
| 151 | Ga0307517_10036718 | 3300028786 | Bacteria | 5500 |
| 152 | Ga0307515_10025712 | 3300028794 | Bacteria | 10172 |
| 153 | Ga0265338_10047162 | 3300028800 | Bacteria | 3939 |
| 154 | Ga0265338_10097142 | 3300028800 | Unclassified | 2414 |
| 155 | Ga0265332_10005666 | 3300031238 | Bacteria | 5741 |
| 156 | Ga0265331_10391203 | 3300031250 | Unclassified | 623 |
| 157 | Ga0307513_10091917 | 3300031456 | Bacteria | 3091 |
| 158 | Ga0307513_10429310 | 3300031456 | Bacteria | 1050 |
| 159 | Ga0307509_10000111 | 3300031507 | Bacteria | 117078 |
| 160 | Ga0307509_10004236 | 3300031507 | Bacteria | 20915 |
| 161 | Ga0307509_10031864 | 3300031507 | Bacteria | 5814 |
| 162 | Ga0307509_10075203 | 3300031507 | Bacteria | 3509 |
| 163 | Ga0307509_10207687 | 3300031507 | Bacteria | 1787 |
| 164 | Ga0265313_10266065 | 3300031595 | Bacteria | 696 |
| 165 | Ga0307508_10090060 | 3300031616 | Bacteria | 2654 |
| 166 | Ga0265314_10255848 | 3300031711 | Unclassified | 1003 |
| 167 | Ga0307516_10097810 | 3300031730 | Bacteria | 2754 |
| 168 | Ga0307406_10420810 | 3300031901 | Bacteria | 1064 |
| 169 | Ga0307407_11645830 | 3300031903 | Bacteria | 510 |
| 170 | Ga0307415_100005501 | 3300032126 | Bacteria | 6733 |
| 171 | Ga0307507_10588189 | 3300033179 | Bacteria | 578 |
| 172 | Ga0373949_0000045 | 3300035090 | Bacteria | 45428 |
| 173 | Ga0373936_0000005 | 3300035113 | Bacteria | 325848 |
| 174 | Ga0373939_0081662 | 3300035114 | Bacteria | 1074 |
| 175 | Ga0373941_0080476 | 3300035115 | Bacteria | 1099 |
| 176 | Ga0373945_0394386 | 3300035116 | Unclassified | 606 |
| 177 | Ga0373956_0077692 | 3300035119 | Unclassified | 1520 |
| 178 | Ga0373961_0000039 | 3300035241 | Bacteria | 78101 |
| 179 | Ga0395899_0383158 | 3300037312 | Bacteria | 934 |
| 180 | Ga0395899_0655845 | 3300037312 | Bacteria | 663 |
| 181 | Ga0395900_0021997 | 3300037418 | Bacteria | 6520 |
| 182 | Ga0395900_1683022 | 3300037418 | Unclassified | 545 |
| 183 | Ga0395898_1932198 | 3300037466 | Bacteria | 510 |
| 184 | Ga0395905_0313897 | 3300037471 | Bacteria | 1456 |
| 185 | Ga0395905_0448256 | 3300037471 | Unclassified | 1188 |
| 186 | Ga0395905_1240395 | 3300037471 | Unclassified | 649 |
| 187 | Ga0395901_0015341 | 3300038443 | Bacteria | 7797 |
| 188 | Ga0395901_0352710 | 3300038443 | Bacteria | 1518 |
| 189 | Ga0436365_0109887 | 3300039437 | Unclassified | 583 |
| 190 | Ga0436365_0379180 | 3300039437 | Bacteria | 1218 |
| 191 | Ga0436365_0659839 | 3300039437 | Unclassified | 1012 |
| 192 | Ga0436365_1368064 | 3300039437 | Bacteria | 3997 |
| 193 | Ga0436363_1717800 | 3300039450 | Bacteria | 1388 |
| 194 | Ga0451793_0508308 | 3300041452 | Bacteria | 2277 |
| 195 | Ga0451800_0882863 | 3300041459 | Bacteria | 592 |
| 196 | Ga0451807_2711463 | 3300041486 | Bacteria | 542 |
| 197 | Ga0451853_0481791 | 3300041512 | Bacteria | 633 |
| 198 | Ga0451853_1945486 | 3300041512 | Bacteria | 715 |
| 199 | Ga0451853_2114537 | 3300041512 | Bacteria | 944 |
| 200 | Ga0453683_1076460 | 3300044673 | Bacteria | 535 |
| 201 | Ga0466961_0116732 | 3300044693 | Unclassified | 1677 |
| 202 | Ga0466963_0510995 | 3300044694 | Bacteria | 848 |
| 203 | Ga0453684_1321188 | 3300044712 | Bacteria | 751 |
| 204 | Ga0466971_0563161 | 3300044719 | Unclassified | 566 |
| 205 | Ga0495650_0147979 | 3300046471 | Unclassified | 845 |
| 206 | Ga0495632_0110039 | 3300046519 | Bacteria | 1294 |
| 207 | Ga0495643_0287417 | 3300046522 | Bacteria | 754 |
| 208 | Ga0495625_0120704 | 3300046660 | Bacteria | 1784 |
| 209 | Ga0495658_0574847 | 3300046683 | Bacteria | 722 |
| 210 | Ga0495672_0339708 | 3300047320 | Unclassified | 700 |
| 211 | Ga0495686_0090806 | 3300047472 | Unclassified | 1854 |
| 212 | Ga0495686_0182911 | 3300047472 | Bacteria | 1213 |
| 213 | Ga0496104_0306337 | 3300048907 | Bacteria | 1501 |
| 214 | Ga0501292_136233 | 3300049515 | Unclassified | 511 |
| 215 | Ga0501032_1077366 | 3300049569 | Unclassified | 504 |
| 216 | Ga0501034_0141218 | 3300049571 | Bacteria | 2388 |
