F391410

General Info

Members Datasets Scaffolds Average Seq Length
293 213 291 109

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100072974|Ga0068859_1000729744
Length 107
Sequence MPIELPKPIADYVEANARLDVDGILNPFATDAVVLDNGGRHEGHAELRTLFEEAVIPVRAIFTPDAVCHENSQVEGPAHGDFKSSPIRFTYRFTLKNDAIKALEITA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
107 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
108 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
109 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
110 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
115 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
118 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
124 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
129 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
130 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
131 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
132 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
137 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
138 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
139 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
140 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
141 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
142 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
143 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
144 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
145 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
150 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 2.05
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.11
Nodule 0
Rhizoplane 6.14
Rhizosphere 61.43
Stem 0
Stem Tuber 0
Unclassified 13.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3519818 2162886007 Bacteria 1824
2 rootH2_10046462 3300003320 Bacteria 1351
3 Ga0055526_1025513 3300003771 Bacteria 1895
4 Ga0055536_1002297 3300003781 Bacteria 10842
5 Ga0055530_10002765 3300003791 Bacteria 10853
6 Ga0055530_10008621 3300003791 Bacteria 4046
7 Ga0055531_10000442 3300003794 Bacteria 38998
8 Ga0055531_10033154 3300003794 Bacteria 1669
9 Ga0055543_1037370 3300004625 Bacteria 829
10 Ga0065165_1000490 3300005262 Bacteria 61094
11 Ga0065165_1001889 3300005262 Bacteria 20208
12 Ga0065165_1091593 3300005262 Bacteria 773
13 Ga0070676_10204585 3300005328 Bacteria 1296
14 Ga0070668_100195037 3300005347 Bacteria 1660
15 Ga0070669_100129005 3300005353 Bacteria 1938
16 Ga0070674_100017677 3300005356 Bacteria 4493
17 Ga0070659_100584579 3300005366 Bacteria 958
18 Ga0070701_11214201 3300005438 Bacteria 536
19 Ga0070700_100246171 3300005441 Bacteria 1280
20 Ga0070694_100599342 3300005444 Bacteria 887
21 Ga0070672_100519074 3300005543 Bacteria 1032
22 Ga0070665_100001612 3300005548 Bacteria 25956
23 Ga0070665_100632837 3300005548 Bacteria 1083
24 Ga0068857_100685760 3300005577 Bacteria 973
25 Ga0068859_100072974 3300005617 Bacteria 3469
26 Ga0068861_100262329 3300005719 Bacteria 1480
27 Ga0068863_100000680 3300005841 Bacteria 34407
28 Ga0068858_100014379 3300005842 Bacteria 7462
29 Ga0068860_100021794 3300005843 Bacteria 6198
30 Ga0068862_100000118 3300005844 Bacteria 92548
31 Ga0068862_100049495 3300005844 Bacteria 3589
32 Ga0068862_100168054 3300005844 Bacteria 1962
33 Ga0068862_100331356 3300005844 Bacteria 1408
34 Ga0075365_10136571 3300006038 Bacteria 1700
35 Ga0075365_10294121 3300006038 Bacteria 1143
36 Ga0075363_100421207 3300006048 Bacteria 786
37 Ga0075363_100662438 3300006048 Bacteria 629
38 Ga0075364_10572832 3300006051 Bacteria 772
39 Ga0075362_10074138 3300006177 Bacteria 1559
40 Ga0075367_10005981 3300006178 Bacteria 6111
41 Ga0075367_10182987 3300006178 Bacteria 1307
42 Ga0075366_10041041 3300006195 Bacteria 2738
43 Ga0075366_10516773 3300006195 Bacteria 739
44 Ga0075366_10533104 3300006195 Bacteria 727
45 Ga0075370_10519588 3300006353 Bacteria 719
46 Ga0075428_100228437 3300006844 Bacteria 2008
47 Ga0075430_100836178 3300006846 Bacteria 759
48 Ga0075431_100076032 3300006847 Bacteria 3465
49 Ga0075433_10812073 3300006852 Bacteria 817
50 Ga0097620_100072975 3300006931 Bacteria 3469
51 Ga0105240_11701572 3300009093 Bacteria 658
52 Ga0111539_10897004 3300009094 Bacteria 1031
53 Ga0105245_10335553 3300009098 Bacteria 1494
54 Ga0105247_10004324 3300009101 Bacteria 9076
55 Ga0105247_10085293 3300009101 Bacteria 1997
56 Ga0105248_11004519 3300009177 Bacteria 942
57 Ga0105248_11866881 3300009177 Bacteria 682
58 Ga0105237_12380284 3300009545 Bacteria 540
59 Ga0105238_11139078 3300009551 Bacteria 803
60 Ga0105249_10000119 3300009553 Bacteria 107840
61 Ga0157371_10998538 3300013102 Bacteria 638
62 Ga0157370_10637225 3300013104 Bacteria 975
63 Ga0163162_10702305 3300013306 Bacteria 1133
64 Ga0163162_12026944 3300013306 Bacteria 660
65 Ga0157372_11246253 3300013307 Bacteria 859
66 Ga0157380_10105280 3300014326 Bacteria 2358
67 Ga0157380_10629567 3300014326 Bacteria 1066
68 Ga0157379_10032176 3300014968 Bacteria 4675
69 Ga0213875_10143178 3300021388 Bacteria 1119
70 Ga0209676_1000119 3300025292 Bacteria 201094
71 Ga0209676_1000136 3300025292 Bacteria 181860
72 Ga0209564_1000283 3300025295 Bacteria 102740
73 Ga0209758_1061713 3300025297 Bacteria 1232
74 Ga0209050_1000238 3300025298 Bacteria 119729
75 Ga0209050_1000745 3300025298 Bacteria 46839
76 Ga0209050_1095477 3300025298 Bacteria 599
77 Ga0207426_1015924 3300025302 Bacteria 2715
78 Ga0209051_1002945 3300025303 Bacteria 11621
79 Ga0209257_1000142 3300025304 Bacteria 200756
80 Ga0209257_1002646 3300025304 Bacteria 17231
81 Ga0209257_1002960 3300025304 Bacteria 15555
82 Ga0207710_10004543 3300025900 Bacteria 6030
83 Ga0207710_10219636 3300025900 Bacteria 943
84 Ga0207647_10027457 3300025904 Bacteria 3710
85 Ga0207647_10618459 3300025904 Unclassified 596
86 Ga0207645_10075879 3300025907 Bacteria 2152
87 Ga0207694_10746804 3300025924 Bacteria 826
88 Ga0207690_10919684 3300025932 Bacteria 726
89 Ga0207706_10209015 3300025933 Bacteria 1711
90 Ga0207669_10036657 3300025937 Bacteria 2805
91 Ga0207704_10320527 3300025938 Bacteria 1195
92 Ga0207691_10344898 3300025940 Bacteria 1274
93 Ga0207712_10000048 3300025961 Bacteria 160050
94 Ga0207668_10005742 3300025972 Bacteria 7313
95 Ga0207668_10104432 3300025972 Bacteria 2112
96 Ga0207668_11097638 3300025972 Bacteria 713
97 Ga0207668_11944403 3300025972 Bacteria 530
98 Ga0207658_10703455 3300025986 Bacteria 913
99 Ga0207658_11289922 3300025986 Bacteria 668
100 Ga0207703_10001565 3300026035 Bacteria 20747
101 Ga0207708_10181260 3300026075 Bacteria 1672
102 Ga0207641_10005526 3300026088 Bacteria 10784
103 Ga0207648_10327492 3300026089 Bacteria 1377
104 Ga0207676_10487250 3300026095 Bacteria 1169
105 Ga0207674_10099298 3300026116 Bacteria 2893
106 Ga0207674_11312776 3300026116 Bacteria 693
107 Ga0207675_100060544 3300026118 Bacteria 3535
108 Ga0207683_10805063 3300026121 Bacteria 872
109 Ga0209969_1010973 3300027360 Bacteria 1299
110 Ga0209996_1008100 3300027395 Bacteria 1374
111 Ga0209984_1031191 3300027424 Bacteria 753
112 Ga0210000_1079372 3300027462 Bacteria 538
113 Ga0209999_1013615 3300027543 Bacteria 1475
114 Ga0209983_1006494 3300027665 Bacteria 2401
115 Ga0209971_1006574 3300027682 Bacteria 2750
116 Ga0209966_1028112 3300027695 Bacteria 1128
117 Ga0209998_10012822 3300027717 Bacteria 1742
118 Ga0209974_10022926 3300027876 Bacteria 2066
119 Ga0268266_10000487 3300028379 Bacteria 56915
120 Ga0268266_10049732 3300028379 Bacteria 3596
121 Ga0268266_10189173 3300028379 Bacteria 1879
122 Ga0268266_10304462 3300028379 Bacteria 1488
123 Ga0268265_10000139 3300028380 Bacteria 92561
124 Ga0268265_10043974 3300028380 Bacteria 3323
125 Ga0268265_10307120 3300028380 Bacteria 1431
126 Ga0268264_10008920 3300028381 Bacteria 8320
127 Ga0307515_10154544 3300028794 Bacteria 2377
128 Ga0307408_101221358 3300031548 Bacteria 702
129 Ga0307408_101434902 3300031548 Bacteria 651
130 Ga0307408_101872091 3300031548 Bacteria 575
131 Ga0307413_10231577 3300031824 Bacteria 1357
132 Ga0307410_10607411 3300031852 Bacteria 913
133 Ga0307406_10367362 3300031901 Bacteria 1130
134 Ga0307406_10477364 3300031901 Bacteria 1006
135 Ga0307412_10223839 3300031911 Bacteria 1444
136 Ga0307409_100007334 3300031995 Bacteria 6588
137 Ga0307416_101962746 3300032002 Bacteria 688
138 Ga0307414_10000217 3300032004 Bacteria 37929
139 Ga0307414_10004970 3300032004 Bacteria 7269
140 Ga0307411_10407303 3300032005 Bacteria 1126
141 Ga0307411_11836890 3300032005 Bacteria 563
142 Ga0307415_100038569 3300032126 Bacteria 3150
143 Ga0307415_100703512 3300032126 Bacteria 912
144 Ga0436364_0229003 3300037853 Bacteria 4549
145 Ga0439436_0007645 3300041404 Bacteria 3326
146 Ga0439439_0098721 3300041406 Bacteria 803
147 Ga0439453_0006699 3300041408 Bacteria 1804
148 Ga0439453_0032636 3300041408 Bacteria 992
149 Ga0439461_0013874 3300041410 Bacteria 1525
150 Ga0451789_0046278 3300041443 Bacteria 663
151 Ga0451789_0265164 3300041443 Bacteria 808
152 Ga0451789_1312465 3300041443 Bacteria 1693
153 Ga0451791_1491005 3300041451 Bacteria 1051
154 Ga0451797_0128270 3300041453 Bacteria 936
155 Ga0451807_0792711 3300041486 Bacteria 598
156 Ga0451807_1013671 3300041486 Bacteria 3054
157 Ga0451833_0896211 3300041491 Bacteria 641
158 Ga0451835_0646359 3300041492 Bacteria 561
159 Ga0451837_1832384 3300041494 Bacteria 604
160 Ga0451847_0487251 3300041503 Bacteria 702
161 Ga0451851_0421471 3300041507 Bacteria 766
162 Ga0451843_1612693 3300041509 Bacteria 814
163 Ga0439431_0002734 3300041997 Bacteria 3875
164 Ga0439437_005397 3300042000 Bacteria 1406
165 Ga0439441_001228 3300042001 Bacteria 3274
166 Ga0439442_037773 3300042002 Bacteria 1012
167 Ga0439443_000160 3300042003 Bacteria 4760
168 Ga0439443_023065 3300042003 Bacteria 991
169 Ga0439445_0076347 3300042004 Bacteria 933
170 Ga0439448_0270622 3300042005 Bacteria 601
171 Ga0439450_001270 3300042008 Bacteria 3653
172 Ga0439451_019600 3300042009 Bacteria 1363
173 Ga0439451_068769 3300042009 Bacteria 709
174 Ga0439452_117701 3300042010 Bacteria 566
175 Ga0439454_000279 3300042011 Bacteria 3742
176 Ga0439455_0010593 3300042012 Bacteria 2032
177 Ga0439456_009892 3300042013 Bacteria 1968
178 Ga0439457_135412 3300042014 Bacteria 587
179 Ga0439462_0009606 3300042015 Bacteria 2446
180 Ga0439463_022393 3300042016 Bacteria 1581
181 Ga0439463_044325 3300042016 Bacteria 1133
182 Ga0450913_001594 3300042117 Bacteria 1275
183 Ga0450915_000367 3300042119 Bacteria 1560
184 Ga0450920_022707 3300042122 Bacteria 1216
185 Ga0450921_007906 3300042123 Bacteria 854
186 Ga0450888_007662 3300042126 Bacteria 1200
187 Ga0450888_036533 3300042126 Bacteria 672
188 Ga0450890_014179 3300042127 Bacteria 1044
189 Ga0450894_010929 3300042131 Bacteria 1181
190 Ga0450896_082260 3300042133 Bacteria 543
191 Ga0450889_004248 3300042144 Bacteria 1416
192 Ga0450910_058060 3300042147 Bacteria 649
193 Ga0439458_0084329 3300042157 Bacteria 813
194 Ga0439434_0039627 3300042435 Bacteria 1445
195 Ga0439435_0004717 3300042436 Bacteria 2954
196 Ga0439435_0005293 3300042436 Bacteria 2832
197 Ga0439435_0065758 3300042436 Bacteria 1064
198 Ga0439444_0000329 3300042437 Bacteria 4972
199 Ga0439459_0019665 3300042438 Bacteria 1282
200 Ga0439464_0001612 3300042439 Bacteria 5368
201 Ga0439464_0023177 3300042439 Bacteria 1713
202 Ga0439460_0039722 3300042461 Bacteria 1376
203 Ga0450916_076105 3300042530 Bacteria 567
204 Ga0450918_093834 3300042531 Bacteria 582
205 Ga0450893_0001440 3300042532 Bacteria 3643
206 Ga0439440_0168593 3300042993 Bacteria 635
207 Ga0495638_0000845 3300046460 Bacteria 32033
208 Ga0495631_0100456 3300046518 Bacteria 1245
209 Ga0495648_0014995 3300046524 Bacteria 5645
210 Ga0495654_0352058 3300046530 Bacteria 592
211 Ga0495611_0378864 3300046648 Bacteria 648
212 Ga0495625_0311517 3300046660 Bacteria 1004
213 Ga0495670_0012838 3300046691 Bacteria 4119
214 Ga0495677_0383397 3300047445 Bacteria 556
215 Ga0495681_0024703 3300047470 Bacteria 3157
216 Ga0495681_0051983 3300047470 Bacteria 1925
217 Ga0495615_0000039 3300048090 Bacteria 43274
218 Ga0496100_0646610 3300048903 Bacteria 823
219 Ga0496101_0516817 3300048904 Bacteria 943
220 Ga0496102_0000452 3300048905 Bacteria 46768
221 Ga0496103_0000518 3300048906 Bacteria 31718
222 Ga0496104_0038840 3300048907 Bacteria 4456
223 Ga0496105_0000823 3300048908 Bacteria 21077
224 Ga0496107_0056770 3300048910 Bacteria 2829
225 Ga0496111_0012329 3300048914 Bacteria 5782
226 Ga0496114_0006274 3300048917 Bacteria 9359
227 Ga0496114_0598443 3300048917 Bacteria 972
228 Ga0496115_0000230 3300048918 Bacteria 50872
229 Ga0496116_0003936 3300048919 Bacteria 14452
230 Ga0496117_0000885 3300048920 Bacteria 46146
231 Ga0496117_0049243 3300048920 Bacteria 3000
232 Ga0496118_0000144 3300048921 Bacteria 124411
233 Ga0496118_0013656 3300048921 Bacteria 7665
234 Ga0496118_0015642 3300048921 Bacteria 7010
235 Ga0496119_0014764 3300048922 Bacteria 6079
236 Ga0496121_0000295 3300048924 Bacteria 103239
237 Ga0496121_0073531 3300048924 Bacteria 2739
238 Ga0496121_0100832 3300048924 Bacteria 2228
239 Ga0496122_0001136 3300048925 Bacteria 45692
240 Ga0496122_0006264 3300048925 Bacteria 13748
241 Ga0496122_0014827 3300048925 Bacteria 7507
242 Ga0496122_0036476 3300048925 Bacteria 3974
243 Ga0496123_0001120 3300048926 Bacteria 39985
244 Ga0496123_0001168 3300048926 Bacteria 38791
245 Ga0496123_0013015 3300048926 Bacteria 7025
246 Ga0496123_0039575 3300048926 Bacteria 3296
247 Ga0496124_0000683 3300048927 Bacteria 55788
248 Ga0496124_0017980 3300048927 Bacteria 6642
249 Ga0496124_0137675 3300048927 Bacteria 1931
250 Ga0496125_0001206 3300048928 Bacteria 38876
251 Ga0496125_0126230 3300048928 Bacteria 1812
252 Ga0496126_0001756 3300048929 Bacteria 32069
253 Ga0496126_0001880 3300048929 Bacteria 30537
254 Ga0496126_0052573 3300048929 Bacteria 3701
255 Ga0496126_0149657 3300048929 Bacteria 2001
256 Ga0496126_0770763 3300048929 Bacteria 741
257 Ga0501306_026572 3300049127 Bacteria 839
258 Ga0501310_018905 3300049130 Bacteria 844
259 Ga0501312_073374 3300049528 Bacteria 610
260 Ga0501317_017249 3300049533 Bacteria 945
261 Ga0501317_110449 3300049533 Bacteria 505
262 Ga0501318_059113 3300049534 Bacteria 585
263 Ga0501034_0028614 3300049571 Bacteria 5671
264 Ga0501035_1224223 3300049822 Bacteria 582
265 nmdc:mga03683_169277_c1 3300050489 Bacteria 992
266 nmdc:mga03683_674718_c1 3300050489 Bacteria 510
267 nmdc:mga03683_88789_c1 3300050489 Bacteria 1345
268 nmdc:mga03n38_364430_c1 3300050490 Bacteria 789
269 nmdc:mga03n38_511429_c1 3300050490 Bacteria 675
270 nmdc:mga00v17_324368_c1 3300050491 Bacteria 1000
271 nmdc:mga00v17_73568_c1 3300050491 Bacteria 2122
272 nmdc:mga0yw44_387988_c1 3300050492 Bacteria 943
273 nmdc:mga0yw44_95483_c1 3300050492 Bacteria 1886
274 nmdc:mga0k408_38279_c1 3300050493 Bacteria 2752
275 nmdc:mga0k408_934858_c1 3300050493 Bacteria 502
276 nmdc:mga06z11_55146_c1 3300050494 Bacteria 2051
277 nmdc:mga06z11_853454_c1 3300050494 Bacteria 555
278 nmdc:mga07m45_262594_c1 3300050496 Bacteria 1004
279 nmdc:mga05p37_42994_c1 3300050507 Bacteria 5555
280 nmdc:mga09592_404798_c1 3300050508 Bacteria 1179
281 nmdc:mga0qj67_302900_c1 3300050509 Bacteria 1295
282 nmdc:mga06r32_37885_c1 3300050510 Bacteria 4563
283 nmdc:mga08y16_877599_c1 3300050511 Bacteria 885
284 nmdc:mga0sz30_68759_c1 3300050516 Bacteria 1522
285 Ga0500643_000067 3300053087 Bacteria 117867
286 Ga0500643_009969 3300053087 Bacteria 3580
287 Ga0500646_0011837 3300053090 Bacteria 2247
288 Ga0500614_022569 3300053123 Bacteria 1470
289 Ga0500642_0000953 3300053130 Bacteria 8365
290 Ga0500568_0087452 3300053139 Bacteria 1178
291 Ga0500616_0017532 3300053153 Bacteria 4061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100072974 Ga0068859_1000729744 107
2 3300006931 Ga0097620_100072975 Ga0097620_1000729754 107
3 3300009101 Ga0105247_10004324 Ga0105247_100043248 107
4 3300025900 Ga0207710_10004543 Ga0207710_100045434 107
5 3300009551 Ga0105238_11139078 Ga0105238_111390782 108
6 3300025924 Ga0207694_10746804 Ga0207694_107468041 108
7 3300031548 Ga0307408_101434902 Ga0307408_1014349022 108
8 3300031548 Ga0307408_101872091 Ga0307408_1018720911 108
9 3300041404 Ga0439436_0007645 Ga0439436_0007645_1556_1882 108
10 3300042010 Ga0439452_117701 Ga0439452_117701_226_552 108
11 3300042122 Ga0450920_022707 Ga0450920_022707_396_722 108
12 3300042147 Ga0450910_058060 Ga0450910_058060_253_579 108
13 3300048921 Ga0496118_0013656 Ga0496118_0013656_5996_6322 108
14 2162886007 SwRhRL2b_contig_3519818 SwRhRL2b_0024.00005020 109
15 3300003320 rootH2_10046462 rootH2_100464622 109
16 3300003771 Ga0055526_1025513 Ga0055526_10255133 109
17 3300003781 Ga0055536_1002297 Ga0055536_10022973 109
18 3300003791 Ga0055530_10002765 Ga0055530_100027653 109
19 3300003791 Ga0055530_10008621 Ga0055530_100086213 109
20 3300003794 Ga0055531_10000442 Ga0055531_1000044219 109
21 3300003794 Ga0055531_10033154 Ga0055531_100331542 109
22 3300004625 Ga0055543_1037370 Ga0055543_10373702 109
23 3300005262 Ga0065165_1000490 Ga0065165_100049031 109
24 3300005262 Ga0065165_1001889 Ga0065165_10018899 109
25 3300005262 Ga0065165_1091593 Ga0065165_10915932 109
26 3300005328 Ga0070676_10204585 Ga0070676_102045851 109
27 3300005347 Ga0070668_100195037 Ga0070668_1001950372 109
28 3300005353 Ga0070669_100129005 Ga0070669_1001290052 109
29 3300005356 Ga0070674_100017677 Ga0070674_1000176774 109
30 3300005366 Ga0070659_100584579 Ga0070659_1005845791 109
31 3300005438 Ga0070701_11214201 Ga0070701_112142012 109
32 3300005441 Ga0070700_100246171 Ga0070700_1002461712 109
33 3300005444 Ga0070694_100599342 Ga0070694_1005993421 109
34 3300005543 Ga0070672_100519074 Ga0070672_1005190742 109
35 3300005548 Ga0070665_100001612 Ga0070665_10000161230 109
36 3300005548 Ga0070665_100632837 Ga0070665_1006328372 109
37 3300005577 Ga0068857_100685760 Ga0068857_1006857601 109
38 3300005719 Ga0068861_100262329 Ga0068861_1002623291 109
39 3300005841 Ga0068863_100000680 Ga0068863_10000068031 109
40 3300005842 Ga0068858_100014379 Ga0068858_1000143793 109
41 3300005843 Ga0068860_100021794 Ga0068860_1000217946 109
42 3300005844 Ga0068862_100000118 Ga0068862_10000011828 109
43 3300005844 Ga0068862_100049495 Ga0068862_1000494952 109
44 3300005844 Ga0068862_100168054 Ga0068862_1001680542 109
45 3300005844 Ga0068862_100331356 Ga0068862_1003313562 109
46 3300006038 Ga0075365_10136571 Ga0075365_101365713 109
47 3300006038 Ga0075365_10294121 Ga0075365_102941212 109
48 3300006048 Ga0075363_100421207 Ga0075363_1004212072 109
49 3300006048 Ga0075363_100662438 Ga0075363_1006624381 109
50 3300006051 Ga0075364_10572832 Ga0075364_105728322 109
51 3300006177 Ga0075362_10074138 Ga0075362_100741381 109
52 3300006178 Ga0075367_10005981 Ga0075367_100059814 109
53 3300006178 Ga0075367_10182987 Ga0075367_101829872 109
54 3300006195 Ga0075366_10041041 Ga0075366_100410413 109
55 3300006195 Ga0075366_10516773 Ga0075366_105167731 109
56 3300006195 Ga0075366_10533104 Ga0075366_105331041 109
57 3300006353 Ga0075370_10519588 Ga0075370_105195881 109
58 3300006844 Ga0075428_100228437 Ga0075428_1002284373 109
59 3300006846 Ga0075430_100836178 Ga0075430_1008361782 109
60 3300006847 Ga0075431_100076032 Ga0075431_1000760323 109
61 3300006852 Ga0075433_10812073 Ga0075433_108120732 109
62 3300009093 Ga0105240_11701572 Ga0105240_117015722 109
63 3300009094 Ga0111539_10897004 Ga0111539_108970042 109
64 3300009098 Ga0105245_10335553 Ga0105245_103355531 109
65 3300009101 Ga0105247_10085293 Ga0105247_100852932 109
66 3300009177 Ga0105248_11004519 Ga0105248_110045192 109
67 3300009177 Ga0105248_11866881 Ga0105248_118668812 109
68 3300009545 Ga0105237_12380284 Ga0105237_123802842 109
69 3300009553 Ga0105249_10000119 Ga0105249_1000011926 109
70 3300013102 Ga0157371_10998538 Ga0157371_109985382 109
71 3300013104 Ga0157370_10637225 Ga0157370_106372251 109
72 3300013306 Ga0163162_10702305 Ga0163162_107023051 109
73 3300013306 Ga0163162_12026944 Ga0163162_120269442 109
74 3300013307 Ga0157372_11246253 Ga0157372_112462531 109
75 3300014326 Ga0157380_10105280 Ga0157380_101052803 109
76 3300014326 Ga0157380_10629567 Ga0157380_106295671 109
77 3300014968 Ga0157379_10032176 Ga0157379_100321764 109
78 3300021388 Ga0213875_10143178 Ga0213875_101431782 109
79 3300025292 Ga0209676_1000119 Ga0209676_100011988 109
80 3300025292 Ga0209676_1000136 Ga0209676_100013678 109
81 3300025295 Ga0209564_1000283 Ga0209564_100028322 109
82 3300025297 Ga0209758_1061713 Ga0209758_10617132 109
83 3300025298 Ga0209050_1000238 Ga0209050_100023871 109
84 3300025298 Ga0209050_1000745 Ga0209050_10007453 109
85 3300025298 Ga0209050_1095477 Ga0209050_10954772 109
86 3300025302 Ga0207426_1015924 Ga0207426_10159243 109
87 3300025303 Ga0209051_1002945 Ga0209051_10029457 109
88 3300025304 Ga0209257_1000142 Ga0209257_100014278 109
89 3300025304 Ga0209257_1002646 Ga0209257_100264610 109
90 3300025304 Ga0209257_1002960 Ga0209257_100296016 109
91 3300025900 Ga0207710_10219636 Ga0207710_102196361 109
92 3300025904 Ga0207647_10027457 Ga0207647_100274575 109
93 3300025904 Ga0207647_10618459 Ga0207647_106184592 109
94 3300025907 Ga0207645_10075879 Ga0207645_100758792 109
95 3300025932 Ga0207690_10919684 Ga0207690_109196842 109
96 3300025933 Ga0207706_10209015 Ga0207706_102090152 109
97 3300025937 Ga0207669_10036657 Ga0207669_100366574 109
98 3300025938 Ga0207704_10320527 Ga0207704_103205272 109
99 3300025940 Ga0207691_10344898 Ga0207691_103448982 109
100 3300025961 Ga0207712_10000048 Ga0207712_1000004825 109
101 3300025972 Ga0207668_10005742 Ga0207668_100057421 109
102 3300025972 Ga0207668_10104432 Ga0207668_101044322 109
103 3300025972 Ga0207668_11097638 Ga0207668_110976382 109
104 3300025972 Ga0207668_11944403 Ga0207668_119444032 109
105 3300025986 Ga0207658_10703455 Ga0207658_107034552 109
106 3300025986 Ga0207658_11289922 Ga0207658_112899221 109
107 3300026035 Ga0207703_10001565 Ga0207703_1000156515 109
108 3300026075 Ga0207708_10181260 Ga0207708_101812602 109
109 3300026088 Ga0207641_10005526 Ga0207641_100055268 109
110 3300026089 Ga0207648_10327492 Ga0207648_103274922 109
111 3300026095 Ga0207676_10487250 Ga0207676_104872502 109
112 3300026116 Ga0207674_10099298 Ga0207674_100992982 109
113 3300026116 Ga0207674_11312776 Ga0207674_113127762 109
114 3300026118 Ga0207675_100060544 Ga0207675_1000605443 109
115 3300026121 Ga0207683_10805063 Ga0207683_108050632 109
116 3300027360 Ga0209969_1010973 Ga0209969_10109733 109
117 3300027395 Ga0209996_1008100 Ga0209996_10081002 109
118 3300027424 Ga0209984_1031191 Ga0209984_10311912 109
119 3300027462 Ga0210000_1079372 Ga0210000_10793722 109
120 3300027543 Ga0209999_1013615 Ga0209999_10136151 109
121 3300027665 Ga0209983_1006494 Ga0209983_10064942 109
122 3300027682 Ga0209971_1006574 Ga0209971_10065742 109
123 3300027695 Ga0209966_1028112 Ga0209966_10281121 109
124 3300027717 Ga0209998_10012822 Ga0209998_100128222 109
125 3300027876 Ga0209974_10022926 Ga0209974_100229262 109
126 3300028379 Ga0268266_10000487 Ga0268266_1000048727 109
127 3300028379 Ga0268266_10049732 Ga0268266_100497322 109
128 3300028379 Ga0268266_10189173 Ga0268266_101891732 109
129 3300028379 Ga0268266_10304462 Ga0268266_103044622 109
130 3300028380 Ga0268265_10000139 Ga0268265_1000013955 109
131 3300028380 Ga0268265_10043974 Ga0268265_100439742 109
132 3300028380 Ga0268265_10307120 Ga0268265_103071202 109
133 3300028381 Ga0268264_10008920 Ga0268264_100089202 109
134 3300028794 Ga0307515_10154544 Ga0307515_101545443 109
135 3300031548 Ga0307408_101221358 Ga0307408_1012213582 109
136 3300031824 Ga0307413_10231577 Ga0307413_102315771 109
137 3300031852 Ga0307410_10607411 Ga0307410_106074112 109
138 3300031901 Ga0307406_10367362 Ga0307406_103673622 109
139 3300031901 Ga0307406_10477364 Ga0307406_104773642 109
140 3300031911 Ga0307412_10223839 Ga0307412_102238392 109
141 3300031995 Ga0307409_100007334 Ga0307409_1000073342 109
142 3300032002 Ga0307416_101962746 Ga0307416_1019627462 109
143 3300032004 Ga0307414_10000217 Ga0307414_100002176 109
144 3300032004 Ga0307414_10004970 Ga0307414_100049705 109
145 3300032005 Ga0307411_10407303 Ga0307411_104073032 109
146 3300032005 Ga0307411_11836890 Ga0307411_118368902 109
147 3300032126 Ga0307415_100038569 Ga0307415_1000385694 109
148 3300032126 Ga0307415_100703512 Ga0307415_1007035121 109
149 3300037853 Ga0436364_0229003 Ga0436364_0229003_499_828 109
150 3300041406 Ga0439439_0098721 Ga0439439_0098721_308_637 109
151 3300041408 Ga0439453_0006699 Ga0439453_0006699_150_479 109
152 3300041408 Ga0439453_0032636 Ga0439453_0032636_498_827 109
153 3300041410 Ga0439461_0013874 Ga0439461_0013874_101_430 109
154 3300041443 Ga0451789_0046278 Ga0451789_0046278_52_381 109
155 3300041443 Ga0451789_0265164 Ga0451789_0265164_111_440 109
156 3300041443 Ga0451789_1312465 Ga0451789_1312465_1224_1553 109
157 3300041451 Ga0451791_1491005 Ga0451791_1491005_515_844 109
158 3300041453 Ga0451797_0128270 Ga0451797_0128270_245_574 109
159 3300041486 Ga0451807_0792711 Ga0451807_0792711_33_392 109
160 3300041486 Ga0451807_1013671 Ga0451807_1013671_1590_1919 109
161 3300041491 Ga0451833_0896211 Ga0451833_0896211_228_557 109
162 3300041492 Ga0451835_0646359 Ga0451835_0646359_115_444 109
163 3300041494 Ga0451837_1832384 Ga0451837_1832384_89_448 109
164 3300041503 Ga0451847_0487251 Ga0451847_0487251_166_495 109
165 3300041507 Ga0451851_0421471 Ga0451851_0421471_338_667 109
166 3300041509 Ga0451843_1612693 Ga0451843_1612693_52_381 109
167 3300041997 Ga0439431_0002734 Ga0439431_0002734_3229_3558 109
168 3300042000 Ga0439437_005397 Ga0439437_005397_418_747 109
169 3300042001 Ga0439441_001228 Ga0439441_001228_1230_1559 109
170 3300042002 Ga0439442_037773 Ga0439442_037773_170_499 109
171 3300042003 Ga0439443_000160 Ga0439443_000160_1750_2079 109
172 3300042003 Ga0439443_023065 Ga0439443_023065_178_507 109
173 3300042004 Ga0439445_0076347 Ga0439445_0076347_281_610 109
174 3300042005 Ga0439448_0270622 Ga0439448_0270622_188_517 109
175 3300042008 Ga0439450_001270 Ga0439450_001270_1709_2038 109
176 3300042009 Ga0439451_019600 Ga0439451_019600_12_341 109
177 3300042009 Ga0439451_068769 Ga0439451_068769_168_497 109
178 3300042011 Ga0439454_000279 Ga0439454_000279_382_711 109
179 3300042012 Ga0439455_0010593 Ga0439455_0010593_461_790 109
180 3300042013 Ga0439456_009892 Ga0439456_009892_1255_1584 109
181 3300042014 Ga0439457_135412 Ga0439457_135412_47_376 109
182 3300042015 Ga0439462_0009606 Ga0439462_0009606_1675_2004 109
183 3300042016 Ga0439463_022393 Ga0439463_022393_382_711 109
184 3300042016 Ga0439463_044325 Ga0439463_044325_96_425 109
185 3300042117 Ga0450913_001594 Ga0450913_001594_370_699 109
186 3300042119 Ga0450915_000367 Ga0450915_000367_388_717 109
187 3300042123 Ga0450921_007906 Ga0450921_007906_73_402 109
188 3300042126 Ga0450888_007662 Ga0450888_007662_843_1172 109
189 3300042126 Ga0450888_036533 Ga0450888_036533_79_408 109
190 3300042127 Ga0450890_014179 Ga0450890_014179_395_724 109
191 3300042131 Ga0450894_010929 Ga0450894_010929_24_353 109
192 3300042133 Ga0450896_082260 Ga0450896_082260_122_451 109
193 3300042144 Ga0450889_004248 Ga0450889_004248_733_1062 109
194 3300042157 Ga0439458_0084329 Ga0439458_0084329_236_565 109
195 3300042435 Ga0439434_0039627 Ga0439434_0039627_251_580 109
196 3300042436 Ga0439435_0004717 Ga0439435_0004717_699_1028 109
197 3300042436 Ga0439435_0005293 Ga0439435_0005293_2358_2687 109
198 3300042436 Ga0439435_0065758 Ga0439435_0065758_328_657 109
199 3300042437 Ga0439444_0000329 Ga0439444_0000329_1730_2059 109
200 3300042438 Ga0439459_0019665 Ga0439459_0019665_339_668 109
201 3300042439 Ga0439464_0001612 Ga0439464_0001612_2302_2631 109
202 3300042439 Ga0439464_0023177 Ga0439464_0023177_456_785 109
203 3300042461 Ga0439460_0039722 Ga0439460_0039722_408_737 109
204 3300042530 Ga0450916_076105 Ga0450916_076105_106_435 109
205 3300042531 Ga0450918_093834 Ga0450918_093834_185_514 109
206 3300042532 Ga0450893_0001440 Ga0450893_0001440_538_867 109
207 3300042993 Ga0439440_0168593 Ga0439440_0168593_146_475 109
208 3300046460 Ga0495638_0000845 Ga0495638_0000845_24085_24414 109
209 3300046518 Ga0495631_0100456 Ga0495631_0100456_305_634 109
210 3300046524 Ga0495648_0014995 Ga0495648_0014995_1821_2150 109
211 3300046530 Ga0495654_0352058 Ga0495654_0352058_27_356 109
212 3300046648 Ga0495611_0378864 Ga0495611_0378864_93_422 109
213 3300046660 Ga0495625_0311517 Ga0495625_0311517_555_884 109
214 3300046691 Ga0495670_0012838 Ga0495670_0012838_357_686 109
215 3300047445 Ga0495677_0383397 Ga0495677_0383397_137_466 109
216 3300047470 Ga0495681_0024703 Ga0495681_0024703_1470_1799 109
217 3300047470 Ga0495681_0051983 Ga0495681_0051983_788_1117 109
218 3300048090 Ga0495615_0000039 Ga0495615_0000039_25039_25368 109
219 3300048903 Ga0496100_0646610 Ga0496100_0646610_283_612 109
220 3300048904 Ga0496101_0516817 Ga0496101_0516817_296_625 109
221 3300048905 Ga0496102_0000452 Ga0496102_0000452_29302_29631 109
222 3300048906 Ga0496103_0000518 Ga0496103_0000518_18643_18972 109
223 3300048907 Ga0496104_0038840 Ga0496104_0038840_1533_1862 109
224 3300048908 Ga0496105_0000823 Ga0496105_0000823_7948_8277 109
225 3300048910 Ga0496107_0056770 Ga0496107_0056770_405_734 109
226 3300048914 Ga0496111_0012329 Ga0496111_0012329_381_710 109
227 3300048917 Ga0496114_0006274 Ga0496114_0006274_376_705 109
228 3300048917 Ga0496114_0598443 Ga0496114_0598443_625_954 109
229 3300048918 Ga0496115_0000230 Ga0496115_0000230_22014_22343 109
230 3300048919 Ga0496116_0003936 Ga0496116_0003936_9743_10072 109
231 3300048920 Ga0496117_0000885 Ga0496117_0000885_17114_17443 109
232 3300048920 Ga0496117_0049243 Ga0496117_0049243_743_1102 109
233 3300048921 Ga0496118_0000144 Ga0496118_0000144_105113_105442 109
234 3300048921 Ga0496118_0015642 Ga0496118_0015642_5434_5793 109
235 3300048922 Ga0496119_0014764 Ga0496119_0014764_3338_3667 109
236 3300048924 Ga0496121_0000295 Ga0496121_0000295_90029_90358 109
237 3300048924 Ga0496121_0073531 Ga0496121_0073531_2135_2464 109
238 3300048924 Ga0496121_0100832 Ga0496121_0100832_1441_1770 109
239 3300048925 Ga0496122_0001136 Ga0496122_0001136_24025_24354 109
240 3300048925 Ga0496122_0006264 Ga0496122_0006264_9444_9773 109
241 3300048925 Ga0496122_0014827 Ga0496122_0014827_769_1098 109
242 3300048925 Ga0496122_0036476 Ga0496122_0036476_1391_1720 109
243 3300048926 Ga0496123_0001120 Ga0496123_0001120_29012_29341 109
244 3300048926 Ga0496123_0001168 Ga0496123_0001168_24025_24354 109
245 3300048926 Ga0496123_0013015 Ga0496123_0013015_2440_2769 109
246 3300048926 Ga0496123_0039575 Ga0496123_0039575_1427_1756 109
247 3300048927 Ga0496124_0000683 Ga0496124_0000683_18782_19111 109
248 3300048927 Ga0496124_0017980 Ga0496124_0017980_3913_4242 109
249 3300048927 Ga0496124_0137675 Ga0496124_0137675_520_849 109
250 3300048928 Ga0496125_0001206 Ga0496125_0001206_28611_28940 109
251 3300048928 Ga0496125_0126230 Ga0496125_0126230_280_609 109
252 3300048929 Ga0496126_0001756 Ga0496126_0001756_12819_13148 109
253 3300048929 Ga0496126_0001880 Ga0496126_0001880_25378_25707 109
254 3300048929 Ga0496126_0052573 Ga0496126_0052573_743_1072 109
255 3300048929 Ga0496126_0149657 Ga0496126_0149657_447_806 109
256 3300048929 Ga0496126_0770763 Ga0496126_0770763_168_572 109
257 3300049127 Ga0501306_026572 Ga0501306_026572_418_747 109
258 3300049130 Ga0501310_018905 Ga0501310_018905_93_422 109
259 3300049528 Ga0501312_073374 Ga0501312_073374_91_420 109
260 3300049533 Ga0501317_017249 Ga0501317_017249_101_430 109
261 3300049533 Ga0501317_110449 Ga0501317_110449_80_409 109
262 3300049534 Ga0501318_059113 Ga0501318_059113_83_412 109
263 3300049571 Ga0501034_0028614 Ga0501034_0028614_582_911 109
264 3300049822 Ga0501035_1224223 Ga0501035_1224223_189_518 109
265 3300050489 nmdc:mga03683_169277_c1 nmdc:mga03683_169277_c1_179_508 109
266 3300050489 nmdc:mga03683_674718_c1 nmdc:mga03683_674718_c1_142_471 109
267 3300050489 nmdc:mga03683_88789_c1 nmdc:mga03683_88789_c1_34_363 109
268 3300050490 nmdc:mga03n38_364430_c1 nmdc:mga03n38_364430_c1_281_610 109
269 3300050490 nmdc:mga03n38_511429_c1 nmdc:mga03n38_511429_c1_332_661 109
270 3300050491 nmdc:mga00v17_324368_c1 nmdc:mga00v17_324368_c1_142_471 109
271 3300050491 nmdc:mga00v17_73568_c1 nmdc:mga00v17_73568_c1_678_1007 109
272 3300050492 nmdc:mga0yw44_387988_c1 nmdc:mga0yw44_387988_c1_72_401 109
273 3300050492 nmdc:mga0yw44_95483_c1 nmdc:mga0yw44_95483_c1_385_714 109
274 3300050493 nmdc:mga0k408_38279_c1 nmdc:mga0k408_38279_c1_1988_2317 109
275 3300050493 nmdc:mga0k408_934858_c1 nmdc:mga0k408_934858_c1_82_411 109
276 3300050494 nmdc:mga06z11_55146_c1 nmdc:mga06z11_55146_c1_581_910 109
277 3300050494 nmdc:mga06z11_853454_c1 nmdc:mga06z11_853454_c1_72_401 109
278 3300050496 nmdc:mga07m45_262594_c1 nmdc:mga07m45_262594_c1_333_662 109
279 3300050507 nmdc:mga05p37_42994_c1 nmdc:mga05p37_42994_c1_2194_2568 109
280 3300050508 nmdc:mga09592_404798_c1 nmdc:mga09592_404798_c1_664_993 109
281 3300050509 nmdc:mga0qj67_302900_c1 nmdc:mga0qj67_302900_c1_938_1267 109
282 3300050510 nmdc:mga06r32_37885_c1 nmdc:mga06r32_37885_c1_4183_4512 109
283 3300050511 nmdc:mga08y16_877599_c1 nmdc:mga08y16_877599_c1_339_668 109
284 3300050516 nmdc:mga0sz30_68759_c1 nmdc:mga0sz30_68759_c1_175_504 109
285 3300053087 Ga0500643_000067 Ga0500643_000067_26925_27254 109
286 3300053087 Ga0500643_009969 Ga0500643_009969_377_706 109
287 3300053090 Ga0500646_0011837 Ga0500646_0011837_904_1233 109
288 3300053123 Ga0500614_022569 Ga0500614_022569_967_1296 109
289 3300053130 Ga0500642_0000953 Ga0500642_0000953_1840_2169 109
290 3300053139 Ga0500568_0087452 Ga0500568_0087452_205_534 109
291 3300053153 Ga0500616_0017532 Ga0500616_0017532_2810_3139 109
292 iso_pu_bacteria 2884960567 2884961726 109
293 iso_pu_bacteria 8001845381 8001848201 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

9

102

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.9293 5 108
3nbr-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound 0.876 8 109
5cxo-assembly1.cif.gz_A intriguing role of epoxide hydrolase/cyclase-like enzyme salbiii in pyran ring formation in polyether salinomycin 0.8704 7 107
5if6-assembly2.cif.gz_B structure of a computationally designed 17-ohp binder 0.8684 8 109
2z7a-assembly3.cif.gz_D-2 x-ray crystal structure of rv0760c from mycobacterium tuberculosis at 2.10 angstrom resolution 0.865 8 109
ID Description Score Start End Superfamily
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9281 5 108 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8874 5 108 3.10.450.50
5cxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8704 7 107 3.10.450.50
5tgnA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8699 8 108 3.10.450.50
af_Q55CV2_31_144_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8675 9 108 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A4P7RSI5-F1-model_v4 Nuclear transport factor 2 family protein 1.003 4 109
AF-A0A4Q2ZC24-F1-model_v4 Nuclear transport factor 2 family protein 0.9994 3 109
AF-A0A4P7RTR4-F1-model_v4 Nuclear transport factor 2 family protein 0.9992 5 109
AF-A8I0U0-F1-model_v4 SnoaL-like domain-containing protein 0.999 1 109
AF-A0A2W6TBT1-F1-model_v4 deleted 0.998 1 109

Feature Viewer

pLDDT pTM Quality
94.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map