F391277
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 293 | 213 | 273 | 590 |
Family's Representative Sequence
| Representative Sequence | 3300003187|JGI25151J46595_10004971|JGI25151J46595_100049716 |
| Length | 624 |
| Sequence | MATKSPSRRAAATPAAVAAPGVHYRVECADLHARLFEVTLTIDRPAAEQLLTLPVWIPGSYLVREFAKNLQGLQASQGRRKAPVLTQLDKCSWRVECTAGQPLVLRYKVCAYDNSVRTAWLDAERGFFNGTSLCLRVEGQTDAPHALEIVAPAASALPEGAAPWSCATALPPLKTDRHGFGRYLAADYDELADSPVELGAFWSGEFEAGGVPHRFVVAGAAASFDGERLLADTKAICDAEMRFWHGDKVGKRGGPKPPIDRYVFMLNAVDDGYGGLEHRHSTALICNRRDLPQLGMKKAGDGYVTLLGLISHEYFHTWNVKRLRPAEFARYDYGRENYTRLLWFFEGFTSYYDDLLLRRAGLIDDAAYLRLVNKTINQVQQTPGRQVQSVADASFDAWVKYYRQDEQTPNGTVSYYTKGALVALCLDLKLRAEGRGSLDDAMRHLWSASGGGPVSEADIAAALEAAGGRSYAAELAAWVHSTAELPLSELLRLHGVAALDDPSQPAQTLGLRVAESGGSVQVKVVLRGGAAEKAGFAAGDEWIGIELPAAGRKPAQGWRIGRLDDLALYLGAGKRCTALVARDRKLVKLPLVLPTGVTTWRLLAQDTGRVSKWLAPVAIAATKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 4 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 5 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 6 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 7 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 8 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 9 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 10 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 11 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 12 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 13 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 14 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 15 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 16 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 17 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 18 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 19 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 20 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 21 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 22 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 23 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 24 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 144 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 145 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 146 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 164 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 165 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 166 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 167 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 168 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 169 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 170 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 171 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 197 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 198 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 199 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 200 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 209 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 212 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 213 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.83 |
| Metatranscriptomes | 0.34 |
| Isolates | 6.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.53 |
| Nodule | 1.02 |
| Rhizoplane | 2.73 |
| Rhizosphere | 62.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001228 | 3300002705 | Bacteria | 11260 |
| 2 | JGI25154J39366_1003095 | 3300002738 | Bacteria | 3733 |
| 3 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 4 | JGI25151J46595_10001446 | 3300003187 | Bacteria | 16098 |
| 5 | JGI25151J46595_10004971 | 3300003187 | Bacteria | 6931 |
| 6 | JGI25153J46596_10000674 | 3300003215 | Bacteria | 20875 |
| 7 | JGI25153J46596_10006142 | 3300003215 | Bacteria | 6157 |
| 8 | Ga0006562J51391_1045467 | 3300003578 | Bacteria | 6752 |
| 9 | Ga0055539_1000382 | 3300003752 | Bacteria | 18078 |
| 10 | Ga0055539_1000992 | 3300003752 | Bacteria | 6189 |
| 11 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 12 | Ga0055535_1001531 | 3300003761 | Bacteria | 11369 |
| 13 | Ga0055529_1000338 | 3300003763 | Bacteria | 52417 |
| 14 | Ga0055526_1003927 | 3300003771 | Bacteria | 9181 |
| 15 | Ga0055537_1000618 | 3300003773 | Bacteria | 19474 |
| 16 | Ga0055536_1009899 | 3300003781 | Bacteria | 3870 |
| 17 | Ga0055534_1001207 | 3300003784 | Bacteria | 10825 |
| 18 | Ga0055534_1001997 | 3300003784 | Bacteria | 7436 |
| 19 | Ga0055528_1015294 | 3300003790 | Bacteria | 2781 |
| 20 | Ga0055530_10002840 | 3300003791 | Bacteria | 10590 |
| 21 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 22 | Ga0055531_10000452 | 3300003794 | Bacteria | 38120 |
| 23 | Ga0055531_10003946 | 3300003794 | Bacteria | 9210 |
| 24 | Ga0055531_10008909 | 3300003794 | Bacteria | 5207 |
| 25 | Ga0065714_10008154 | 3300005288 | Bacteria | 4219 |
| 26 | Ga0070658_10057463 | 3300005327 | Bacteria | 3165 |
| 27 | Ga0070666_10014381 | 3300005335 | Bacteria | 5038 |
| 28 | Ga0070680_100109233 | 3300005336 | Bacteria | 2301 |
| 29 | Ga0068868_100002288 | 3300005338 | Bacteria | 13244 |
| 30 | Ga0070660_100017577 | 3300005339 | Bacteria | 5213 |
| 31 | Ga0070661_100001910 | 3300005344 | Bacteria | 14436 |
| 32 | Ga0070675_100006356 | 3300005354 | Bacteria | 9073 |
| 33 | Ga0070675_100044369 | 3300005354 | Bacteria | 3636 |
| 34 | Ga0070673_100002408 | 3300005364 | Bacteria | 11381 |
| 35 | Ga0070659_100000260 | 3300005366 | Bacteria | 41588 |
| 36 | Ga0070659_100028708 | 3300005366 | Bacteria | 4298 |
| 37 | Ga0070667_100015275 | 3300005367 | Bacteria | 6346 |
| 38 | Ga0070678_100028844 | 3300005456 | Bacteria | 3791 |
| 39 | Ga0070662_100063756 | 3300005457 | Bacteria | 2696 |
| 40 | Ga0068867_100021948 | 3300005459 | Bacteria | 4559 |
| 41 | Ga0070672_100030178 | 3300005543 | Bacteria | 4071 |
| 42 | Ga0068855_100032125 | 3300005563 | Bacteria | 6267 |
| 43 | Ga0068855_100043313 | 3300005563 | Bacteria | 5332 |
| 44 | Ga0068855_100254134 | 3300005563 | Bacteria | 1960 |
| 45 | Ga0070664_100006437 | 3300005564 | Bacteria | 9475 |
| 46 | Ga0070664_100015776 | 3300005564 | Bacteria | 6182 |
| 47 | Ga0068857_100025084 | 3300005577 | Bacteria | 5251 |
| 48 | Ga0068854_100012982 | 3300005578 | Bacteria | 5458 |
| 49 | Ga0068854_100049541 | 3300005578 | Bacteria | 3000 |
| 50 | Ga0068864_100005634 | 3300005618 | Bacteria | 10265 |
| 51 | Ga0068861_100084174 | 3300005719 | Bacteria | 2497 |
| 52 | Ga0068863_100053903 | 3300005841 | Bacteria | 3811 |
| 53 | Ga0068858_100005764 | 3300005842 | Bacteria | 12102 |
| 54 | Ga0068862_100043654 | 3300005844 | Bacteria | 3822 |
| 55 | Ga0075365_10001995 | 3300006038 | Bacteria | 9669 |
| 56 | Ga0075365_10007414 | 3300006038 | Bacteria | 6139 |
| 57 | Ga0075365_10090773 | 3300006038 | Bacteria | 2081 |
| 58 | Ga0075363_100004145 | 3300006048 | Bacteria | 6293 |
| 59 | Ga0075363_100016515 | 3300006048 | Bacteria | 3646 |
| 60 | Ga0075364_10063259 | 3300006051 | Bacteria | 2429 |
| 61 | Ga0075432_10010992 | 3300006058 | Bacteria | 3075 |
| 62 | Ga0075366_10007913 | 3300006195 | Bacteria | 5880 |
| 63 | Ga0075366_10022469 | 3300006195 | Bacteria | 3670 |
| 64 | Ga0097621_100060366 | 3300006237 | Bacteria | 3108 |
| 65 | Ga0075370_10022511 | 3300006353 | Bacteria | 3461 |
| 66 | Ga0075370_10032012 | 3300006353 | Bacteria | 2937 |
| 67 | Ga0075430_100035532 | 3300006846 | Bacteria | 4228 |
| 68 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 69 | Ga0105244_10034401 | 3300009036 | Bacteria | 2668 |
| 70 | Ga0105240_10002814 | 3300009093 | Bacteria | 27490 |
| 71 | Ga0105240_10015617 | 3300009093 | Bacteria | 10312 |
| 72 | Ga0105240_10042736 | 3300009093 | Bacteria | 5773 |
| 73 | Ga0105248_10089645 | 3300009177 | Bacteria | 3462 |
| 74 | Ga0105237_10002372 | 3300009545 | Bacteria | 23375 |
| 75 | Ga0105237_10096073 | 3300009545 | Bacteria | 2953 |
| 76 | Ga0105238_10083758 | 3300009551 | Bacteria | 3178 |
| 77 | Ga0105238_10091626 | 3300009551 | Bacteria | 3027 |
| 78 | Ga0105238_10109670 | 3300009551 | Bacteria | 2741 |
| 79 | Ga0105249_10018801 | 3300009553 | Bacteria | 6158 |
| 80 | Ga0105239_10001168 | 3300010375 | Bacteria | 36102 |
| 81 | Ga0157347_1000259 | 3300012502 | Bacteria | 3136 |
| 82 | Ga0157373_10003982 | 3300013100 | Bacteria | 11140 |
| 83 | Ga0157374_10049480 | 3300013296 | Bacteria | 3904 |
| 84 | Ga0163162_10021978 | 3300013306 | Bacteria | 6286 |
| 85 | Ga0157375_10059326 | 3300013308 | Bacteria | 3790 |
| 86 | Ga0163163_10033316 | 3300014325 | Bacteria | 4983 |
| 87 | Ga0182008_10000191 | 3300014497 | Bacteria | 48580 |
| 88 | Ga0182008_10006656 | 3300014497 | Bacteria | 6434 |
| 89 | Ga0157376_10005532 | 3300014969 | Bacteria | 8830 |
| 90 | Ga0157376_10023553 | 3300014969 | Bacteria | 4821 |
| 91 | Ga0182007_10001944 | 3300015262 | Bacteria | 10695 |
| 92 | Ga0182007_10002842 | 3300015262 | Bacteria | 8423 |
| 93 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 94 | Ga0163161_10000244 | 3300017792 | Bacteria | 49165 |
| 95 | Ga0163161_10020769 | 3300017792 | Bacteria | 4610 |
| 96 | Ga0163161_10057603 | 3300017792 | Bacteria | 2823 |
| 97 | Ga0213872_10000132 | 3300021361 | Bacteria | 67609 |
| 98 | Ga0213872_10012173 | 3300021361 | Bacteria | 4056 |
| 99 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 100 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 101 | Ga0207427_100460 | 3300025231 | Bacteria | 22485 |
| 102 | Ga0209258_100262 | 3300025242 | Bacteria | 90619 |
| 103 | Ga0209258_100767 | 3300025242 | Bacteria | 19764 |
| 104 | Ga0207425_1001028 | 3300025245 | Bacteria | 13015 |
| 105 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 106 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 107 | Ga0209677_100175 | 3300025253 | Bacteria | 55052 |
| 108 | Ga0209677_102998 | 3300025253 | Bacteria | 5840 |
| 109 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 110 | Ga0209759_1001440 | 3300025256 | Bacteria | 13427 |
| 111 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 112 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 113 | Ga0209455_1000191 | 3300025272 | Bacteria | 90618 |
| 114 | Ga0209673_1000072 | 3300025273 | Bacteria | 236935 |
| 115 | Ga0209673_1021343 | 3300025273 | Bacteria | 2267 |
| 116 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 117 | Ga0209676_1020063 | 3300025292 | Bacteria | 2281 |
| 118 | Ga0209025_1000286 | 3300025294 | Bacteria | 114096 |
| 119 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 120 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 121 | Ga0209758_1000327 | 3300025297 | Bacteria | 89663 |
| 122 | Ga0209050_1001120 | 3300025298 | Bacteria | 32400 |
| 123 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 124 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 125 | Ga0209051_1000114 | 3300025303 | Bacteria | 152303 |
| 126 | Ga0209051_1002160 | 3300025303 | Bacteria | 14589 |
| 127 | Ga0209051_1003036 | 3300025303 | Bacteria | 11357 |
| 128 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 129 | Ga0209257_1000324 | 3300025304 | Bacteria | 100144 |
| 130 | Ga0207655_1001961 | 3300025728 | Bacteria | 17580 |
| 131 | Ga0207682_10022960 | 3300025893 | Bacteria | 2461 |
| 132 | Ga0207645_10021997 | 3300025907 | Bacteria | 4153 |
| 133 | Ga0207695_10005159 | 3300025913 | Bacteria | 17488 |
| 134 | Ga0207695_10027651 | 3300025913 | Bacteria | 6312 |
| 135 | Ga0207695_10068359 | 3300025913 | Bacteria | 3640 |
| 136 | Ga0207671_10006688 | 3300025914 | Bacteria | 10213 |
| 137 | Ga0207657_10068675 | 3300025919 | Bacteria | 3010 |
| 138 | Ga0207649_10000515 | 3300025920 | Bacteria | 27166 |
| 139 | Ga0207681_10002439 | 3300025923 | Bacteria | 11796 |
| 140 | Ga0207694_10036301 | 3300025924 | Bacteria | 3782 |
| 141 | Ga0207694_10051905 | 3300025924 | Bacteria | 3178 |
| 142 | Ga0207690_10000906 | 3300025932 | Bacteria | 18937 |
| 143 | Ga0207690_10011161 | 3300025932 | Bacteria | 5362 |
| 144 | Ga0207690_10033812 | 3300025932 | Bacteria | 3290 |
| 145 | Ga0207706_10003127 | 3300025933 | Bacteria | 15894 |
| 146 | Ga0207709_10002379 | 3300025935 | Bacteria | 11866 |
| 147 | Ga0207691_10034186 | 3300025940 | Bacteria | 4728 |
| 148 | Ga0207679_10000047 | 3300025945 | Bacteria | 119891 |
| 149 | Ga0207679_10038702 | 3300025945 | Bacteria | 3400 |
| 150 | Ga0207667_10014707 | 3300025949 | Bacteria | 8907 |
| 151 | Ga0207667_10039365 | 3300025949 | Bacteria | 5039 |
| 152 | Ga0207667_10063994 | 3300025949 | Bacteria | 3842 |
| 153 | Ga0207651_10058493 | 3300025960 | Bacteria | 2664 |
| 154 | Ga0207651_10060455 | 3300025960 | Bacteria | 2630 |
| 155 | Ga0207651_10100109 | 3300025960 | Bacteria | 2148 |
| 156 | Ga0207668_10070691 | 3300025972 | Bacteria | 2490 |
| 157 | Ga0207677_10025339 | 3300026023 | Bacteria | 3699 |
| 158 | Ga0207702_10015600 | 3300026078 | Bacteria | 6288 |
| 159 | Ga0207648_10078292 | 3300026089 | Bacteria | 2883 |
| 160 | Ga0207676_10014719 | 3300026095 | Bacteria | 5634 |
| 161 | Ga0207674_10016085 | 3300026116 | Bacteria | 8194 |
| 162 | Ga0207674_10019884 | 3300026116 | Bacteria | 7265 |
| 163 | Ga0207675_100004708 | 3300026118 | Bacteria | 13135 |
| 164 | Ga0207675_100128549 | 3300026118 | Bacteria | 2401 |
| 165 | Ga0207683_10019865 | 3300026121 | Bacteria | 5740 |
| 166 | Ga0207683_10045012 | 3300026121 | Bacteria | 3859 |
| 167 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 168 | Ga0209282_1000298 | 3300027666 | Bacteria | 24501 |
| 169 | Ga0265336_10000040 | 3300028666 | Bacteria | 138266 |
| 170 | Ga0307515_10000609 | 3300028794 | Bacteria | 83557 |
| 171 | Ga0307515_10001655 | 3300028794 | Bacteria | 49620 |
| 172 | Ga0307515_10090019 | 3300028794 | Bacteria | 3854 |
| 173 | Ga0265324_10002437 | 3300029957 | Bacteria | 9532 |
| 174 | Ga0307511_10027910 | 3300030521 | Bacteria | 5143 |
| 175 | Ga0316177_1207751 | 3300030731 | Bacteria | 2324 |
| 176 | Ga0314311_1032688 | 3300030733 | Bacteria | 3322 |
| 177 | Ga0316181_1070286 | 3300030744 | Bacteria | 3871 |
| 178 | Ga0265330_10008146 | 3300031235 | Bacteria | 5061 |
| 179 | Ga0265327_10000945 | 3300031251 | Bacteria | 42267 |
| 180 | Ga0265327_10005555 | 3300031251 | Bacteria | 10470 |
| 181 | Ga0307513_10031678 | 3300031456 | Bacteria | 5983 |
| 182 | Ga0307509_10039831 | 3300031507 | Bacteria | 5115 |
| 183 | Ga0307408_100078165 | 3300031548 | Bacteria | 2466 |
| 184 | Ga0307514_10011687 | 3300031649 | Bacteria | 7302 |
| 185 | Ga0265314_10005055 | 3300031711 | Bacteria | 12020 |
| 186 | Ga0265314_10009447 | 3300031711 | Bacteria | 8225 |
| 187 | Ga0307516_10000127 | 3300031730 | Bacteria | 90180 |
| 188 | Ga0307516_10000438 | 3300031730 | Bacteria | 54750 |
| 189 | Ga0307516_10003818 | 3300031730 | Bacteria | 19103 |
| 190 | Ga0307412_10017683 | 3300031911 | Bacteria | 4270 |
| 191 | Ga0307412_10103571 | 3300031911 | Bacteria | 2017 |
| 192 | Ga0307411_10086734 | 3300032005 | Bacteria | 2172 |
| 193 | Ga0307507_10025176 | 3300033179 | Bacteria | 6461 |
| 194 | Ga0373931_0000961 | 3300035691 | Bacteria | 12161 |
| 195 | Ga0395899_0025794 | 3300037312 | Bacteria | 4436 |
| 196 | Ga0395900_0000050 | 3300037418 | Bacteria | 224616 |
| 197 | Ga0395900_0024297 | 3300037418 | Bacteria | 6205 |
| 198 | Ga0395900_0036713 | 3300037418 | Bacteria | 5052 |
| 199 | Ga0395900_0117627 | 3300037418 | Bacteria | 2727 |
| 200 | Ga0395898_0004637 | 3300037466 | Bacteria | 14988 |
| 201 | Ga0395898_0017154 | 3300037466 | Bacteria | 7396 |
| 202 | Ga0395898_0023979 | 3300037466 | Bacteria | 6157 |
| 203 | Ga0395898_0053335 | 3300037466 | Bacteria | 3949 |
| 204 | Ga0395905_0053738 | 3300037471 | Bacteria | 3769 |
| 205 | Ga0395905_0067485 | 3300037471 | Bacteria | 3350 |
| 206 | Ga0395905_0070844 | 3300037471 | Bacteria | 3267 |
| 207 | Ga0395905_0077512 | 3300037471 | Bacteria | 3114 |
| 208 | Ga0395901_0001065 | 3300038443 | Bacteria | 29436 |
| 209 | Ga0395901_0016283 | 3300038443 | Bacteria | 7572 |
| 210 | Ga0395901_0037979 | 3300038443 | Bacteria | 4980 |
| 211 | Ga0436361_0437739 | 3300039447 | Bacteria | 3933 |
| 212 | Ga0436361_1206467 | 3300039447 | Bacteria | 80244 |
| 213 | Ga0439436_0005707 | 3300041404 | Bacteria | 3815 |
| 214 | Ga0439465_0004738 | 3300041413 | Bacteria | 4385 |
| 215 | Ga0439433_0001034 | 3300041999 | Bacteria | 5638 |
| 216 | Ga0439449_0000682 | 3300042007 | Bacteria | 12925 |
| 217 | Ga0439449_0002064 | 3300042007 | Bacteria | 7908 |
| 218 | Ga0439462_0004368 | 3300042015 | Bacteria | 3443 |
| 219 | Ga0439434_0001557 | 3300042435 | Bacteria | 6612 |
| 220 | Ga0439434_0006663 | 3300042435 | Bacteria | 3375 |
| 221 | Ga0439464_0011750 | 3300042439 | Bacteria | 2323 |
| 222 | Ga0450918_000266 | 3300042531 | Bacteria | 11793 |
| 223 | Ga0451577_0022279 | 3300042876 | Bacteria | 5785 |
| 224 | Ga0451577_0025241 | 3300042876 | Bacteria | 5394 |
| 225 | Ga0466969_0000008 | 3300044656 | Bacteria | 139607 |
| 226 | Ga0466972_0001150 | 3300044658 | Bacteria | 12651 |
| 227 | Ga0466965_0003338 | 3300044683 | Bacteria | 7030 |
| 228 | Ga0466966_0011822 | 3300044684 | Bacteria | 5780 |
| 229 | Ga0466971_0016545 | 3300044719 | Bacteria | 3256 |
| 230 | Ga0466970_0024282 | 3300044765 | Bacteria | 3169 |
| 231 | Ga0466959_0005783 | 3300045049 | Bacteria | 8517 |
| 232 | Ga0466959_0027222 | 3300045049 | Bacteria | 4240 |
| 233 | Ga0451576_0018434 | 3300045051 | Bacteria | 7651 |
| 234 | Ga0451576_0096009 | 3300045051 | Bacteria | 3083 |
| 235 | Ga0495639_0002239 | 3300046475 | Bacteria | 8498 |
| 236 | Ga0495639_0013358 | 3300046475 | Bacteria | 3545 |
| 237 | Ga0495585_0039558 | 3300046492 | Bacteria | 2650 |
| 238 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 239 | Ga0495606_0002732 | 3300046507 | Bacteria | 19860 |
| 240 | Ga0495668_0047957 | 3300046616 | Bacteria | 2371 |
| 241 | Ga0495625_0001236 | 3300046660 | Bacteria | 32273 |
| 242 | Ga0495625_0003970 | 3300046660 | Bacteria | 14185 |
| 243 | Ga0495649_0000548 | 3300046694 | Bacteria | 31877 |
| 244 | Ga0496100_0025814 | 3300048903 | Bacteria | 3595 |
| 245 | Ga0496101_0001647 | 3300048904 | Bacteria | 13387 |
| 246 | Ga0496102_0081494 | 3300048905 | Bacteria | 2983 |
| 247 | Ga0496103_0053003 | 3300048906 | Bacteria | 2513 |
| 248 | Ga0496104_0024430 | 3300048907 | Bacteria | 5557 |
| 249 | Ga0496105_0011915 | 3300048908 | Bacteria | 6884 |
| 250 | Ga0496107_0048755 | 3300048910 | Bacteria | 3052 |
| 251 | Ga0496110_0076278 | 3300048913 | Bacteria | 2980 |
| 252 | Ga0496118_0060248 | 3300048921 | Bacteria | 2819 |
| 253 | Ga0496121_0021731 | 3300048924 | Bacteria | 6270 |
| 254 | Ga0496122_0000324 | 3300048925 | Bacteria | 104220 |
| 255 | Ga0496123_0000160 | 3300048926 | Bacteria | 135310 |
| 256 | Ga0496124_0000487 | 3300048927 | Bacteria | 68031 |
| 257 | Ga0501034_0027893 | 3300049571 | Bacteria | 5742 |
| 258 | Ga0501043_0001042 | 3300049579 | Bacteria | 24366 |
| 259 | Ga0501046_0000137 | 3300049580 | Bacteria | 78496 |
| 260 | Ga0501047_0001319 | 3300049581 | Bacteria | 24366 |
| 261 | Ga0501048_0008861 | 3300049582 | Bacteria | 7575 |
| 262 | Ga0501035_0011020 | 3300049822 | Bacteria | 8371 |
| 263 | Ga0501045_0009289 | 3300049824 | Bacteria | 6878 |
| 264 | nmdc:mga00v17_46391_c1 | 3300050491 | Bacteria | 2629 |
| 265 | nmdc:mga0yw44_10136_c1 | 3300050492 | Bacteria | 4801 |
| 266 | nmdc:mga0yw44_38012_c1 | 3300050492 | Bacteria | 2845 |
| 267 | nmdc:mga0yw44_8149_c1 | 3300050492 | Bacteria | 5205 |
| 268 | nmdc:mga0k408_2087_c1 | 3300050493 | Bacteria | 10691 |
| 269 | nmdc:mga0k408_21637_c1 | 3300050493 | Bacteria | 3614 |
| 270 | nmdc:mga0k408_9610_c3 | 3300050493 | Bacteria | 2609 |
| 271 | Ga0500635_0000113 | 3300053080 | Bacteria | 49202 |
| 272 | Ga0500578_0000079 | 3300053086 | Bacteria | 107137 |
| 273 | Ga0466962_0003243 | 3300061719 | Bacteria | 7731 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003784 | Ga0055534_1001997 | Ga0055534_10019976 | 476 |
| 2 | 3300005457 | Ga0070662_100063756 | Ga0070662_1000637562 | 517 |
| 3 | 3300025933 | Ga0207706_10003127 | Ga0207706_100031279 | 517 |
| 4 | 3300005564 | Ga0070664_100015776 | Ga0070664_1000157763 | 541 |
| 5 | 3300003791 | Ga0055530_10002840 | Ga0055530_100028405 | 542 |
| 6 | 3300003792 | Ga0055540_1000001 | Ga0055540_1000001376 | 542 |
| 7 | 3300003794 | Ga0055531_10003946 | Ga0055531_100039465 | 542 |
| 8 | 3300025298 | Ga0209050_1001120 | Ga0209050_10011204 | 542 |
| 9 | 3300025303 | Ga0209051_1000018 | Ga0209051_100001878 | 542 |
| 10 | 3300025304 | Ga0209257_1000324 | Ga0209257_100032478 | 542 |
| 11 | 3300005344 | Ga0070661_100001910 | Ga0070661_1000019103 | 543 |
| 12 | 3300005366 | Ga0070659_100000260 | Ga0070659_10000026032 | 543 |
| 13 | 3300005564 | Ga0070664_100006437 | Ga0070664_1000064376 | 543 |
| 14 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001391 | 543 |
| 15 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015479 | 543 |
| 16 | 3300025920 | Ga0207649_10000515 | Ga0207649_100005153 | 543 |
| 17 | 3300025932 | Ga0207690_10000906 | Ga0207690_1000090611 | 543 |
| 18 | 3300025945 | Ga0207679_10000047 | Ga0207679_10000047103 | 543 |
| 19 | 3300027111 | Ga0209281_1000151 | Ga0209281_100015174 | 543 |
| 20 | 3300042531 | Ga0450918_000266 | Ga0450918_000266_88_1821 | 544 |
| 21 | 3300014497 | Ga0182008_10000191 | Ga0182008_1000019112 | 553 |
| 22 | 3300021361 | Ga0213872_10000132 | Ga0213872_1000013243 | 554 |
| 23 | 3300039447 | Ga0436361_1206467 | Ga0436361_1206467_21448_23133 | 554 |
| 24 | 3300005336 | Ga0070680_100109233 | Ga0070680_1001092332 | 557 |
| 25 | 3300005339 | Ga0070660_100017577 | Ga0070660_1000175773 | 557 |
| 26 | 3300005563 | Ga0068855_100043313 | Ga0068855_1000433133 | 557 |
| 27 | 3300009093 | Ga0105240_10015617 | Ga0105240_100156176 | 557 |
| 28 | 3300009551 | Ga0105238_10083758 | Ga0105238_100837582 | 557 |
| 29 | 3300025913 | Ga0207695_10068359 | Ga0207695_100683592 | 557 |
| 30 | 3300025924 | Ga0207694_10051905 | Ga0207694_100519051 | 557 |
| 31 | 3300025949 | Ga0207667_10063994 | Ga0207667_100639943 | 557 |
| 32 | 3300042876 | Ga0451577_0025241 | Ga0451577_0025241_196_1938 | 557 |
| 33 | 3300006048 | Ga0075363_100016515 | Ga0075363_1000165153 | 558 |
| 34 | 3300006195 | Ga0075366_10007913 | Ga0075366_100079134 | 558 |
| 35 | 3300006353 | Ga0075370_10032012 | Ga0075370_100320123 | 558 |
| 36 | 3300050493 | nmdc:mga0k408_21637_c1 | nmdc:mga0k408_21637_c1_1719_3551 | 558 |
| 37 | 3300037418 | Ga0395900_0000050 | Ga0395900_0000050_7463_9229 | 560 |
| 38 | 3300042007 | Ga0439449_0000682 | Ga0439449_0000682_8547_10277 | 561 |
| 39 | 3300042015 | Ga0439462_0004368 | Ga0439462_0004368_205_1935 | 561 |
| 40 | 3300003794 | Ga0055531_10000452 | Ga0055531_100004524 | 562 |
| 41 | 3300003794 | Ga0055531_10008909 | Ga0055531_100089092 | 562 |
| 42 | 3300005563 | Ga0068855_100254134 | Ga0068855_1002541341 | 562 |
| 43 | 3300006038 | Ga0075365_10090773 | Ga0075365_100907732 | 562 |
| 44 | 3300006846 | Ga0075430_100035532 | Ga0075430_1000355323 | 562 |
| 45 | 3300025303 | Ga0209051_1000114 | Ga0209051_100011492 | 562 |
| 46 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015719 | 562 |
| 47 | 3300033179 | Ga0307507_10025176 | Ga0307507_100251762 | 562 |
| 48 | 3300037312 | Ga0395899_0025794 | Ga0395899_0025794_1499_3256 | 562 |
| 49 | 3300037418 | Ga0395900_0024297 | Ga0395900_0024297_2804_4561 | 562 |
| 50 | 3300037418 | Ga0395900_0036713 | Ga0395900_0036713_2057_3817 | 562 |
| 51 | 3300037466 | Ga0395898_0004637 | Ga0395898_0004637_2237_3991 | 562 |
| 52 | 3300037466 | Ga0395898_0023979 | Ga0395898_0023979_3507_5267 | 562 |
| 53 | 3300037471 | Ga0395905_0067485 | Ga0395905_0067485_142_1899 | 562 |
| 54 | 3300038443 | Ga0395901_0016283 | Ga0395901_0016283_4485_6245 | 562 |
| 55 | 3300038443 | Ga0395901_0037979 | Ga0395901_0037979_785_2539 | 562 |
| 56 | 3300042439 | Ga0439464_0011750 | Ga0439464_0011750_291_2045 | 562 |
| 57 | 3300042876 | Ga0451577_0022279 | Ga0451577_0022279_3740_5503 | 562 |
| 58 | 3300045051 | Ga0451576_0018434 | Ga0451576_0018434_5793_7547 | 562 |
| 59 | 3300045051 | Ga0451576_0096009 | Ga0451576_0096009_895_2658 | 562 |
| 60 | 3300050492 | nmdc:mga0yw44_38012_c1 | nmdc:mga0yw44_38012_c1_297_2048 | 562 |
| 61 | iso_pu_bacteria | 2881101125 | 2881104965 | 562 |
| 62 | 3300014969 | Ga0157376_10005532 | Ga0157376_100055324 | 563 |
| 63 | 3300026023 | Ga0207677_10025339 | Ga0207677_100253393 | 563 |
| 64 | 3300031235 | Ga0265330_10008146 | Ga0265330_100081462 | 563 |
| 65 | 3300031711 | Ga0265314_10005055 | Ga0265314_100050557 | 563 |
| 66 | 3300031711 | Ga0265314_10009447 | Ga0265314_100094478 | 563 |
| 67 | 3300037418 | Ga0395900_0117627 | Ga0395900_0117627_553_2310 | 563 |
| 68 | 3300037471 | Ga0395905_0070844 | Ga0395905_0070844_1436_3193 | 563 |
| 69 | 3300049571 | Ga0501034_0027893 | Ga0501034_0027893_28_1788 | 563 |
| 70 | 3300049822 | Ga0501035_0011020 | Ga0501035_0011020_5014_6774 | 563 |
| 71 | 3300005335 | Ga0070666_10014381 | Ga0070666_100143814 | 564 |
| 72 | 3300005338 | Ga0068868_100002288 | Ga0068868_10000228811 | 564 |
| 73 | 3300005354 | Ga0070675_100006356 | Ga0070675_1000063567 | 564 |
| 74 | 3300005841 | Ga0068863_100053903 | Ga0068863_1000539032 | 564 |
| 75 | 3300005842 | Ga0068858_100005764 | Ga0068858_1000057645 | 564 |
| 76 | 3300006038 | Ga0075365_10007414 | Ga0075365_100074143 | 564 |
| 77 | 3300006237 | Ga0097621_100060366 | Ga0097621_1000603662 | 564 |
| 78 | 3300009177 | Ga0105248_10089645 | Ga0105248_100896453 | 564 |
| 79 | 3300013296 | Ga0157374_10049480 | Ga0157374_100494802 | 564 |
| 80 | 3300014325 | Ga0163163_10033316 | Ga0163163_100333163 | 564 |
| 81 | 3300025907 | Ga0207645_10021997 | Ga0207645_100219971 | 564 |
| 82 | 3300025923 | Ga0207681_10002439 | Ga0207681_1000243910 | 564 |
| 83 | 3300025960 | Ga0207651_10100109 | Ga0207651_101001092 | 564 |
| 84 | 3300026089 | Ga0207648_10078292 | Ga0207648_100782922 | 564 |
| 85 | 3300026095 | Ga0207676_10014719 | Ga0207676_100147194 | 564 |
| 86 | 3300026121 | Ga0207683_10019865 | Ga0207683_100198655 | 564 |
| 87 | 3300048925 | Ga0496122_0000324 | Ga0496122_0000324_74408_76198 | 564 |
| 88 | 3300048926 | Ga0496123_0000160 | Ga0496123_0000160_65956_67746 | 564 |
| 89 | 3300050492 | nmdc:mga0yw44_8149_c1 | nmdc:mga0yw44_8149_c1_1105_2889 | 564 |
| 90 | iso_pu_bacteria | 2842747753 | 2842752684 | 564 |
| 91 | 3300003187 | JGI25151J46595_10001446 | JGI25151J46595_100014469 | 565 |
| 92 | 3300003187 | JGI25151J46595_10004971 | JGI25151J46595_100049716 | 565 |
| 93 | 3300003578 | Ga0006562J51391_1045467 | Ga0006562J51391_10454673 | 565 |
| 94 | 3300003773 | Ga0055537_1000618 | Ga0055537_10006182 | 565 |
| 95 | 3300003781 | Ga0055536_1009899 | Ga0055536_10098992 | 565 |
| 96 | 3300003784 | Ga0055534_1001207 | Ga0055534_10012072 | 565 |
| 97 | 3300003790 | Ga0055528_1015294 | Ga0055528_10152942 | 565 |
| 98 | 3300005288 | Ga0065714_10008154 | Ga0065714_100081543 | 565 |
| 99 | 3300005367 | Ga0070667_100015275 | Ga0070667_1000152754 | 565 |
| 100 | 3300005578 | Ga0068854_100049541 | Ga0068854_1000495413 | 565 |
| 101 | 3300005618 | Ga0068864_100005634 | Ga0068864_1000056349 | 565 |
| 102 | 3300006038 | Ga0075365_10001995 | Ga0075365_100019959 | 565 |
| 103 | 3300006048 | Ga0075363_100004145 | Ga0075363_1000041456 | 565 |
| 104 | 3300006051 | Ga0075364_10063259 | Ga0075364_100632592 | 565 |
| 105 | 3300006058 | Ga0075432_10010992 | Ga0075432_100109922 | 565 |
| 106 | 3300006353 | Ga0075370_10022511 | Ga0075370_100225113 | 565 |
| 107 | 3300009036 | Ga0105244_10034401 | Ga0105244_100344012 | 565 |
| 108 | 3300009551 | Ga0105238_10091626 | Ga0105238_100916262 | 565 |
| 109 | 3300012502 | Ga0157347_1000259 | Ga0157347_10002592 | 565 |
| 110 | 3300013100 | Ga0157373_10003982 | Ga0157373_100039829 | 565 |
| 111 | 3300013306 | Ga0163162_10021978 | Ga0163162_100219783 | 565 |
| 112 | 3300013308 | Ga0157375_10059326 | Ga0157375_100593262 | 565 |
| 113 | 3300014497 | Ga0182008_10006656 | Ga0182008_100066563 | 565 |
| 114 | 3300015262 | Ga0182007_10001944 | Ga0182007_1000194410 | 565 |
| 115 | 3300015262 | Ga0182007_10002842 | Ga0182007_100028424 | 565 |
| 116 | 3300015683 | Ga0183362_10005 | Ga0183362_10005154 | 565 |
| 117 | 3300017792 | Ga0163161_10000244 | Ga0163161_1000024439 | 565 |
| 118 | 3300017792 | Ga0163161_10020769 | Ga0163161_100207693 | 565 |
| 119 | 3300017792 | Ga0163161_10057603 | Ga0163161_100576032 | 565 |
| 120 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020108 | 565 |
| 121 | 3300025273 | Ga0209673_1000072 | Ga0209673_100007292 | 565 |
| 122 | 3300025273 | Ga0209673_1021343 | Ga0209673_10213432 | 565 |
| 123 | 3300025291 | Ga0209675_1000014 | Ga0209675_100001496 | 565 |
| 124 | 3300025292 | Ga0209676_1020063 | Ga0209676_10200632 | 565 |
| 125 | 3300025294 | Ga0209025_1000286 | Ga0209025_10002863 | 565 |
| 126 | 3300025303 | Ga0209051_1002160 | Ga0209051_100216013 | 565 |
| 127 | 3300025728 | Ga0207655_1001961 | Ga0207655_100196116 | 565 |
| 128 | 3300025932 | Ga0207690_10033812 | Ga0207690_100338121 | 565 |
| 129 | 3300025935 | Ga0207709_10002379 | Ga0207709_100023799 | 565 |
| 130 | 3300025945 | Ga0207679_10038702 | Ga0207679_100387022 | 565 |
| 131 | 3300025949 | Ga0207667_10039365 | Ga0207667_100393653 | 565 |
| 132 | 3300026116 | Ga0207674_10016085 | Ga0207674_100160858 | 565 |
| 133 | 3300027666 | Ga0209282_1000298 | Ga0209282_100029824 | 565 |
| 134 | 3300030731 | Ga0316177_1207751 | Ga0316177_12077512 | 565 |
| 135 | 3300030733 | Ga0314311_1032688 | Ga0314311_10326882 | 565 |
| 136 | 3300030744 | Ga0316181_1070286 | Ga0316181_10702863 | 565 |
| 137 | 3300031251 | Ga0265327_10000945 | Ga0265327_100009454 | 565 |
| 138 | 3300031251 | Ga0265327_10005555 | Ga0265327_1000555510 | 565 |
| 139 | 3300031649 | Ga0307514_10011687 | Ga0307514_100116877 | 565 |
| 140 | 3300031911 | Ga0307412_10017683 | Ga0307412_100176833 | 565 |
| 141 | 3300031911 | Ga0307412_10103571 | Ga0307412_101035711 | 565 |
| 142 | 3300032005 | Ga0307411_10086734 | Ga0307411_100867342 | 565 |
| 143 | 3300041404 | Ga0439436_0005707 | Ga0439436_0005707_708_2558 | 565 |
| 144 | 3300041413 | Ga0439465_0004738 | Ga0439465_0004738_1891_3684 | 565 |
| 145 | 3300041999 | Ga0439433_0001034 | Ga0439433_0001034_3827_5620 | 565 |
| 146 | 3300042007 | Ga0439449_0002064 | Ga0439449_0002064_301_2094 | 565 |
| 147 | 3300042435 | Ga0439434_0001557 | Ga0439434_0001557_1771_3564 | 565 |
| 148 | 3300042435 | Ga0439434_0006663 | Ga0439434_0006663_719_2569 | 565 |
| 149 | 3300046475 | Ga0495639_0002239 | Ga0495639_0002239_4810_6603 | 565 |
| 150 | 3300046660 | Ga0495625_0001236 | Ga0495625_0001236_8944_10794 | 565 |
| 151 | 3300048903 | Ga0496100_0025814 | Ga0496100_0025814_941_2734 | 565 |
| 152 | 3300048904 | Ga0496101_0001647 | Ga0496101_0001647_4098_5891 | 565 |
| 153 | 3300048905 | Ga0496102_0081494 | Ga0496102_0081494_304_2097 | 565 |
| 154 | 3300048906 | Ga0496103_0053003 | Ga0496103_0053003_267_2060 | 565 |
| 155 | 3300048907 | Ga0496104_0024430 | Ga0496104_0024430_3714_5507 | 565 |
| 156 | 3300048908 | Ga0496105_0011915 | Ga0496105_0011915_288_2081 | 565 |
| 157 | 3300048910 | Ga0496107_0048755 | Ga0496107_0048755_891_2684 | 565 |
| 158 | 3300048913 | Ga0496110_0076278 | Ga0496110_0076278_883_2676 | 565 |
| 159 | 3300048921 | Ga0496118_0060248 | Ga0496118_0060248_575_2401 | 565 |
| 160 | 3300050491 | nmdc:mga00v17_46391_c1 | nmdc:mga00v17_46391_c1_382_2232 | 565 |
| 161 | 3300050492 | nmdc:mga0yw44_10136_c1 | nmdc:mga0yw44_10136_c1_491_2341 | 565 |
| 162 | 3300050493 | nmdc:mga0k408_2087_c1 | nmdc:mga0k408_2087_c1_67_1917 | 565 |
| 163 | iso_pu_bacteria | 2513020051 | 2513226970 | 565 |
| 164 | iso_pu_bacteria | 2643221628 | 2644164052 | 565 |
| 165 | iso_pu_bacteria | 2738541277 | 2738721466 | 565 |
| 166 | iso_pu_bacteria | 2738543013 | 2739249673 | 565 |
| 167 | iso_pu_bacteria | 2738543019 | 2739281135 | 565 |
| 168 | iso_pu_bacteria | 2842677519 | 2842678661 | 565 |
| 169 | iso_pu_bacteria | 2842733646 | 2842733924 | 565 |
| 170 | iso_pu_bacteria | 2885192300 | 2885193183 | 565 |
| 171 | iso_pu_bacteria | 2904541872 | 2904547143 | 565 |
| 172 | iso_pu_bacteria | 2919462493 | 2919463645 | 565 |
| 173 | iso_pu_bacteria | 2929160207 | 2929165697 | 565 |
| 174 | iso_pu_bacteria | 2945909444 | 2945909649 | 565 |
| 175 | iso_pu_bacteria | 2945945610 | 2945945735 | 565 |
| 176 | iso_pu_bacteria | 2945972063 | 2945975390 | 565 |
| 177 | iso_pu_bacteria | 2945984333 | 2945988377 | 565 |
| 178 | 3300031730 | Ga0307516_10000127 | Ga0307516_1000012745 | 566 |
| 179 | iso_pu_bacteria | 2928115317 | 2928117940 | 567 |
| 180 | 3300031730 | Ga0307516_10000438 | Ga0307516_1000043829 | 570 |
| 181 | iso_pu_bacteria | 2643221644 | 2644246581 | 570 |
| 182 | 3300031548 | Ga0307408_100078165 | Ga0307408_1000781652 | 572 |
| 183 | 3300014969 | Ga0157376_10023553 | Ga0157376_100235534 | 574 |
| 184 | 3300048927 | Ga0496124_0000487 | Ga0496124_0000487_47105_48844 | 574 |
| 185 | iso_pu_bacteria | 2585428062 | 2587754167 | 574 |
| 186 | 3300028794 | Ga0307515_10090019 | Ga0307515_100900194 | 575 |
| 187 | 3300037466 | Ga0395898_0017154 | Ga0395898_0017154_5238_7004 | 575 |
| 188 | 3300037471 | Ga0395905_0053738 | Ga0395905_0053738_195_1934 | 575 |
| 189 | 3300037471 | Ga0395905_0077512 | Ga0395905_0077512_1008_2753 | 575 |
| 190 | 3300044656 | Ga0466969_0000008 | Ga0466969_0000008_73877_75646 | 575 |
| 191 | 3300044658 | Ga0466972_0001150 | Ga0466972_0001150_4781_6538 | 575 |
| 192 | 3300045049 | Ga0466959_0005783 | Ga0466959_0005783_3762_5531 | 575 |
| 193 | 3300048924 | Ga0496121_0021731 | Ga0496121_0021731_1164_2984 | 575 |
| 194 | 3300003215 | JGI25153J46596_10000674 | JGI25153J46596_1000067414 | 577 |
| 195 | 3300003771 | Ga0055526_1003927 | Ga0055526_10039272 | 577 |
| 196 | 3300005354 | Ga0070675_100044369 | Ga0070675_1000443693 | 577 |
| 197 | 3300005456 | Ga0070678_100028844 | Ga0070678_1000288442 | 577 |
| 198 | 3300005459 | Ga0068867_100021948 | Ga0068867_1000219483 | 577 |
| 199 | 3300005543 | Ga0070672_100030178 | Ga0070672_1000301782 | 577 |
| 200 | 3300005844 | Ga0068862_100043654 | Ga0068862_1000436542 | 577 |
| 201 | 3300009553 | Ga0105249_10018801 | Ga0105249_100188015 | 577 |
| 202 | 3300025245 | Ga0207425_1001028 | Ga0207425_10010282 | 577 |
| 203 | 3300025258 | Ga0209129_1000062 | Ga0209129_1000062142 | 577 |
| 204 | 3300025295 | Ga0209564_1000176 | Ga0209564_100017662 | 577 |
| 205 | 3300025297 | Ga0209758_1000129 | Ga0209758_100012927 | 577 |
| 206 | 3300025893 | Ga0207682_10022960 | Ga0207682_100229602 | 577 |
| 207 | 3300025940 | Ga0207691_10034186 | Ga0207691_100341862 | 577 |
| 208 | 3300025960 | Ga0207651_10060455 | Ga0207651_100604552 | 577 |
| 209 | 3300025972 | Ga0207668_10070691 | Ga0207668_100706912 | 577 |
| 210 | 3300026118 | Ga0207675_100004708 | Ga0207675_1000047085 | 577 |
| 211 | 3300026121 | Ga0207683_10045012 | Ga0207683_100450122 | 577 |
| 212 | 3300003215 | JGI25153J46596_10006142 | JGI25153J46596_100061425 | 578 |
| 213 | 3300025297 | Ga0209758_1000327 | Ga0209758_100032724 | 578 |
| 214 | 3300028794 | Ga0307515_10000609 | Ga0307515_1000060951 | 578 |
| 215 | 3300028794 | Ga0307515_10001655 | Ga0307515_1000165540 | 578 |
| 216 | 3300031456 | Ga0307513_10031678 | Ga0307513_100316783 | 578 |
| 217 | 3300031507 | Ga0307509_10039831 | Ga0307509_100398313 | 578 |
| 218 | 3300046660 | Ga0495625_0003970 | Ga0495625_0003970_9482_11227 | 578 |
| 219 | 3300049579 | Ga0501043_0001042 | Ga0501043_0001042_2418_4217 | 578 |
| 220 | 3300049580 | Ga0501046_0000137 | Ga0501046_0000137_74325_76124 | 578 |
| 221 | 3300049581 | Ga0501047_0001319 | Ga0501047_0001319_2418_4217 | 578 |
| 222 | 3300049582 | Ga0501048_0008861 | Ga0501048_0008861_355_2154 | 578 |
| 223 | 3300049824 | Ga0501045_0009289 | Ga0501045_0009289_4655_6454 | 578 |
| 224 | 3300053080 | Ga0500635_0000113 | Ga0500635_0000113_226_2007 | 578 |
| 225 | 3300053086 | Ga0500578_0000079 | Ga0500578_0000079_80094_81881 | 578 |
| 226 | 3300009093 | Ga0105240_10002814 | Ga0105240_1000281410 | 580 |
| 227 | 3300009545 | Ga0105237_10002372 | Ga0105237_1000237211 | 580 |
| 228 | 3300010375 | Ga0105239_10001168 | Ga0105239_1000116818 | 580 |
| 229 | 3300025913 | Ga0207695_10005159 | Ga0207695_100051597 | 580 |
| 230 | 3300025914 | Ga0207671_10006688 | Ga0207671_100066888 | 580 |
| 231 | 3300030521 | Ga0307511_10027910 | Ga0307511_100279102 | 582 |
| 232 | 3300046475 | Ga0495639_0013358 | Ga0495639_0013358_408_2195 | 582 |
| 233 | 3300046506 | Ga0495583_0000046 | Ga0495583_0000046_91923_93716 | 582 |
| 234 | 3300046507 | Ga0495606_0002732 | Ga0495606_0002732_9611_11404 | 582 |
| 235 | 3300046616 | Ga0495668_0047957 | Ga0495668_0047957_194_1987 | 582 |
| 236 | 3300046694 | Ga0495649_0000548 | Ga0495649_0000548_4334_6127 | 582 |
| 237 | 3300003752 | Ga0055539_1000382 | Ga0055539_10003823 | 583 |
| 238 | 3300003756 | Ga0055533_1000033 | Ga0055533_1000033115 | 583 |
| 239 | 3300025226 | Ga0209674_100064 | Ga0209674_100064134 | 583 |
| 240 | 3300025230 | Ga0209563_100099 | Ga0209563_100099134 | 583 |
| 241 | 3300025253 | Ga0209677_100175 | Ga0209677_1001753 | 583 |
| 242 | 3300031730 | Ga0307516_10003818 | Ga0307516_1000381812 | 584 |
| 243 | 3300044683 | Ga0466965_0003338 | Ga0466965_0003338_4891_6651 | 586 |
| 244 | 3300044684 | Ga0466966_0011822 | Ga0466966_0011822_1976_3736 | 586 |
| 245 | 3300044719 | Ga0466971_0016545 | Ga0466971_0016545_251_2011 | 586 |
| 246 | 3300044765 | Ga0466970_0024282 | Ga0466970_0024282_1205_2965 | 586 |
| 247 | 3300045049 | Ga0466959_0027222 | Ga0466959_0027222_1981_3741 | 586 |
| 248 | 3300061719 | Ga0466962_0003243 | Ga0466962_0003243_4161_5921 | 586 |
| 249 | 3300026078 | Ga0207702_10015600 | Ga0207702_100156002 | 588 |
| 250 | 3300003761 | Ga0055535_1001531 | Ga0055535_10015317 | 589 |
| 251 | 3300003763 | Ga0055529_1000338 | Ga0055529_100033849 | 589 |
| 252 | 3300025242 | Ga0209258_100262 | Ga0209258_10026291 | 589 |
| 253 | 3300025256 | Ga0209759_1001440 | Ga0209759_10014403 | 589 |
| 254 | 3300025272 | Ga0209455_1000191 | Ga0209455_100019191 | 589 |
| 255 | 3300005364 | Ga0070673_100002408 | Ga0070673_1000024086 | 590 |
| 256 | 3300025960 | Ga0207651_10058493 | Ga0207651_100584932 | 590 |
| 257 | 3300021361 | Ga0213872_10012173 | Ga0213872_100121733 | 591 |
| 258 | 3300025303 | Ga0209051_1003036 | Ga0209051_10030366 | 591 |
| 259 | 3300039447 | Ga0436361_0437739 | Ga0436361_0437739_1773_3551 | 591 |
| 260 | 3300005327 | Ga0070658_10057463 | Ga0070658_100574632 | 592 |
| 261 | 3300028666 | Ga0265336_10000040 | Ga0265336_100000402 | 592 |
| 262 | 3300029957 | Ga0265324_10002437 | Ga0265324_100024372 | 592 |
| 263 | 3300035691 | Ga0373931_0000961 | Ga0373931_0000961_4871_6652 | 593 |
| 264 | 3300046492 | Ga0495585_0039558 | Ga0495585_0039558_69_1850 | 593 |
| 265 | 3300002705 | JGI25156J39149_1001228 | JGI25156J39149_10012284 | 595 |
| 266 | 3300002738 | JGI25154J39366_1003095 | JGI25154J39366_10030953 | 595 |
| 267 | 3300002741 | JGI25157J39369_1000021 | JGI25157J39369_100002146 | 595 |
| 268 | 3300003752 | Ga0055539_1000992 | Ga0055539_10009922 | 595 |
| 269 | 3300005366 | Ga0070659_100028708 | Ga0070659_1000287083 | 595 |
| 270 | 3300005563 | Ga0068855_100032125 | Ga0068855_1000321254 | 595 |
| 271 | 3300005577 | Ga0068857_100025084 | Ga0068857_1000250843 | 595 |
| 272 | 3300005578 | Ga0068854_100012982 | Ga0068854_1000129824 | 595 |
| 273 | 3300005719 | Ga0068861_100084174 | Ga0068861_1000841742 | 595 |
| 274 | 3300006195 | Ga0075366_10022469 | Ga0075366_100224692 | 595 |
| 275 | 3300009093 | Ga0105240_10042736 | Ga0105240_100427362 | 595 |
| 276 | 3300009545 | Ga0105237_10096073 | Ga0105237_100960732 | 595 |
| 277 | 3300009551 | Ga0105238_10109670 | Ga0105238_101096703 | 595 |
| 278 | 3300025231 | Ga0207427_100460 | Ga0207427_10046017 | 595 |
| 279 | 3300025242 | Ga0209258_100767 | Ga0209258_1007673 | 595 |
| 280 | 3300025246 | Ga0209646_1000060 | Ga0209646_1000060111 | 595 |
| 281 | 3300025250 | Ga0209026_1000049 | Ga0209026_1000049109 | 595 |
| 282 | 3300025253 | Ga0209677_102998 | Ga0209677_1029983 | 595 |
| 283 | 3300025256 | Ga0209759_1000069 | Ga0209759_1000069109 | 595 |
| 284 | 3300025913 | Ga0207695_10027651 | Ga0207695_100276514 | 595 |
| 285 | 3300025919 | Ga0207657_10068675 | Ga0207657_100686752 | 595 |
| 286 | 3300025924 | Ga0207694_10036301 | Ga0207694_100363014 | 595 |
| 287 | 3300025932 | Ga0207690_10011161 | Ga0207690_100111615 | 595 |
| 288 | 3300025949 | Ga0207667_10014707 | Ga0207667_100147073 | 595 |
| 289 | 3300026116 | Ga0207674_10019884 | Ga0207674_100198844 | 595 |
| 290 | 3300026118 | Ga0207675_100128549 | Ga0207675_1001285492 | 595 |
| 291 | 3300037466 | Ga0395898_0053335 | Ga0395898_0053335_1434_3221 | 595 |
| 292 | 3300038443 | Ga0395901_0001065 | Ga0395901_0001065_24636_26423 | 595 |
| 293 | 3300050493 | nmdc:mga0k408_9610_c3 | nmdc:mga0k408_9610_c3_576_2363 | 595 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fgm-assembly1.cif.gz_A | crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. | 0.8956 | 1 | 593 |
| 4fgm-assembly1.cif.gz_A | crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. | 0.8913 | 1 | 593 |
| 5wyn-assembly1.cif.gz_A | htra2 pathogenic mutant | 0.8685 | 486 | 560 |
| 4a8d-assembly1.cif.gz_A | degp dodecamer with bound omp | 0.8666 | 485 | 559 |
| 1lcy-assembly1.cif.gz_A | crystal structure of the mitochondrial serine protease htra2 | 0.8642 | 497 | 562 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fgmA02 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.9256 | 186 | 460 | 1.10.390.10 |
| 4fgmA02 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.9223 | 186 | 460 | 1.10.390.10 |
| af_F1QL69_2_87_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8664 | 497 | 563 | 2.30.42.10 |
| af_Q9VFJ3_320_421_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8628 | 497 | 563 | 2.30.42.10 |
| af_Q4D0I1_345_430_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.8626 | 485 | 536 | 2.30.42.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536VFM4-F1-model_v4 | M61 family metallopeptidase | 0.9505 | 167 | 369 |
|
| AF-A0A522BYE5-F1-model_v4 | M61 family peptidase | 0.9463 | 1 | 351 |
|
| AF-A0A519YXZ2-F1-model_v4 | Peptidase M61 | 0.9416 | 1 | 262 |
|
| AF-A0A3C1SZ38-F1-model_v4 | Peptidase M61 | 0.939 | 249 | 456 |
|
| AF-A0A519YXZ2-F1-model_v4 | Peptidase M61 | 0.9379 | 1 | 262 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar