F391365

General Info

Members Datasets Scaffolds Average Seq Length
293 186 586 132

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10685626|Ga0070709_106856261
Length 152
Sequence VIVDTSVWIDFFAGGDTWQVGLLAQQLDDEQPVGLTDIVYAEILQGIKDDGVLLGVERQLLALDIVGLEGLGDFGNAAQLYRAARRQGLTIRRTADCLIATVCVREDRPLLHKDVDFEHLAAVSPLRLVKQPSGVSEPAAPSAPPVGSPDTR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 20.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10685626 3300005434 Unclassified 796
2 JGI25407J50210_10114110 3300003373 Bacteria 666
3 Ga0070658_10096830 3300005327 Bacteria 2436
4 Ga0070658_10320604 3300005327 Bacteria 1323
5 Ga0070683_100271381 3300005329 Bacteria 1613
6 Ga0070683_100602408 3300005329 Bacteria 1051
7 Ga0070677_10000048 3300005333 Bacteria 37331
8 Ga0070680_100003174 3300005336 Bacteria 12217
9 Ga0070680_100165858 3300005336 Unclassified 1857
10 Ga0070682_100268994 3300005337 Bacteria 1237
11 Ga0070660_100123969 3300005339 Bacteria 2064
12 Ga0070689_100140233 3300005340 Bacteria 1944
13 Ga0070691_10084782 3300005341 Bacteria 1556
14 Ga0070661_100431286 3300005344 Bacteria 1046
15 Ga0070692_11050180 3300005345 Unclassified 572
16 Ga0070668_100000238 3300005347 Bacteria 36117
17 Ga0070669_100434464 3300005353 Bacteria 1079
18 Ga0070675_100575968 3300005354 Bacteria 1020
19 Ga0070673_100538348 3300005364 Bacteria 1060
20 Ga0070659_100289575 3300005366 Bacteria 1364
21 Ga0070714_100004077 3300005435 Bacteria 10980
22 Ga0070714_100627517 3300005435 Bacteria 1033
23 Ga0070713_100606749 3300005436 Unclassified 1040
24 Ga0070713_101395203 3300005436 Unclassified 679
25 Ga0070700_100032606 3300005441 Bacteria 3132
26 Ga0070694_100313263 3300005444 Unclassified 1206
27 Ga0070708_100093225 3300005445 Bacteria 2745
28 Ga0070708_100168249 3300005445 Bacteria 2045
29 Ga0070708_100899208 3300005445 Bacteria 831
30 Ga0070708_101119373 3300005445 Bacteria 737
31 Ga0070663_100885938 3300005455 Bacteria 770
32 Ga0070662_100018551 3300005457 Bacteria 4708
33 Ga0070706_100046582 3300005467 Bacteria 4002
34 Ga0070706_101279732 3300005467 Unclassified 673
35 Ga0070706_101549838 3300005467 Unclassified 605
36 Ga0070707_100028710 3300005468 Bacteria 5295
37 Ga0070707_100602680 3300005468 Bacteria 1061
38 Ga0070698_100443809 3300005471 Unclassified 1233
39 Ga0070699_100457796 3300005518 Unclassified 1157
40 Ga0070684_100028938 3300005535 Bacteria 4690
41 Ga0070684_100063981 3300005535 Bacteria 3226
42 Ga0070697_100597043 3300005536 Unclassified 970
43 Ga0070697_100857876 3300005536 Bacteria 805
44 Ga0068853_100170314 3300005539 Bacteria 1970
45 Ga0070672_100157660 3300005543 Unclassified 1881
46 Ga0070695_100500778 3300005545 Bacteria 939
47 Ga0070695_100843800 3300005545 Unclassified 737
48 Ga0070696_100007553 3300005546 Bacteria 7272
49 Ga0070696_100194767 3300005546 Bacteria 1510
50 Ga0070704_100003001 3300005549 Bacteria 9595
51 Ga0070704_100164965 3300005549 Bacteria 1756
52 Ga0070664_100311478 3300005564 Bacteria 1425
53 Ga0068854_100112068 3300005578 Bacteria 2059
54 Ga0068854_100115844 3300005578 Bacteria 2028
55 Ga0068854_100403385 3300005578 Bacteria 1132
56 Ga0068856_100060417 3300005614 Bacteria 3744
57 Ga0068856_100180879 3300005614 Bacteria 2121
58 Ga0068852_100660916 3300005616 Bacteria 1053
59 Ga0068859_100454254 3300005617 Unclassified 1377
60 Ga0068861_100004840 3300005719 Bacteria 9055
61 Ga0068858_100445251 3300005842 Bacteria 1248
62 Ga0068862_100057539 3300005844 Bacteria 3334
63 Ga0081455_10104536 3300005937 Unclassified 2265
64 Ga0081538_10000621 3300005981 Bacteria 39454
65 Ga0081538_10143207 3300005981 Bacteria 1097
66 Ga0070717_10271439 3300006028 Bacteria 1502
67 Ga0075432_10207319 3300006058 Bacteria 778
68 Ga0075428_100026166 3300006844 Bacteria 6462
69 Ga0075428_100046740 3300006844 Bacteria 4754
70 Ga0075428_100145049 3300006844 Bacteria 2580
71 Ga0075428_100872880 3300006844 Bacteria 955
72 Ga0075430_100801141 3300006846 Bacteria 776
73 Ga0075431_100425697 3300006847 Bacteria 1326
74 Ga0075431_100803206 3300006847 Bacteria 914
75 Ga0075434_100579123 3300006871 Unclassified 1142
76 Ga0075434_102265463 3300006871 Unclassified 546
77 Ga0075429_101035301 3300006880 Unclassified 717
78 Ga0075429_102010064 3300006880 Unclassified 500
79 Ga0075436_100471461 3300006914 Unclassified 916
80 Ga0097620_100454244 3300006931 Unclassified 1377
81 Ga0075435_100452734 3300007076 Bacteria 1107
82 Ga0105240_10369772 3300009093 Bacteria 1621
83 Ga0105240_10491633 3300009093 Bacteria 1366
84 Ga0105240_11971747 3300009093 Bacteria 607
85 Ga0111539_10005684 3300009094 Bacteria 16136
86 Ga0111539_10582975 3300009094 Unclassified 1302
87 Ga0111539_11091194 3300009094 Unclassified 927
88 Ga0105245_10135301 3300009098 Bacteria 2316
89 Ga0105245_10188134 3300009098 Bacteria 1976
90 Ga0114129_10802060 3300009147 Bacteria 1201
91 Ga0114129_11429926 3300009147 Bacteria 852
92 Ga0114129_11714837 3300009147 Bacteria 766
93 Ga0114129_12762991 3300009147 Unclassified 584
94 Ga0105238_10126094 3300009551 Bacteria 2538
95 Ga0105249_10035460 3300009553 Bacteria 4524
96 Ga0105239_10075848 3300010375 Bacteria 3697
97 Ga0105239_10552477 3300010375 Unclassified 1311
98 Ga0157370_10146804 3300013104 Bacteria 2196
99 Ga0157369_10041032 3300013105 Bacteria 5051
100 Ga0157369_10208504 3300013105 Bacteria 2049
101 Ga0157378_11640177 3300013297 Unclassified 689
102 Ga0163162_10087187 3300013306 Bacteria 3200
103 Ga0163162_10794340 3300013306 Bacteria 1064
104 Ga0163162_11614522 3300013306 Unclassified 740
105 Ga0157380_10501078 3300014326 Bacteria 1180
106 Ga0157380_11312923 3300014326 Bacteria 771
107 Ga0157377_10137326 3300014745 Bacteria 1499
108 Ga0206354_10013057 3300020081 Bacteria 2364
109 Ga0206353_11283495 3300020082 Bacteria 1696
110 Ga0207682_10000168 3300025893 Bacteria 30073
111 Ga0207688_10147812 3300025901 Bacteria 1386
112 Ga0207699_10547595 3300025906 Bacteria 839
113 Ga0207645_10309429 3300025907 Bacteria 1053
114 Ga0207705_10094773 3300025909 Bacteria 2190
115 Ga0207705_10306143 3300025909 Bacteria 1219
116 Ga0207684_10048680 3300025910 Bacteria 3595
117 Ga0207684_10947510 3300025910 Unclassified 722
118 Ga0207660_10607250 3300025917 Unclassified 891
119 Ga0207657_10128235 3300025919 Bacteria 2082
120 Ga0207657_10242024 3300025919 Bacteria 1440
121 Ga0207649_10556946 3300025920 Bacteria 878
122 Ga0207652_10568153 3300025921 Bacteria 1018
123 Ga0207646_10014736 3300025922 Bacteria 7407
124 Ga0207681_10144824 3300025923 Unclassified 1774
125 Ga0207694_10304954 3300025924 Bacteria 1312
126 Ga0207687_10580646 3300025927 Bacteria 943
127 Ga0207700_10631182 3300025928 Unclassified 954
128 Ga0207664_10666253 3300025929 Unclassified 935
129 Ga0207690_10048421 3300025932 Bacteria 2826
130 Ga0207706_10004022 3300025933 Bacteria 13914
131 Ga0207686_10874979 3300025934 Bacteria 724
132 Ga0207691_10131353 3300025940 Unclassified 2212
133 Ga0207667_10764819 3300025949 Unclassified 964
134 Ga0207651_10555197 3300025960 Bacteria 999
135 Ga0207712_10062967 3300025961 Bacteria 2639
136 Ga0207712_10100972 3300025961 Bacteria 2145
137 Ga0207668_10017688 3300025972 Bacteria 4472
138 Ga0207640_10032290 3300025981 Bacteria 3245
139 Ga0207640_10198798 3300025981 Bacteria 1517
140 Ga0207640_10330621 3300025981 Bacteria 1217
141 Ga0207677_10713149 3300026023 Bacteria 891
142 Ga0207639_10101290 3300026041 Bacteria 2329
143 Ga0207678_11136359 3300026067 Bacteria 692
144 Ga0207708_10083479 3300026075 Bacteria 2456
145 Ga0207702_10016756 3300026078 Bacteria 6066
146 Ga0207702_10163916 3300026078 Bacteria 2032
147 Ga0207675_100002122 3300026118 Bacteria 19651
148 Ga0207698_10334876 3300026142 Bacteria 1423
149 Ga0207698_10537022 3300026142 Bacteria 1144
150 Ga0207428_10005083 3300027907 Bacteria 12354
151 Ga0207428_11025877 3300027907 Unclassified 579
152 Ga0268265_10056162 3300028380 Bacteria 2994
153 Ga0268264_10163172 3300028381 Bacteria 2009
154 Ga0307408_101147168 3300031548 Bacteria 723
155 Ga0307518_10081326 3300031838 Bacteria 2339
156 Ga0307406_10089079 3300031901 Bacteria 2072
157 Ga0307416_100014644 3300032002 Bacteria 5386
158 Ga0307411_10003701 3300032005 Bacteria 7164
159 Ga0307415_100621835 3300032126 Bacteria 964
160 Ga0373948_0093803 3300034817 Bacteria 699
161 Ga0373931_0000035 3300035691 Bacteria 80746
162 Ga0395900_0613795 3300037418 Bacteria 1027
163 Ga0395898_0110646 3300037466 Bacteria 2633
164 Ga0436364_0750023 3300037853 Bacteria 6469
165 Ga0395901_0282565 3300038443 Bacteria 1724
166 Ga0395901_2023947 3300038443 Unclassified 522
167 Ga0436360_0847341 3300039438 Unclassified 775
168 Ga0436361_0599260 3300039447 Unclassified 656
169 Ga0436361_0999536 3300039447 Bacteria 1537
170 Ga0436362_1244554 3300039453 Unclassified 860
171 Ga0451791_0099758 3300041451 Bacteria 1318
172 Ga0439435_0259616 3300042436 Unclassified 587
173 Ga0466969_0127105 3300044656 Bacteria 1184
174 Ga0466969_0143003 3300044656 Bacteria 1105
175 Ga0453683_0215910 3300044673 Bacteria 1219
176 Ga0466965_0128866 3300044683 Bacteria 1311
177 Ga0466966_0504052 3300044684 Bacteria 728
178 Ga0466963_0084085 3300044694 Bacteria 2159
179 Ga0466957_0030697 3300044842 Bacteria 3210
180 Ga0466957_0185406 3300044842 Bacteria 1360
181 Ga0466960_0681301 3300044901 Bacteria 615
182 Ga0466959_0017519 3300045049 Bacteria 5252
183 Ga0466958_0060952 3300045836 Bacteria 2297
184 Ga0466958_0216085 3300045836 Bacteria 1222
185 Ga0466967_0574733 3300045976 Bacteria 1111
186 Ga0495596_0228015 3300046500 Unclassified 723
187 Ga0495620_0000344 3300046515 Bacteria 32387
188 Ga0495652_0000022 3300046529 Bacteria 178368
189 Ga0495645_0000286 3300046543 Bacteria 37134
190 Ga0495656_0018128 3300046615 Bacteria 2698
191 Ga0495656_0164668 3300046615 Bacteria 1080
192 Ga0495672_0005230 3300047320 Bacteria 10337
193 Ga0496109_0000001 3300048912 Bacteria 700852
194 Ga0496110_0017966 3300048913 Bacteria 5924
195 Ga0496113_0018351 3300048916 Bacteria 4870
196 Ga0496125_0237707 3300048928 Unclassified 1159
197 Ga0501031_0000885 3300049568 Bacteria 18036
198 Ga0501031_0008236 3300049568 Bacteria 6780
199 Ga0501032_0000843 3300049569 Bacteria 24899
200 Ga0501032_0005696 3300049569 Bacteria 9227
201 Ga0501033_0001203 3300049570 Bacteria 23326
202 Ga0501033_0011825 3300049570 Bacteria 6672
203 Ga0501034_0000466 3300049571 Bacteria 66806
204 Ga0501034_0004760 3300049571 Bacteria 15020
205 Ga0501034_0457550 3300049571 Bacteria 1193
206 Ga0501036_0000711 3300049572 Bacteria 24631
207 Ga0501036_0008814 3300049572 Bacteria 8280
208 Ga0501037_0000522 3300049573 Bacteria 30837
209 Ga0501037_0002367 3300049573 Bacteria 13619
210 Ga0501038_0002510 3300049574 Bacteria 17093
211 Ga0501038_0022039 3300049574 Bacteria 5713
212 Ga0501039_0003044 3300049575 Bacteria 12541
213 Ga0501040_0005537 3300049576 Bacteria 8175
214 Ga0501040_0060383 3300049576 Bacteria 2605
215 Ga0501040_0756312 3300049576 Unclassified 703
216 Ga0501042_0016864 3300049578 Bacteria 5025
217 Ga0501042_0027547 3300049578 Bacteria 3997
218 Ga0501043_0002028 3300049579 Bacteria 17289
219 Ga0501043_0031742 3300049579 Bacteria 4152
220 Ga0501046_0001261 3300049580 Bacteria 24516
221 Ga0501046_0001400 3300049580 Bacteria 23220
222 Ga0501047_0000585 3300049581 Bacteria 38692
223 Ga0501047_0001310 3300049581 Bacteria 24535
224 Ga0501047_0006924 3300049581 Bacteria 10650
225 Ga0501047_0010346 3300049581 Bacteria 8824
226 Ga0501047_0607223 3300049581 Bacteria 915
227 Ga0501048_0000689 3300049582 Bacteria 24553
228 Ga0501048_0005699 3300049582 Bacteria 9467
229 Ga0501068_0013903 3300049584 Bacteria 4590
230 Ga0501068_0596113 3300049584 Bacteria 720
231 Ga0501068_0723562 3300049584 Bacteria 651
232 Ga0501069_0000078 3300049585 Bacteria 47681
233 Ga0501069_0009351 3300049585 Bacteria 5174
234 Ga0501070_0000267 3300049586 Bacteria 49167
235 Ga0501070_0001290 3300049586 Bacteria 22489
236 Ga0501070_0017742 3300049586 Bacteria 5976
237 Ga0501072_0074312 3300049588 Bacteria 2688
238 Ga0501072_0454288 3300049588 Bacteria 1014
239 Ga0501072_0564702 3300049588 Unclassified 898
240 Ga0501073_0001506 3300049589 Bacteria 17232
241 Ga0501073_0012742 3300049589 Bacteria 6134
242 Ga0501073_0454425 3300049589 Bacteria 885
243 Ga0501074_0003835 3300049590 Bacteria 10696
244 Ga0501074_0218661 3300049590 Unclassified 1357
245 Ga0501074_0379695 3300049590 Unclassified 1003
246 Ga0501075_0442083 3300049591 Unclassified 992
247 Ga0501076_0777726 3300049592 Unclassified 790
248 Ga0501079_0032038 3300049741 Bacteria 4040
249 Ga0501079_0057891 3300049741 Bacteria 2990
250 Ga0501079_0278599 3300049741 Unclassified 1308
251 Ga0501080_0011833 3300049742 Bacteria 7996
252 Ga0501080_0122058 3300049742 Bacteria 2414
253 Ga0501080_1267104 3300049742 Bacteria 632
254 Ga0501080_1797085 3300049742 Unclassified 515
255 Ga0501081_0068949 3300049743 Bacteria 2463
256 Ga0501081_1483228 3300049743 Unclassified 515
257 Ga0501083_0007708 3300049744 Bacteria 7632
258 Ga0501083_0038384 3300049744 Bacteria 3256
259 Ga0501083_0760606 3300049744 Bacteria 630
260 Ga0501035_0000625 3300049822 Bacteria 38949
261 Ga0501035_0001546 3300049822 Bacteria 23436
262 Ga0501044_0000092 3300049823 Bacteria 110012
263 Ga0501044_0003136 3300049823 Bacteria 18695
264 Ga0501044_0482742 3300049823 Bacteria 1142
265 Ga0501045_0020390 3300049824 Bacteria 4734
266 Ga0501045_0438533 3300049824 Bacteria 971
267 Ga0501045_0528184 3300049824 Unclassified 876
268 Ga0501045_1421887 3300049824 Bacteria 503
269 nmdc:mga05p37_1600203_c1 3300050507 Unclassified 642
270 nmdc:mga05p37_969742_c1 3300050507 Bacteria 907
271 nmdc:mga09592_597850_c1 3300050508 Bacteria 945
272 nmdc:mga09592_914708_c1 3300050508 Unclassified 737
273 nmdc:mga0qj67_724969_c1 3300050509 Bacteria 790
274 nmdc:mga06r32_1754256_c1 3300050510 Bacteria 557
275 nmdc:mga06r32_772001_c1 3300050510 Bacteria 923
276 nmdc:mga08y16_401836_c1 3300050511 Unclassified 1402
277 nmdc:mga08y16_7748_c1 3300050511 Bacteria 11248
278 nmdc:mga0n895_1622242_c1 3300050512 Unclassified 611
279 nmdc:mga0rr50_430780_c1 3300050513 Bacteria 1116
280 nmdc:mga08x19_270764_c1 3300050514 Bacteria 1175
281 Ga0495655_0014813 3300053083 Bacteria 1644
282 Ga0500559_0001844 3300053136 Bacteria 11548
283 Ga0500585_083565 3300053144 Bacteria 1154
284 Ga0501084_0141440 3300054114 Bacteria 2026
285 Ga0501084_0284251 3300054114 Unclassified 1397
286 Ga0501084_1010716 3300054114 Unclassified 699
287 Ga0501082_0031003 3300060353 Bacteria 4608
288 Ga0501082_0251504 3300060353 Bacteria 1538
289 Ga0501082_0516847 3300060353 Unclassified 1044
290 Ga0501082_0607388 3300060353 Unclassified 957
291 Ga0466962_0349905 3300061719 Bacteria 736
292 Ga0530510_0042697 3300061734 Bacteria 3275
293 Ga0530510_0334230 3300061734 Unclassified 1137
294 Ga0070709_10685626
295 JGI25407J50210_10114110
296 Ga0070658_10096830
297 Ga0070658_10320604
298 Ga0070683_100271381
299 Ga0070683_100602408
300 Ga0070677_10000048
301 Ga0070680_100003174
302 Ga0070680_100165858
303 Ga0070682_100268994
304 Ga0070660_100123969
305 Ga0070689_100140233
306 Ga0070691_10084782
307 Ga0070661_100431286
308 Ga0070692_11050180
309 Ga0070668_100000238
310 Ga0070669_100434464
311 Ga0070675_100575968
312 Ga0070673_100538348
313 Ga0070659_100289575
314 Ga0070714_100004077
315 Ga0070714_100627517
316 Ga0070713_100606749
317 Ga0070713_101395203
318 Ga0070700_100032606
319 Ga0070694_100313263
320 Ga0070708_100093225
321 Ga0070708_100168249
322 Ga0070708_100899208
323 Ga0070708_101119373
324 Ga0070663_100885938
325 Ga0070662_100018551
326 Ga0070706_100046582
327 Ga0070706_101279732
328 Ga0070706_101549838
329 Ga0070707_100028710
330 Ga0070707_100602680
331 Ga0070698_100443809
332 Ga0070699_100457796
333 Ga0070684_100028938
334 Ga0070684_100063981
335 Ga0070697_100597043
336 Ga0070697_100857876
337 Ga0068853_100170314
338 Ga0070672_100157660
339 Ga0070695_100500778
340 Ga0070695_100843800
341 Ga0070696_100007553
342 Ga0070696_100194767
343 Ga0070704_100003001
344 Ga0070704_100164965
345 Ga0070664_100311478
346 Ga0068854_100112068
347 Ga0068854_100115844
348 Ga0068854_100403385
349 Ga0068856_100060417
350 Ga0068856_100180879
351 Ga0068852_100660916
352 Ga0068859_100454254
353 Ga0068861_100004840
354 Ga0068858_100445251
355 Ga0068862_100057539
356 Ga0081455_10104536
357 Ga0081538_10000621
358 Ga0081538_10143207
359 Ga0070717_10271439
360 Ga0075432_10207319
361 Ga0075428_100026166
362 Ga0075428_100046740
363 Ga0075428_100145049
364 Ga0075428_100872880
365 Ga0075430_100801141
366 Ga0075431_100425697
367 Ga0075431_100803206
368 Ga0075434_100579123
369 Ga0075434_102265463
370 Ga0075429_101035301
371 Ga0075429_102010064
372 Ga0075436_100471461
373 Ga0097620_100454244
374 Ga0075435_100452734
375 Ga0105240_10369772
376 Ga0105240_10491633
377 Ga0105240_11971747
378 Ga0111539_10005684
379 Ga0111539_10582975
380 Ga0111539_11091194
381 Ga0105245_10135301
382 Ga0105245_10188134
383 Ga0114129_10802060
384 Ga0114129_11429926
385 Ga0114129_11714837
386 Ga0114129_12762991
387 Ga0105238_10126094
388 Ga0105249_10035460
389 Ga0105239_10075848
390 Ga0105239_10552477
391 Ga0157370_10146804
392 Ga0157369_10041032
393 Ga0157369_10208504
394 Ga0157378_11640177
395 Ga0163162_10087187
396 Ga0163162_10794340
397 Ga0163162_11614522
398 Ga0157380_10501078
399 Ga0157380_11312923
400 Ga0157377_10137326
401 Ga0206354_10013057
402 Ga0206353_11283495
403 Ga0207682_10000168
404 Ga0207688_10147812
405 Ga0207699_10547595
406 Ga0207645_10309429
407 Ga0207705_10094773
408 Ga0207705_10306143
409 Ga0207684_10048680
410 Ga0207684_10947510
411 Ga0207660_10607250
412 Ga0207657_10128235
413 Ga0207657_10242024
414 Ga0207649_10556946
415 Ga0207652_10568153
416 Ga0207646_10014736
417 Ga0207681_10144824
418 Ga0207694_10304954
419 Ga0207687_10580646
420 Ga0207700_10631182
421 Ga0207664_10666253
422 Ga0207690_10048421
423 Ga0207706_10004022
424 Ga0207686_10874979
425 Ga0207691_10131353
426 Ga0207667_10764819
427 Ga0207651_10555197
428 Ga0207712_10062967
429 Ga0207712_10100972
430 Ga0207668_10017688
431 Ga0207640_10032290
432 Ga0207640_10198798
433 Ga0207640_10330621
434 Ga0207677_10713149
435 Ga0207639_10101290
436 Ga0207678_11136359
437 Ga0207708_10083479
438 Ga0207702_10016756
439 Ga0207702_10163916
440 Ga0207675_100002122
441 Ga0207698_10334876
442 Ga0207698_10537022
443 Ga0207428_10005083
444 Ga0207428_11025877
445 Ga0268265_10056162
446 Ga0268264_10163172
447 Ga0307408_101147168
448 Ga0307518_10081326
449 Ga0307406_10089079
450 Ga0307416_100014644
451 Ga0307411_10003701
452 Ga0307415_100621835
453 Ga0373948_0093803
454 Ga0373931_0000035
455 Ga0395900_0613795
456 Ga0395898_0110646
457 Ga0436364_0750023
458 Ga0395901_0282565
459 Ga0395901_2023947
460 Ga0436360_0847341
461 Ga0436361_0599260
462 Ga0436361_0999536
463 Ga0436362_1244554
464 Ga0451791_0099758
465 Ga0439435_0259616
466 Ga0466969_0127105
467 Ga0466969_0143003
468 Ga0453683_0215910
469 Ga0466965_0128866
470 Ga0466966_0504052
471 Ga0466963_0084085
472 Ga0466957_0030697
473 Ga0466957_0185406
474 Ga0466960_0681301
475 Ga0466959_0017519
476 Ga0466958_0060952
477 Ga0466958_0216085
478 Ga0466967_0574733
479 Ga0495596_0228015
480 Ga0495620_0000344
481 Ga0495652_0000022
482 Ga0495645_0000286
483 Ga0495656_0018128
484 Ga0495656_0164668
485 Ga0495672_0005230
486 Ga0496109_0000001
487 Ga0496110_0017966
488 Ga0496113_0018351
489 Ga0496125_0237707
490 Ga0501031_0000885
491 Ga0501031_0008236
492 Ga0501032_0000843
493 Ga0501032_0005696
494 Ga0501033_0001203
495 Ga0501033_0011825
496 Ga0501034_0000466
497 Ga0501034_0004760
498 Ga0501034_0457550
499 Ga0501036_0000711
500 Ga0501036_0008814
501 Ga0501037_0000522
502 Ga0501037_0002367
503 Ga0501038_0002510
504 Ga0501038_0022039
505 Ga0501039_0003044
506 Ga0501040_0005537
507 Ga0501040_0060383
508 Ga0501040_0756312
509 Ga0501042_0016864
510 Ga0501042_0027547
511 Ga0501043_0002028
512 Ga0501043_0031742
513 Ga0501046_0001261
514 Ga0501046_0001400
515 Ga0501047_0000585
516 Ga0501047_0001310
517 Ga0501047_0006924
518 Ga0501047_0010346
519 Ga0501047_0607223
520 Ga0501048_0000689
521 Ga0501048_0005699
522 Ga0501068_0013903
523 Ga0501068_0596113
524 Ga0501068_0723562
525 Ga0501069_0000078
526 Ga0501069_0009351
527 Ga0501070_0000267
528 Ga0501070_0001290
529 Ga0501070_0017742
530 Ga0501072_0074312
531 Ga0501072_0454288
532 Ga0501072_0564702
533 Ga0501073_0001506
534 Ga0501073_0012742
535 Ga0501073_0454425
536 Ga0501074_0003835
537 Ga0501074_0218661
538 Ga0501074_0379695
539 Ga0501075_0442083
540 Ga0501076_0777726
541 Ga0501079_0032038
542 Ga0501079_0057891
543 Ga0501079_0278599
544 Ga0501080_0011833
545 Ga0501080_0122058
546 Ga0501080_1267104
547 Ga0501080_1797085
548 Ga0501081_0068949
549 Ga0501081_1483228
550 Ga0501083_0007708
551 Ga0501083_0038384
552 Ga0501083_0760606
553 Ga0501035_0000625
554 Ga0501035_0001546
555 Ga0501044_0000092
556 Ga0501044_0003136
557 Ga0501044_0482742
558 Ga0501045_0020390
559 Ga0501045_0438533
560 Ga0501045_0528184
561 Ga0501045_1421887
562 nmdc:mga05p37_1600203_c1
563 nmdc:mga05p37_969742_c1
564 nmdc:mga09592_597850_c1
565 nmdc:mga09592_914708_c1
566 nmdc:mga0qj67_724969_c1
567 nmdc:mga06r32_1754256_c1
568 nmdc:mga06r32_772001_c1
569 nmdc:mga08y16_401836_c1
570 nmdc:mga08y16_7748_c1
571 nmdc:mga0n895_1622242_c1
572 nmdc:mga0rr50_430780_c1
573 nmdc:mga08x19_270764_c1
574 Ga0495655_0014813
575 Ga0500559_0001844
576 Ga0500585_083565
577 Ga0501084_0141440
578 Ga0501084_0284251
579 Ga0501084_1010716
580 Ga0501082_0031003
581 Ga0501082_0251504
582 Ga0501082_0516847
583 Ga0501082_0607388
584 Ga0466962_0349905
585 Ga0530510_0042697
586 Ga0530510_0334230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

1

123

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.9664 1 128
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.9448 1 128
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.9393 2 130
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.9256 2 130
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.8119 2 129
ID Description Score Start End Superfamily
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9422 1 130 3.40.50.1010
4chgB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.941 3 129 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9353 1 130 3.40.50.1010
af_P9WFB5_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9112 35 129 3.40.50.1010
4chgB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9063 3 129 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1M3BM46-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 1.001 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A1M3BM46-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9935 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A6G0A8R8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9914 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A6G0A8R8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9839 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A0J6YQ39-F1-model_v4 deleted 0.9805 1 130

Map