| 217 | Ga0501034_0243273 | 3300049571 | Bacteria | 1745 |
| 218 | Ga0501034_1248508 | 3300049571 | Unclassified | 621 |
| 219 | Ga0501036_0240076 | 3300049572 | Bacteria | 1520 |
| 220 | Ga0501043_0131266 | 3300049579 | Bacteria | 1963 |
| 221 | Ga0501046_0510697 | 3300049580 | Bacteria | 860 |
| 222 | Ga0501047_0107043 | 3300049581 | Bacteria | 2677 |
| 223 | Ga0501067_0060310 | 3300049583 | Bacteria | 2100 |
| 224 | Ga0501067_0203441 | 3300049583 | Bacteria | 1103 |
| 225 | Ga0501068_0123646 | 3300049584 | Bacteria | 1615 |
| 226 | Ga0501068_0254481 | 3300049584 | Bacteria | 1120 |
| 227 | Ga0501070_0024354 | 3300049586 | Bacteria | 5077 |
| 228 | Ga0501070_0024498 | 3300049586 | Bacteria | 5061 |
| 229 | Ga0501070_0084277 | 3300049586 | Bacteria | 2631 |
| 230 | Ga0501070_0157887 | 3300049586 | Bacteria | 1870 |
| 231 | Ga0501071_0873121 | 3300049587 | Bacteria | 694 |
| 232 | Ga0501071_0998476 | 3300049587 | Bacteria | 646 |
| 233 | Ga0501073_0641563 | 3300049589 | Bacteria | 733 |
| 234 | Ga0501074_0116431 | 3300049590 | Bacteria | 1912 |
| 235 | Ga0501074_0145671 | 3300049590 | Bacteria | 1694 |
| 236 | Ga0501074_1212295 | 3300049590 | Bacteria | 529 |
| 237 | Ga0501227_080919 | 3300049665 | Unclassified | 851 |
| 238 | Ga0501233_238950 | 3300049668 | Unclassified | 542 |
| 239 | Ga0501079_1152839 | 3300049741 | Unclassified | 611 |
| 240 | Ga0501080_0351130 | 3300049742 | Bacteria | 1332 |
| 241 | Ga0501083_0117365 | 3300049744 | Bacteria | 1746 |
| 242 | Ga0501035_0849573 | 3300049822 | Bacteria | 726 |
| 243 | Ga0501044_0063269 | 3300049823 | Bacteria | 3780 |
| 244 | Ga0501044_1180872 | 3300049823 | Bacteria | 633 |
| 245 | Ga0501044_1500027 | 3300049823 | Unclassified | 539 |
| 246 | nmdc:mga05p37_1319619_c1 | 3300050507 | Unclassified | 734 |
| 247 | nmdc:mga05p37_595544_c1 | 3300050507 | Unclassified | 1249 |
| 248 | nmdc:mga09592_357556_c1 | 3300050508 | Bacteria | 961 |
| 249 | nmdc:mga09592_5486_c1 | 3300050508 | Bacteria | 10314 |
| 250 | nmdc:mga09592_5923_c1 | 3300050508 | Bacteria | 9964 |
| 251 | nmdc:mga0qj67_452149_c1 | 3300050509 | Bacteria | 1035 |
| 252 | nmdc:mga08y16_9586_c1 | 3300050511 | Bacteria | 10165 |
| 253 | nmdc:mga08y16_986624_c1 | 3300050511 | Bacteria | 823 |
| 254 | nmdc:mga0rr50_1599067_c1 | 3300050513 | Unclassified | 550 |
| 255 | nmdc:mga0rr50_180538_c1 | 3300050513 | Unclassified | 1725 |
| 256 | Ga0500635_0003573 | 3300053080 | Bacteria | 3927 |
| 257 | Ga0500578_0670937 | 3300053086 | Bacteria | 561 |
| 258 | Ga0500578_0764748 | 3300053086 | Bacteria | 514 |
| 259 | Ga0500646_0042382 | 3300053090 | Unclassified | 1285 |
| 260 | Ga0500647_0184865 | 3300053091 | Archaea | 954 |
| 261 | Ga0500583_0176516 | 3300053092 | Bacteria | 1064 |
| 262 | Ga0500583_0226380 | 3300053092 | Bacteria | 926 |
| 263 | Ga0500651_0382082 | 3300053093 | Bacteria | 794 |
| 264 | Ga0500566_0001160 | 3300053094 | Bacteria | 15322 |
| 265 | Ga0500566_0004252 | 3300053094 | Bacteria | 8546 |
| 266 | Ga0500566_0100712 | 3300053094 | Bacteria | 1584 |
| 267 | Ga0500640_006527 | 3300053095 | Bacteria | 4462 |
| 268 | Ga0500554_000424 | 3300053102 | Bacteria | 8870 |
| 269 | Ga0500558_219246 | 3300053106 | Bacteria | 648 |
| 270 | Ga0500562_049834 | 3300053108 | Unclassified | 1119 |
| 271 | Ga0500572_001055 | 3300053111 | Bacteria | 8184 |
| 272 | Ga0500594_0122409 | 3300053118 | Bacteria | 818 |
| 273 | Ga0500595_000145 | 3300053119 | Bacteria | 46383 |
| 274 | Ga0500597_018566 | 3300053120 | Bacteria | 2699 |
| 275 | Ga0500614_001272 | 3300053123 | Bacteria | 6100 |
| 276 | Ga0500617_298345 | 3300053124 | Unclassified | 507 |
| 277 | Ga0500642_0010480 | 3300053130 | Bacteria | 3270 |
| 278 | Ga0500642_0098009 | 3300053130 | Bacteria | 1361 |
| 279 | Ga0500652_058630 | 3300053131 | Bacteria | 1582 |
| 280 | Ga0500652_362479 | 3300053131 | Bacteria | 545 |
| 281 | Ga0500658_0211987 | 3300053134 | Bacteria | 887 |
| 282 | Ga0500559_0004306 | 3300053136 | Bacteria | 6801 |
| 283 | Ga0500559_0191869 | 3300053136 | Bacteria | 963 |
| 284 | Ga0500568_0023937 | 3300053139 | Bacteria | 2591 |
| 285 | Ga0500585_029399 | 3300053144 | Bacteria | 1879 |
| 286 | Ga0500590_331761 | 3300053148 | Bacteria | 554 |
| 287 | Ga0500603_007739 | 3300053150 | Bacteria | 2365 |
| 288 | Ga0500620_188598 | 3300053155 | Bacteria | 708 |
| 289 | Ga0500622_0186671 | 3300053156 | Bacteria | 953 |
| 290 | Ga0500630_043722 | 3300053159 | Unclassified | 2181 |
| 291 | Ga0500637_0111181 | 3300053178 | Bacteria | 1589 |
| 292 | Ga0500637_0234165 | 3300053178 | Unclassified | 1033 |
| 293 | Ga0501082_0653202 | 3300060353 | Bacteria | 920 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10093517 | Ga0070658_100935172 | 102 |
| 2 | 3300028800 | Ga0265338_10097142 | Ga0265338_100971422 | 103 |
| 3 | 3300031595 | Ga0265313_10266065 | Ga0265313_102660652 | 103 |
| 4 | 3300031711 | Ga0265314_10255848 | Ga0265314_102558483 | 103 |
| 5 | 3300005347 | Ga0070668_101581330 | Ga0070668_1015813302 | 104 |
| 6 | 3300005440 | Ga0070705_100257732 | Ga0070705_1002577322 | 104 |
| 7 | 3300005471 | Ga0070698_100344927 | Ga0070698_1003449272 | 104 |
| 8 | 3300005471 | Ga0070698_101286658 | Ga0070698_1012866582 | 104 |
| 9 | 3300005536 | Ga0070697_100566151 | Ga0070697_1005661512 | 104 |
| 10 | 3300005719 | Ga0068861_100035201 | Ga0068861_1000352014 | 104 |
| 11 | 3300005843 | Ga0068860_100289244 | Ga0068860_1002892443 | 104 |
| 12 | 3300007076 | Ga0075435_100087979 | Ga0075435_1000879792 | 104 |
| 13 | 3300009094 | Ga0111539_10001247 | Ga0111539_1000124715 | 104 |
| 14 | 3300009094 | Ga0111539_10273514 | Ga0111539_102735142 | 104 |
| 15 | 3300009148 | Ga0105243_11265255 | Ga0105243_112652551 | 104 |
| 16 | 3300025935 | Ga0207709_10736763 | Ga0207709_107367632 | 104 |
| 17 | 3300026118 | Ga0207675_100036310 | Ga0207675_1000363103 | 104 |
| 18 | 3300027907 | Ga0207428_10014733 | Ga0207428_100147333 | 104 |
| 19 | 3300028381 | Ga0268264_10129906 | Ga0268264_101299062 | 104 |
| 20 | 3300031456 | Ga0307513_10091917 | Ga0307513_100919171 | 104 |
| 21 | 3300031901 | Ga0307406_10420810 | Ga0307406_104208102 | 104 |
| 22 | 3300049569 | Ga0501032_1077366 | Ga0501032_1077366_127_447 | 104 |
| 23 | 3300050511 | nmdc:mga08y16_9586_c1 | nmdc:mga08y16_9586_c1_3989_4327 | 104 |
| 24 | 3300050511 | nmdc:mga08y16_986624_c1 | nmdc:mga08y16_986624_c1_130_468 | 104 |
| 25 | 3300050513 | nmdc:mga0rr50_180538_c1 | nmdc:mga0rr50_180538_c1_1083_1421 | 104 |
| 26 | 3300003320 | rootH2_10024812 | rootH2_100248122 | 105 |
| 27 | 3300003323 | rootH1_10169057 | rootH1_101690572 | 105 |
| 28 | 3300005329 | Ga0070683_100876549 | Ga0070683_1008765492 | 105 |
| 29 | 3300005329 | Ga0070683_100914085 | Ga0070683_1009140851 | 105 |
| 30 | 3300005330 | Ga0070690_100095670 | Ga0070690_1000956703 | 105 |
| 31 | 3300005334 | Ga0068869_100042573 | Ga0068869_1000425732 | 105 |
| 32 | 3300005334 | Ga0068869_100121139 | Ga0068869_1001211393 | 105 |
| 33 | 3300005334 | Ga0068869_100284372 | Ga0068869_1002843722 | 105 |
| 34 | 3300005334 | Ga0068869_100436601 | Ga0068869_1004366012 | 105 |
| 35 | 3300005336 | Ga0070680_100059017 | Ga0070680_1000590174 | 105 |
| 36 | 3300005340 | Ga0070689_100032006 | Ga0070689_1000320065 | 105 |
| 37 | 3300005340 | Ga0070689_100047788 | Ga0070689_1000477882 | 105 |
| 38 | 3300005340 | Ga0070689_100073761 | Ga0070689_1000737613 | 105 |
| 39 | 3300005345 | Ga0070692_10714663 | Ga0070692_107146632 | 105 |
| 40 | 3300005365 | Ga0070688_100064456 | Ga0070688_1000644562 | 105 |
| 41 | 3300005365 | Ga0070688_100636227 | Ga0070688_1006362272 | 105 |
| 42 | 3300005365 | Ga0070688_101241999 | Ga0070688_1012419992 | 105 |
| 43 | 3300005367 | Ga0070667_100064951 | Ga0070667_1000649515 | 105 |
| 44 | 3300005434 | Ga0070709_10567537 | Ga0070709_105675372 | 105 |
| 45 | 3300005436 | Ga0070713_101243534 | Ga0070713_1012435342 | 105 |
| 46 | 3300005441 | Ga0070700_100260355 | Ga0070700_1002603551 | 105 |
| 47 | 3300005456 | Ga0070678_100002853 | Ga0070678_1000028536 | 105 |
| 48 | 3300005458 | Ga0070681_10141329 | Ga0070681_101413294 | 105 |
| 49 | 3300005458 | Ga0070681_10687455 | Ga0070681_106874552 | 105 |
| 50 | 3300005458 | Ga0070681_11088461 | Ga0070681_110884612 | 105 |
| 51 | 3300005466 | Ga0070685_11343061 | Ga0070685_113430611 | 105 |
| 52 | 3300005467 | Ga0070706_100035278 | Ga0070706_1000352784 | 105 |
| 53 | 3300005471 | Ga0070698_100001138 | Ga0070698_1000011382 | 105 |
| 54 | 3300005530 | Ga0070679_100033128 | Ga0070679_1000331285 | 105 |
| 55 | 3300005530 | Ga0070679_101547643 | Ga0070679_1015476431 | 105 |
| 56 | 3300005535 | Ga0070684_100027448 | Ga0070684_1000274486 | 105 |
| 57 | 3300005548 | Ga0070665_100005561 | Ga0070665_1000055612 | 105 |
| 58 | 3300005548 | Ga0070665_101266202 | Ga0070665_1012662023 | 105 |
| 59 | 3300005563 | Ga0068855_100498165 | Ga0068855_1004981652 | 105 |
| 60 | 3300005577 | Ga0068857_101206268 | Ga0068857_1012062682 | 105 |
| 61 | 3300005614 | Ga0068856_100014588 | Ga0068856_1000145886 | 105 |
| 62 | 3300005614 | Ga0068856_101287556 | Ga0068856_1012875562 | 105 |
| 63 | 3300005615 | Ga0070702_100321307 | Ga0070702_1003213072 | 105 |
| 64 | 3300005615 | Ga0070702_101887598 | Ga0070702_1018875981 | 105 |
| 65 | 3300005617 | Ga0068859_100636584 | Ga0068859_1006365842 | 105 |
| 66 | 3300005618 | Ga0068864_100024485 | Ga0068864_1000244855 | 105 |
| 67 | 3300005618 | Ga0068864_101361854 | Ga0068864_1013618541 | 105 |
| 68 | 3300005718 | Ga0068866_10087153 | Ga0068866_100871531 | 105 |
| 69 | 3300005840 | Ga0068870_10352539 | Ga0068870_103525392 | 105 |
| 70 | 3300005841 | Ga0068863_100092274 | Ga0068863_1000922744 | 105 |
| 71 | 3300005843 | Ga0068860_100090682 | Ga0068860_1000906823 | 105 |
| 72 | 3300005843 | Ga0068860_101187936 | Ga0068860_1011879362 | 105 |
| 73 | 3300005844 | Ga0068862_100409152 | Ga0068862_1004091522 | 105 |
| 74 | 3300005937 | Ga0081455_10384421 | Ga0081455_103844213 | 105 |
| 75 | 3300006028 | Ga0070717_10154621 | Ga0070717_101546212 | 105 |
| 76 | 3300006028 | Ga0070717_10286619 | Ga0070717_102866193 | 105 |
| 77 | 3300006237 | Ga0097621_100621850 | Ga0097621_1006218503 | 105 |
| 78 | 3300006237 | Ga0097621_100621884 | Ga0097621_1006218841 | 105 |
| 79 | 3300006237 | Ga0097621_100851840 | Ga0097621_1008518402 | 105 |
| 80 | 3300006237 | Ga0097621_100874032 | Ga0097621_1008740322 | 105 |
| 81 | 3300006358 | Ga0068871_100356971 | Ga0068871_1003569712 | 105 |
| 82 | 3300006358 | Ga0068871_100407411 | Ga0068871_1004074112 | 105 |
| 83 | 3300006846 | Ga0075430_100499052 | Ga0075430_1004990522 | 105 |
| 84 | 3300006871 | Ga0075434_101118215 | Ga0075434_1011182152 | 105 |
| 85 | 3300006880 | Ga0075429_100006189 | Ga0075429_1000061893 | 105 |
| 86 | 3300006880 | Ga0075429_100422412 | Ga0075429_1004224121 | 105 |
| 87 | 3300006880 | Ga0075429_101178754 | Ga0075429_1011787541 | 105 |
| 88 | 3300006880 | Ga0075429_101955237 | Ga0075429_1019552372 | 105 |
| 89 | 3300006931 | Ga0097620_100636513 | Ga0097620_1006365132 | 105 |
| 90 | 3300007076 | Ga0075435_100159751 | Ga0075435_1001597513 | 105 |
| 91 | 3300007076 | Ga0075435_100894403 | Ga0075435_1008944032 | 105 |
| 92 | 3300009093 | Ga0105240_11280607 | Ga0105240_112806072 | 105 |
| 93 | 3300009094 | Ga0111539_13393410 | Ga0111539_133934102 | 105 |
| 94 | 3300009098 | Ga0105245_10000223 | Ga0105245_100002233 | 105 |
| 95 | 3300009098 | Ga0105245_10800694 | Ga0105245_108006942 | 105 |
| 96 | 3300009147 | Ga0114129_10919357 | Ga0114129_109193572 | 105 |
| 97 | 3300009148 | Ga0105243_10412053 | Ga0105243_104120533 | 105 |
| 98 | 3300009174 | Ga0105241_10309586 | Ga0105241_103095862 | 105 |
| 99 | 3300009174 | Ga0105241_11138450 | Ga0105241_111384502 | 105 |
| 100 | 3300009176 | Ga0105242_10503008 | Ga0105242_105030081 | 105 |
| 101 | 3300009176 | Ga0105242_11502471 | Ga0105242_115024712 | 105 |
| 102 | 3300009177 | Ga0105248_11305332 | Ga0105248_113053322 | 105 |
| 103 | 3300009177 | Ga0105248_12028599 | Ga0105248_120285991 | 105 |
| 104 | 3300009177 | Ga0105248_12780372 | Ga0105248_127803722 | 105 |
| 105 | 3300009553 | Ga0105249_10257608 | Ga0105249_102576082 | 105 |
| 106 | 3300010375 | Ga0105239_10280223 | Ga0105239_102802232 | 105 |
| 107 | 3300010375 | Ga0105239_12191774 | Ga0105239_121917741 | 105 |
| 108 | 3300013296 | Ga0157374_10081510 | Ga0157374_100815104 | 105 |
| 109 | 3300013296 | Ga0157374_12743577 | Ga0157374_127435772 | 105 |
| 110 | 3300014325 | Ga0163163_12378992 | Ga0163163_123789922 | 105 |
| 111 | 3300014969 | Ga0157376_10005449 | Ga0157376_100054499 | 105 |
| 112 | 3300014969 | Ga0157376_11227135 | Ga0157376_112271352 | 105 |
| 113 | 3300014969 | Ga0157376_12092568 | Ga0157376_120925682 | 105 |
| 114 | 3300021384 | Ga0213876_10031332 | Ga0213876_100313322 | 105 |
| 115 | 3300025321 | Ga0207656_10660792 | Ga0207656_106607922 | 105 |
| 116 | 3300025908 | Ga0207643_10398582 | Ga0207643_103985822 | 105 |
| 117 | 3300025908 | Ga0207643_10948609 | Ga0207643_109486091 | 105 |
| 118 | 3300025910 | Ga0207684_10115316 | Ga0207684_101153162 | 105 |
| 119 | 3300025912 | Ga0207707_10768616 | Ga0207707_107686162 | 105 |
| 120 | 3300025917 | Ga0207660_10055238 | Ga0207660_100552382 | 105 |
| 121 | 3300025917 | Ga0207660_10366554 | Ga0207660_103665542 | 105 |
| 122 | 3300025918 | Ga0207662_10182607 | Ga0207662_101826073 | 105 |
| 123 | 3300025918 | Ga0207662_10562094 | Ga0207662_105620942 | 105 |
| 124 | 3300025921 | Ga0207652_10035724 | Ga0207652_100357246 | 105 |
| 125 | 3300025927 | Ga0207687_10000120 | Ga0207687_1000012023 | 105 |
| 126 | 3300025927 | Ga0207687_10654061 | Ga0207687_106540612 | 105 |
| 127 | 3300025936 | Ga0207670_10030775 | Ga0207670_100307752 | 105 |
| 128 | 3300025936 | Ga0207670_10031316 | Ga0207670_100313164 | 105 |
| 129 | 3300025936 | Ga0207670_10046719 | Ga0207670_100467192 | 105 |
| 130 | 3300025937 | Ga0207669_10070338 | Ga0207669_100703382 | 105 |
| 131 | 3300025938 | Ga0207704_10571171 | Ga0207704_105711713 | 105 |
| 132 | 3300025941 | Ga0207711_10560919 | Ga0207711_105609192 | 105 |
| 133 | 3300025941 | Ga0207711_10707178 | Ga0207711_107071782 | 105 |
| 134 | 3300025942 | Ga0207689_10027406 | Ga0207689_100274064 | 105 |
| 135 | 3300025942 | Ga0207689_10088347 | Ga0207689_100883473 | 105 |
| 136 | 3300025942 | Ga0207689_10118102 | Ga0207689_101181023 | 105 |
| 137 | 3300025944 | Ga0207661_10434621 | Ga0207661_104346213 | 105 |
| 138 | 3300025944 | Ga0207661_10459079 | Ga0207661_104590792 | 105 |
| 139 | 3300025949 | Ga0207667_10898549 | Ga0207667_108985492 | 105 |
| 140 | 3300025961 | Ga0207712_10171170 | Ga0207712_101711702 | 105 |
| 141 | 3300025986 | Ga0207658_10047608 | Ga0207658_100476082 | 105 |
| 142 | 3300026023 | Ga0207677_10548640 | Ga0207677_105486402 | 105 |
| 143 | 3300026023 | Ga0207677_11913022 | Ga0207677_119130221 | 105 |
| 144 | 3300026075 | Ga0207708_10314338 | Ga0207708_103143382 | 105 |
| 145 | 3300026075 | Ga0207708_10939101 | Ga0207708_109391012 | 105 |
| 146 | 3300026078 | Ga0207702_10069770 | Ga0207702_100697703 | 105 |
| 147 | 3300026078 | Ga0207702_10849886 | Ga0207702_108498863 | 105 |
| 148 | 3300026088 | Ga0207641_10366729 | Ga0207641_103667293 | 105 |
| 149 | 3300026089 | Ga0207648_10892218 | Ga0207648_108922182 | 105 |
| 150 | 3300026095 | Ga0207676_10831684 | Ga0207676_108316841 | 105 |
| 151 | 3300026095 | Ga0207676_10957713 | Ga0207676_109577132 | 105 |
| 152 | 3300026095 | Ga0207676_12189743 | Ga0207676_121897432 | 105 |
| 153 | 3300026116 | Ga0207674_10826628 | Ga0207674_108266282 | 105 |
| 154 | 3300026116 | Ga0207674_11063590 | Ga0207674_110635902 | 105 |
| 155 | 3300026118 | Ga0207675_101245210 | Ga0207675_1012452102 | 105 |
| 156 | 3300026121 | Ga0207683_10002224 | Ga0207683_100022245 | 105 |
| 157 | 3300028379 | Ga0268266_10004111 | Ga0268266_1000411111 | 105 |
| 158 | 3300028380 | Ga0268265_10979466 | Ga0268265_109794662 | 105 |
| 159 | 3300028381 | Ga0268264_10902314 | Ga0268264_109023142 | 105 |
| 160 | 3300028786 | Ga0307517_10036718 | Ga0307517_100367184 | 105 |
| 161 | 3300028794 | Ga0307515_10025712 | Ga0307515_100257125 | 105 |
| 162 | 3300028800 | Ga0265338_10047162 | Ga0265338_100471622 | 105 |
| 163 | 3300031238 | Ga0265332_10005666 | Ga0265332_100056663 | 105 |
| 164 | 3300031250 | Ga0265331_10391203 | Ga0265331_103912032 | 105 |
| 165 | 3300031456 | Ga0307513_10429310 | Ga0307513_104293103 | 105 |
| 166 | 3300031507 | Ga0307509_10000111 | Ga0307509_1000011121 | 105 |
| 167 | 3300031507 | Ga0307509_10004236 | Ga0307509_1000423623 | 105 |
| 168 | 3300031507 | Ga0307509_10031864 | Ga0307509_100318643 | 105 |
| 169 | 3300031507 | Ga0307509_10075203 | Ga0307509_100752034 | 105 |
| 170 | 3300031507 | Ga0307509_10207687 | Ga0307509_102076872 | 105 |
| 171 | 3300031616 | Ga0307508_10090060 | Ga0307508_100900603 | 105 |
| 172 | 3300031730 | Ga0307516_10097810 | Ga0307516_100978101 | 105 |
| 173 | 3300031903 | Ga0307407_11645830 | Ga0307407_116458301 | 105 |
| 174 | 3300032126 | Ga0307415_100005501 | Ga0307415_1000055014 | 105 |
| 175 | 3300033179 | Ga0307507_10588189 | Ga0307507_105881892 | 105 |
| 176 | 3300035090 | Ga0373949_0000045 | Ga0373949_0000045_17472_17789 | 105 |
| 177 | 3300035113 | Ga0373936_0000005 | Ga0373936_0000005_74761_75078 | 105 |
| 178 | 3300035114 | Ga0373939_0081662 | Ga0373939_0081662_333_650 | 105 |
| 179 | 3300035115 | Ga0373941_0080476 | Ga0373941_0080476_424_741 | 105 |
| 180 | 3300035116 | Ga0373945_0394386 | Ga0373945_0394386_224_541 | 105 |
| 181 | 3300035119 | Ga0373956_0077692 | Ga0373956_0077692_423_740 | 105 |
| 182 | 3300035241 | Ga0373961_0000039 | Ga0373961_0000039_4159_4476 | 105 |
| 183 | 3300037312 | Ga0395899_0383158 | Ga0395899_0383158_123_440 | 105 |
| 184 | 3300037312 | Ga0395899_0655845 | Ga0395899_0655845_43_360 | 105 |
| 185 | 3300037418 | Ga0395900_0021997 | Ga0395900_0021997_757_1074 | 105 |
| 186 | 3300037418 | Ga0395900_1683022 | Ga0395900_1683022_179_496 | 105 |
| 187 | 3300037466 | Ga0395898_1932198 | Ga0395898_1932198_138_455 | 105 |
| 188 | 3300037471 | Ga0395905_0313897 | Ga0395905_0313897_593_910 | 105 |
| 189 | 3300037471 | Ga0395905_0448256 | Ga0395905_0448256_152_469 | 105 |
| 190 | 3300037471 | Ga0395905_1240395 | Ga0395905_1240395_17_373 | 105 |
| 191 | 3300038443 | Ga0395901_0015341 | Ga0395901_0015341_5524_5841 | 105 |
| 192 | 3300038443 | Ga0395901_0352710 | Ga0395901_0352710_519_836 | 105 |
| 193 | 3300039437 | Ga0436365_0109887 | Ga0436365_0109887_66_383 | 105 |
| 194 | 3300039437 | Ga0436365_0379180 | Ga0436365_0379180_863_1198 | 105 |
| 195 | 3300039437 | Ga0436365_0659839 | Ga0436365_0659839_367_687 | 105 |
| 196 | 3300039437 | Ga0436365_1368064 | Ga0436365_1368064_1724_2041 | 105 |
| 197 | 3300039450 | Ga0436363_1717800 | Ga0436363_1717800_100_417 | 105 |
| 198 | 3300041452 | Ga0451793_0508308 | Ga0451793_0508308_997_1326 | 105 |
| 199 | 3300041459 | Ga0451800_0882863 | Ga0451800_0882863_86_406 | 105 |
| 200 | 3300041486 | Ga0451807_2711463 | Ga0451807_2711463_49_366 | 105 |
| 201 | 3300041512 | Ga0451853_0481791 | Ga0451853_0481791_296_616 | 105 |
| 202 | 3300041512 | Ga0451853_1945486 | Ga0451853_1945486_368_685 | 105 |
| 203 | 3300041512 | Ga0451853_2114537 | Ga0451853_2114537_425_742 | 105 |
| 204 | 3300044673 | Ga0453683_1076460 | Ga0453683_1076460_180_497 | 105 |
| 205 | 3300044693 | Ga0466961_0116732 | Ga0466961_0116732_1014_1331 | 105 |
| 206 | 3300044694 | Ga0466963_0510995 | Ga0466963_0510995_92_409 | 105 |
| 207 | 3300044712 | Ga0453684_1321188 | Ga0453684_1321188_86_403 | 105 |
| 208 | 3300044719 | Ga0466971_0563161 | Ga0466971_0563161_169_486 | 105 |
| 209 | 3300046471 | Ga0495650_0147979 | Ga0495650_0147979_325_660 | 105 |
| 210 | 3300046519 | Ga0495632_0110039 | Ga0495632_0110039_84_401 | 105 |
| 211 | 3300046522 | Ga0495643_0287417 | Ga0495643_0287417_115_432 | 105 |
| 212 | 3300046660 | Ga0495625_0120704 | Ga0495625_0120704_407_724 | 105 |
| 213 | 3300046683 | Ga0495658_0574847 | Ga0495658_0574847_349_690 | 105 |
| 214 | 3300047320 | Ga0495672_0339708 | Ga0495672_0339708_264_581 | 105 |
| 215 | 3300047472 | Ga0495686_0090806 | Ga0495686_0090806_457_774 | 105 |
| 216 | 3300047472 | Ga0495686_0182911 | Ga0495686_0182911_56_373 | 105 |
| 217 | 3300048907 | Ga0496104_0306337 | Ga0496104_0306337_13_330 | 105 |
| 218 | 3300049515 | Ga0501292_136233 | Ga0501292_136233_65_382 | 105 |
| 219 | 3300049571 | Ga0501034_0141218 | Ga0501034_0141218_881_1198 | 105 |
| 220 | 3300049571 | Ga0501034_0243273 | Ga0501034_0243273_103_423 | 105 |
| 221 | 3300049571 | Ga0501034_1248508 | Ga0501034_1248508_237_554 | 105 |
| 222 | 3300049572 | Ga0501036_0240076 | Ga0501036_0240076_828_1145 | 105 |
| 223 | 3300049579 | Ga0501043_0131266 | Ga0501043_0131266_62_379 | 105 |
| 224 | 3300049580 | Ga0501046_0510697 | Ga0501046_0510697_123_440 | 105 |
| 225 | 3300049581 | Ga0501047_0107043 | Ga0501047_0107043_503_820 | 105 |
| 226 | 3300049583 | Ga0501067_0060310 | Ga0501067_0060310_989_1306 | 105 |
| 227 | 3300049583 | Ga0501067_0203441 | Ga0501067_0203441_268_585 | 105 |
| 228 | 3300049584 | Ga0501068_0123646 | Ga0501068_0123646_658_975 | 105 |
| 229 | 3300049584 | Ga0501068_0254481 | Ga0501068_0254481_138_455 | 105 |
| 230 | 3300049586 | Ga0501070_0024354 | Ga0501070_0024354_3216_3533 | 105 |
| 231 | 3300049586 | Ga0501070_0024498 | Ga0501070_0024498_3226_3546 | 105 |
| 232 | 3300049586 | Ga0501070_0084277 | Ga0501070_0084277_372_689 | 105 |
| 233 | 3300049586 | Ga0501070_0157887 | Ga0501070_0157887_17_334 | 105 |
| 234 | 3300049587 | Ga0501071_0873121 | Ga0501071_0873121_182_499 | 105 |
| 235 | 3300049587 | Ga0501071_0998476 | Ga0501071_0998476_237_554 | 105 |
| 236 | 3300049589 | Ga0501073_0641563 | Ga0501073_0641563_15_332 | 105 |
| 237 | 3300049590 | Ga0501074_0116431 | Ga0501074_0116431_589_906 | 105 |
| 238 | 3300049590 | Ga0501074_0145671 | Ga0501074_0145671_472_789 | 105 |
| 239 | 3300049590 | Ga0501074_1212295 | Ga0501074_1212295_101_418 | 105 |
| 240 | 3300049665 | Ga0501227_080919 | Ga0501227_080919_298_615 | 105 |
| 241 | 3300049668 | Ga0501233_238950 | Ga0501233_238950_15_332 | 105 |
| 242 | 3300049741 | Ga0501079_1152839 | Ga0501079_1152839_234_551 | 105 |
| 243 | 3300049742 | Ga0501080_0351130 | Ga0501080_0351130_62_379 | 105 |
| 244 | 3300049744 | Ga0501083_0117365 | Ga0501083_0117365_696_1013 | 105 |
| 245 | 3300049822 | Ga0501035_0849573 | Ga0501035_0849573_387_704 | 105 |
| 246 | 3300049823 | Ga0501044_0063269 | Ga0501044_0063269_1499_1816 | 105 |
| 247 | 3300049823 | Ga0501044_1180872 | Ga0501044_1180872_245_562 | 105 |
| 248 | 3300049823 | Ga0501044_1500027 | Ga0501044_1500027_211_528 | 105 |
| 249 | 3300050507 | nmdc:mga05p37_1319619_c1 | nmdc:mga05p37_1319619_c1_276_605 | 105 |
| 250 | 3300050507 | nmdc:mga05p37_595544_c1 | nmdc:mga05p37_595544_c1_331_648 | 105 |
| 251 | 3300050508 | nmdc:mga09592_357556_c1 | nmdc:mga09592_357556_c1_336_653 | 105 |
| 252 | 3300050508 | nmdc:mga09592_5486_c1 | nmdc:mga09592_5486_c1_101_418 | 105 |
| 253 | 3300050508 | nmdc:mga09592_5923_c1 | nmdc:mga09592_5923_c1_8306_8623 | 105 |
| 254 | 3300050509 | nmdc:mga0qj67_452149_c1 | nmdc:mga0qj67_452149_c1_397_714 | 105 |
| 255 | 3300050513 | nmdc:mga0rr50_1599067_c1 | nmdc:mga0rr50_1599067_c1_46_363 | 105 |
| 256 | 3300053080 | Ga0500635_0003573 | Ga0500635_0003573_3397_3714 | 105 |
| 257 | 3300053086 | Ga0500578_0670937 | Ga0500578_0670937_41_358 | 105 |
| 258 | 3300053086 | Ga0500578_0764748 | Ga0500578_0764748_150_467 | 105 |
| 259 | 3300053090 | Ga0500646_0042382 | Ga0500646_0042382_440_757 | 105 |
| 260 | 3300053091 | Ga0500647_0184865 | Ga0500647_0184865_220_537 | 105 |
| 261 | 3300053092 | Ga0500583_0176516 | Ga0500583_0176516_86_403 | 105 |
| 262 | 3300053092 | Ga0500583_0226380 | Ga0500583_0226380_34_351 | 105 |
| 263 | 3300053093 | Ga0500651_0382082 | Ga0500651_0382082_397_714 | 105 |
| 264 | 3300053094 | Ga0500566_0001160 | Ga0500566_0001160_8745_9062 | 105 |
| 265 | 3300053094 | Ga0500566_0004252 | Ga0500566_0004252_6721_7038 | 105 |
| 266 | 3300053094 | Ga0500566_0100712 | Ga0500566_0100712_397_714 | 105 |
| 267 | 3300053095 | Ga0500640_006527 | Ga0500640_006527_3280_3597 | 105 |
| 268 | 3300053102 | Ga0500554_000424 | Ga0500554_000424_5886_6203 | 105 |
| 269 | 3300053106 | Ga0500558_219246 | Ga0500558_219246_37_354 | 105 |
| 270 | 3300053108 | Ga0500562_049834 | Ga0500562_049834_679_996 | 105 |
| 271 | 3300053111 | Ga0500572_001055 | Ga0500572_001055_861_1178 | 105 |
| 272 | 3300053118 | Ga0500594_0122409 | Ga0500594_0122409_108_425 | 105 |
| 273 | 3300053119 | Ga0500595_000145 | Ga0500595_000145_25529_25846 | 105 |
| 274 | 3300053120 | Ga0500597_018566 | Ga0500597_018566_913_1230 | 105 |
| 275 | 3300053123 | Ga0500614_001272 | Ga0500614_001272_5435_5752 | 105 |
| 276 | 3300053124 | Ga0500617_298345 | Ga0500617_298345_134_451 | 105 |
| 277 | 3300053130 | Ga0500642_0010480 | Ga0500642_0010480_30_347 | 105 |
| 278 | 3300053130 | Ga0500642_0098009 | Ga0500642_0098009_286_603 | 105 |
| 279 | 3300053131 | Ga0500652_058630 | Ga0500652_058630_811_1128 | 105 |
| 280 | 3300053131 | Ga0500652_362479 | Ga0500652_362479_177_494 | 105 |
| 281 | 3300053134 | Ga0500658_0211987 | Ga0500658_0211987_19_336 | 105 |
| 282 | 3300053136 | Ga0500559_0004306 | Ga0500559_0004306_4764_5081 | 105 |
| 283 | 3300053136 | Ga0500559_0191869 | Ga0500559_0191869_74_391 | 105 |
| 284 | 3300053139 | Ga0500568_0023937 | Ga0500568_0023937_702_1019 | 105 |
| 285 | 3300053144 | Ga0500585_029399 | Ga0500585_029399_302_619 | 105 |
| 286 | 3300053148 | Ga0500590_331761 | Ga0500590_331761_128_445 | 105 |
| 287 | 3300053150 | Ga0500603_007739 | Ga0500603_007739_259_576 | 105 |
| 288 | 3300053155 | Ga0500620_188598 | Ga0500620_188598_199_516 | 105 |
| 289 | 3300053156 | Ga0500622_0186671 | Ga0500622_0186671_118_435 | 105 |
| 290 | 3300053159 | Ga0500630_043722 | Ga0500630_043722_202_519 | 105 |
| 291 | 3300053178 | Ga0500637_0111181 | Ga0500637_0111181_804_1121 | 105 |
| 292 | 3300053178 | Ga0500637_0234165 | Ga0500637_0234165_520_837 | 105 |
| 293 | 3300060353 | Ga0501082_0653202 | Ga0501082_0653202_155_472 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hs5-assembly2.cif.gz_B | frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family | 0.9361 | 1 | 103 |
| 1ew4-assembly1.cif.gz_A | crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family | 0.9111 | 1 | 105 |
| 1ew4-assembly1.cif.gz_A | crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family | 0.9029 | 1 | 105 |
| 3s5f-assembly1.cif.gz_A | crystal structure of human frataxin variant w155f | 0.8918 | 2 | 102 |
| 3t3l-assembly1.cif.gz_A | 1.15 a structure of human frataxin variant q153a | 0.8902 | 1 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54C45_74_193_3.30.920.10 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.9159 | 2 | 102 | 3.30.920.10 |
| af_Q07540_63_174_3.30.920.10 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.9103 | 1 | 97 | 3.30.920.10 |
| af_Q59PA3_59_177_3.30.920.10 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.9103 | 1 | 102 | 3.30.920.10 |
| 2p1xA00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.8989 | 1 | 103 | 3.30.920.10 |
| af_Q59PA3_59_177_3.30.920.10 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY | 0.8777 | 1 | 102 | 3.30.920.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5ERV4-F1-model_v4 | Iron donor protein CyaY | 0.9902 | 1 | 105 |
GO:0005737
GO:0008199 GO:0016226 |
| AF-A0A7W0ZXL4-F1-model_v4 | Iron donor protein CyaY | 0.9832 | 1 | 105 |
GO:0005737
GO:0008199 GO:0016226 |
| AF-A0A661NUE5-F1-model_v4 | Iron donor protein CyaY | 0.9767 | 1 | 102 |
GO:0005737
GO:0008199 GO:0016226 |
| AF-A0A7W0ZXL4-F1-model_v4 | Iron donor protein CyaY | 0.974 | 1 | 105 |
GO:0005737
GO:0008199 GO:0016226 |
| AF-A0A0K1PG81-F1-model_v4 | Frataxin CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly | 0.9691 | 1 | 102 |
GO:0005829
GO:0008198 GO:0008199 GO:0016226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar