F391277

General Info

Members Datasets Scaffolds Average Seq Length
293 213 273 590

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10004971|JGI25151J46595_100049716
Length 624
Sequence MATKSPSRRAAATPAAVAAPGVHYRVECADLHARLFEVTLTIDRPAAEQLLTLPVWIPGSYLVREFAKNLQGLQASQGRRKAPVLTQLDKCSWRVECTAGQPLVLRYKVCAYDNSVRTAWLDAERGFFNGTSLCLRVEGQTDAPHALEIVAPAASALPEGAAPWSCATALPPLKTDRHGFGRYLAADYDELADSPVELGAFWSGEFEAGGVPHRFVVAGAAASFDGERLLADTKAICDAEMRFWHGDKVGKRGGPKPPIDRYVFMLNAVDDGYGGLEHRHSTALICNRRDLPQLGMKKAGDGYVTLLGLISHEYFHTWNVKRLRPAEFARYDYGRENYTRLLWFFEGFTSYYDDLLLRRAGLIDDAAYLRLVNKTINQVQQTPGRQVQSVADASFDAWVKYYRQDEQTPNGTVSYYTKGALVALCLDLKLRAEGRGSLDDAMRHLWSASGGGPVSEADIAAALEAAGGRSYAAELAAWVHSTAELPLSELLRLHGVAALDDPSQPAQTLGLRVAESGGSVQVKVVLRGGAAEKAGFAAGDEWIGIELPAAGRKPAQGWRIGRLDDLALYLGAGKRCTALVARDRKLVKLPLVLPTGVTTWRLLAQDTGRVSKWLAPVAIAATKA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
4 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
5 2738541277 Variovorax sp. GV051 Isolate Unclassified
6 2738543013 Variovorax sp. BT01 Isolate Unclassified
7 2738543019 Variovorax sp. GV040 Isolate Unclassified
8 2842677519 Variovorax sp. R-72495 Isolate Unclassified
9 2842733646 Variovorax sp. R-72446 Isolate Unclassified
10 2842747753 Variovorax sp. R-72060 Isolate Unclassified
11 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
12 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
13 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
14 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
15 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
16 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
17 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
18 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
19 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
20 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
144 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.83
Metatranscriptomes 0.34
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.53
Nodule 1.02
Rhizoplane 2.73
Rhizosphere 62.46
Stem 0
Stem Tuber 0
Unclassified 11.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001228 3300002705 Bacteria 11260
2 JGI25154J39366_1003095 3300002738 Bacteria 3733
3 JGI25157J39369_1000021 3300002741 Bacteria 163907
4 JGI25151J46595_10001446 3300003187 Bacteria 16098
5 JGI25151J46595_10004971 3300003187 Bacteria 6931
6 JGI25153J46596_10000674 3300003215 Bacteria 20875
7 JGI25153J46596_10006142 3300003215 Bacteria 6157
8 Ga0006562J51391_1045467 3300003578 Bacteria 6752
9 Ga0055539_1000382 3300003752 Bacteria 18078
10 Ga0055539_1000992 3300003752 Bacteria 6189
11 Ga0055533_1000033 3300003756 Bacteria 265716
12 Ga0055535_1001531 3300003761 Bacteria 11369
13 Ga0055529_1000338 3300003763 Bacteria 52417
14 Ga0055526_1003927 3300003771 Bacteria 9181
15 Ga0055537_1000618 3300003773 Bacteria 19474
16 Ga0055536_1009899 3300003781 Bacteria 3870
17 Ga0055534_1001207 3300003784 Bacteria 10825
18 Ga0055534_1001997 3300003784 Bacteria 7436
19 Ga0055528_1015294 3300003790 Bacteria 2781
20 Ga0055530_10002840 3300003791 Bacteria 10590
21 Ga0055540_1000001 3300003792 Bacteria 466834
22 Ga0055531_10000452 3300003794 Bacteria 38120
23 Ga0055531_10003946 3300003794 Bacteria 9210
24 Ga0055531_10008909 3300003794 Bacteria 5207
25 Ga0065714_10008154 3300005288 Bacteria 4219
26 Ga0070658_10057463 3300005327 Bacteria 3165
27 Ga0070666_10014381 3300005335 Bacteria 5038
28 Ga0070680_100109233 3300005336 Bacteria 2301
29 Ga0068868_100002288 3300005338 Bacteria 13244
30 Ga0070660_100017577 3300005339 Bacteria 5213
31 Ga0070661_100001910 3300005344 Bacteria 14436
32 Ga0070675_100006356 3300005354 Bacteria 9073
33 Ga0070675_100044369 3300005354 Bacteria 3636
34 Ga0070673_100002408 3300005364 Bacteria 11381
35 Ga0070659_100000260 3300005366 Bacteria 41588
36 Ga0070659_100028708 3300005366 Bacteria 4298
37 Ga0070667_100015275 3300005367 Bacteria 6346
38 Ga0070678_100028844 3300005456 Bacteria 3791
39 Ga0070662_100063756 3300005457 Bacteria 2696
40 Ga0068867_100021948 3300005459 Bacteria 4559
41 Ga0070672_100030178 3300005543 Bacteria 4071
42 Ga0068855_100032125 3300005563 Bacteria 6267
43 Ga0068855_100043313 3300005563 Bacteria 5332
44 Ga0068855_100254134 3300005563 Bacteria 1960
45 Ga0070664_100006437 3300005564 Bacteria 9475
46 Ga0070664_100015776 3300005564 Bacteria 6182
47 Ga0068857_100025084 3300005577 Bacteria 5251
48 Ga0068854_100012982 3300005578 Bacteria 5458
49 Ga0068854_100049541 3300005578 Bacteria 3000
50 Ga0068864_100005634 3300005618 Bacteria 10265
51 Ga0068861_100084174 3300005719 Bacteria 2497
52 Ga0068863_100053903 3300005841 Bacteria 3811
53 Ga0068858_100005764 3300005842 Bacteria 12102
54 Ga0068862_100043654 3300005844 Bacteria 3822
55 Ga0075365_10001995 3300006038 Bacteria 9669
56 Ga0075365_10007414 3300006038 Bacteria 6139
57 Ga0075365_10090773 3300006038 Bacteria 2081
58 Ga0075363_100004145 3300006048 Bacteria 6293
59 Ga0075363_100016515 3300006048 Bacteria 3646
60 Ga0075364_10063259 3300006051 Bacteria 2429
61 Ga0075432_10010992 3300006058 Bacteria 3075
62 Ga0075366_10007913 3300006195 Bacteria 5880
63 Ga0075366_10022469 3300006195 Bacteria 3670
64 Ga0097621_100060366 3300006237 Bacteria 3108
65 Ga0075370_10022511 3300006353 Bacteria 3461
66 Ga0075370_10032012 3300006353 Bacteria 2937
67 Ga0075430_100035532 3300006846 Bacteria 4228
68 Ga0079104_1000001 3300006946 Bacteria 521847
69 Ga0105244_10034401 3300009036 Bacteria 2668
70 Ga0105240_10002814 3300009093 Bacteria 27490
71 Ga0105240_10015617 3300009093 Bacteria 10312
72 Ga0105240_10042736 3300009093 Bacteria 5773
73 Ga0105248_10089645 3300009177 Bacteria 3462
74 Ga0105237_10002372 3300009545 Bacteria 23375
75 Ga0105237_10096073 3300009545 Bacteria 2953
76 Ga0105238_10083758 3300009551 Bacteria 3178
77 Ga0105238_10091626 3300009551 Bacteria 3027
78 Ga0105238_10109670 3300009551 Bacteria 2741
79 Ga0105249_10018801 3300009553 Bacteria 6158
80 Ga0105239_10001168 3300010375 Bacteria 36102
81 Ga0157347_1000259 3300012502 Bacteria 3136
82 Ga0157373_10003982 3300013100 Bacteria 11140
83 Ga0157374_10049480 3300013296 Bacteria 3904
84 Ga0163162_10021978 3300013306 Bacteria 6286
85 Ga0157375_10059326 3300013308 Bacteria 3790
86 Ga0163163_10033316 3300014325 Bacteria 4983
87 Ga0182008_10000191 3300014497 Bacteria 48580
88 Ga0182008_10006656 3300014497 Bacteria 6434
89 Ga0157376_10005532 3300014969 Bacteria 8830
90 Ga0157376_10023553 3300014969 Bacteria 4821
91 Ga0182007_10001944 3300015262 Bacteria 10695
92 Ga0182007_10002842 3300015262 Bacteria 8423
93 Ga0183362_10005 3300015683 Bacteria 437616
94 Ga0163161_10000244 3300017792 Bacteria 49165
95 Ga0163161_10020769 3300017792 Bacteria 4610
96 Ga0163161_10057603 3300017792 Bacteria 2823
97 Ga0213872_10000132 3300021361 Bacteria 67609
98 Ga0213872_10012173 3300021361 Bacteria 4056
99 Ga0209674_100064 3300025226 Bacteria 265769
100 Ga0209563_100099 3300025230 Bacteria 153336
101 Ga0207427_100460 3300025231 Bacteria 22485
102 Ga0209258_100262 3300025242 Bacteria 90619
103 Ga0209258_100767 3300025242 Bacteria 19764
104 Ga0207425_1001028 3300025245 Bacteria 13015
105 Ga0209646_1000060 3300025246 Bacteria 256386
106 Ga0209026_1000049 3300025250 Bacteria 255273
107 Ga0209677_100175 3300025253 Bacteria 55052
108 Ga0209677_102998 3300025253 Bacteria 5840
109 Ga0209759_1000069 3300025256 Bacteria 182437
110 Ga0209759_1001440 3300025256 Bacteria 13427
111 Ga0209129_1000062 3300025258 Bacteria 240655
112 Ga0209565_1000020 3300025263 Bacteria 432627
113 Ga0209455_1000191 3300025272 Bacteria 90618
114 Ga0209673_1000072 3300025273 Bacteria 236935
115 Ga0209673_1021343 3300025273 Bacteria 2267
116 Ga0209675_1000014 3300025291 Bacteria 421902
117 Ga0209676_1020063 3300025292 Bacteria 2281
118 Ga0209025_1000286 3300025294 Bacteria 114096
119 Ga0209564_1000176 3300025295 Bacteria 152363
120 Ga0209758_1000129 3300025297 Bacteria 185022
121 Ga0209758_1000327 3300025297 Bacteria 89663
122 Ga0209050_1001120 3300025298 Bacteria 32400
123 Ga0209256_1000015 3300025299 Bacteria 622953
124 Ga0209051_1000018 3300025303 Bacteria 527061
125 Ga0209051_1000114 3300025303 Bacteria 152303
126 Ga0209051_1002160 3300025303 Bacteria 14589
127 Ga0209051_1003036 3300025303 Bacteria 11357
128 Ga0209257_1000015 3300025304 Bacteria 908141
129 Ga0209257_1000324 3300025304 Bacteria 100144
130 Ga0207655_1001961 3300025728 Bacteria 17580
131 Ga0207682_10022960 3300025893 Bacteria 2461
132 Ga0207645_10021997 3300025907 Bacteria 4153
133 Ga0207695_10005159 3300025913 Bacteria 17488
134 Ga0207695_10027651 3300025913 Bacteria 6312
135 Ga0207695_10068359 3300025913 Bacteria 3640
136 Ga0207671_10006688 3300025914 Bacteria 10213
137 Ga0207657_10068675 3300025919 Bacteria 3010
138 Ga0207649_10000515 3300025920 Bacteria 27166
139 Ga0207681_10002439 3300025923 Bacteria 11796
140 Ga0207694_10036301 3300025924 Bacteria 3782
141 Ga0207694_10051905 3300025924 Bacteria 3178
142 Ga0207690_10000906 3300025932 Bacteria 18937
143 Ga0207690_10011161 3300025932 Bacteria 5362
144 Ga0207690_10033812 3300025932 Bacteria 3290
145 Ga0207706_10003127 3300025933 Bacteria 15894
146 Ga0207709_10002379 3300025935 Bacteria 11866
147 Ga0207691_10034186 3300025940 Bacteria 4728
148 Ga0207679_10000047 3300025945 Bacteria 119891
149 Ga0207679_10038702 3300025945 Bacteria 3400
150 Ga0207667_10014707 3300025949 Bacteria 8907
151 Ga0207667_10039365 3300025949 Bacteria 5039
152 Ga0207667_10063994 3300025949 Bacteria 3842
153 Ga0207651_10058493 3300025960 Bacteria 2664
154 Ga0207651_10060455 3300025960 Bacteria 2630
155 Ga0207651_10100109 3300025960 Bacteria 2148
156 Ga0207668_10070691 3300025972 Bacteria 2490
157 Ga0207677_10025339 3300026023 Bacteria 3699
158 Ga0207702_10015600 3300026078 Bacteria 6288
159 Ga0207648_10078292 3300026089 Bacteria 2883
160 Ga0207676_10014719 3300026095 Bacteria 5634
161 Ga0207674_10016085 3300026116 Bacteria 8194
162 Ga0207674_10019884 3300026116 Bacteria 7265
163 Ga0207675_100004708 3300026118 Bacteria 13135
164 Ga0207675_100128549 3300026118 Bacteria 2401
165 Ga0207683_10019865 3300026121 Bacteria 5740
166 Ga0207683_10045012 3300026121 Bacteria 3859
167 Ga0209281_1000151 3300027111 Bacteria 167268
168 Ga0209282_1000298 3300027666 Bacteria 24501
169 Ga0265336_10000040 3300028666 Bacteria 138266
170 Ga0307515_10000609 3300028794 Bacteria 83557
171 Ga0307515_10001655 3300028794 Bacteria 49620
172 Ga0307515_10090019 3300028794 Bacteria 3854
173 Ga0265324_10002437 3300029957 Bacteria 9532
174 Ga0307511_10027910 3300030521 Bacteria 5143
175 Ga0316177_1207751 3300030731 Bacteria 2324
176 Ga0314311_1032688 3300030733 Bacteria 3322
177 Ga0316181_1070286 3300030744 Bacteria 3871
178 Ga0265330_10008146 3300031235 Bacteria 5061
179 Ga0265327_10000945 3300031251 Bacteria 42267
180 Ga0265327_10005555 3300031251 Bacteria 10470
181 Ga0307513_10031678 3300031456 Bacteria 5983
182 Ga0307509_10039831 3300031507 Bacteria 5115
183 Ga0307408_100078165 3300031548 Bacteria 2466
184 Ga0307514_10011687 3300031649 Bacteria 7302
185 Ga0265314_10005055 3300031711 Bacteria 12020
186 Ga0265314_10009447 3300031711 Bacteria 8225
187 Ga0307516_10000127 3300031730 Bacteria 90180
188 Ga0307516_10000438 3300031730 Bacteria 54750
189 Ga0307516_10003818 3300031730 Bacteria 19103
190 Ga0307412_10017683 3300031911 Bacteria 4270
191 Ga0307412_10103571 3300031911 Bacteria 2017
192 Ga0307411_10086734 3300032005 Bacteria 2172
193 Ga0307507_10025176 3300033179 Bacteria 6461
194 Ga0373931_0000961 3300035691 Bacteria 12161
195 Ga0395899_0025794 3300037312 Bacteria 4436
196 Ga0395900_0000050 3300037418 Bacteria 224616
197 Ga0395900_0024297 3300037418 Bacteria 6205
198 Ga0395900_0036713 3300037418 Bacteria 5052
199 Ga0395900_0117627 3300037418 Bacteria 2727
200 Ga0395898_0004637 3300037466 Bacteria 14988
201 Ga0395898_0017154 3300037466 Bacteria 7396
202 Ga0395898_0023979 3300037466 Bacteria 6157
203 Ga0395898_0053335 3300037466 Bacteria 3949
204 Ga0395905_0053738 3300037471 Bacteria 3769
205 Ga0395905_0067485 3300037471 Bacteria 3350
206 Ga0395905_0070844 3300037471 Bacteria 3267
207 Ga0395905_0077512 3300037471 Bacteria 3114
208 Ga0395901_0001065 3300038443 Bacteria 29436
209 Ga0395901_0016283 3300038443 Bacteria 7572
210 Ga0395901_0037979 3300038443 Bacteria 4980
211 Ga0436361_0437739 3300039447 Bacteria 3933
212 Ga0436361_1206467 3300039447 Bacteria 80244
213 Ga0439436_0005707 3300041404 Bacteria 3815
214 Ga0439465_0004738 3300041413 Bacteria 4385
215 Ga0439433_0001034 3300041999 Bacteria 5638
216 Ga0439449_0000682 3300042007 Bacteria 12925
217 Ga0439449_0002064 3300042007 Bacteria 7908
218 Ga0439462_0004368 3300042015 Bacteria 3443
219 Ga0439434_0001557 3300042435 Bacteria 6612
220 Ga0439434_0006663 3300042435 Bacteria 3375
221 Ga0439464_0011750 3300042439 Bacteria 2323
222 Ga0450918_000266 3300042531 Bacteria 11793
223 Ga0451577_0022279 3300042876 Bacteria 5785
224 Ga0451577_0025241 3300042876 Bacteria 5394
225 Ga0466969_0000008 3300044656 Bacteria 139607
226 Ga0466972_0001150 3300044658 Bacteria 12651
227 Ga0466965_0003338 3300044683 Bacteria 7030
228 Ga0466966_0011822 3300044684 Bacteria 5780
229 Ga0466971_0016545 3300044719 Bacteria 3256
230 Ga0466970_0024282 3300044765 Bacteria 3169
231 Ga0466959_0005783 3300045049 Bacteria 8517
232 Ga0466959_0027222 3300045049 Bacteria 4240
233 Ga0451576_0018434 3300045051 Bacteria 7651
234 Ga0451576_0096009 3300045051 Bacteria 3083
235 Ga0495639_0002239 3300046475 Bacteria 8498
236 Ga0495639_0013358 3300046475 Bacteria 3545
237 Ga0495585_0039558 3300046492 Bacteria 2650
238 Ga0495583_0000046 3300046506 Bacteria 218059
239 Ga0495606_0002732 3300046507 Bacteria 19860
240 Ga0495668_0047957 3300046616 Bacteria 2371
241 Ga0495625_0001236 3300046660 Bacteria 32273
242 Ga0495625_0003970 3300046660 Bacteria 14185
243 Ga0495649_0000548 3300046694 Bacteria 31877
244 Ga0496100_0025814 3300048903 Bacteria 3595
245 Ga0496101_0001647 3300048904 Bacteria 13387
246 Ga0496102_0081494 3300048905 Bacteria 2983
247 Ga0496103_0053003 3300048906 Bacteria 2513
248 Ga0496104_0024430 3300048907 Bacteria 5557
249 Ga0496105_0011915 3300048908 Bacteria 6884
250 Ga0496107_0048755 3300048910 Bacteria 3052
251 Ga0496110_0076278 3300048913 Bacteria 2980
252 Ga0496118_0060248 3300048921 Bacteria 2819
253 Ga0496121_0021731 3300048924 Bacteria 6270
254 Ga0496122_0000324 3300048925 Bacteria 104220
255 Ga0496123_0000160 3300048926 Bacteria 135310
256 Ga0496124_0000487 3300048927 Bacteria 68031
257 Ga0501034_0027893 3300049571 Bacteria 5742
258 Ga0501043_0001042 3300049579 Bacteria 24366
259 Ga0501046_0000137 3300049580 Bacteria 78496
260 Ga0501047_0001319 3300049581 Bacteria 24366
261 Ga0501048_0008861 3300049582 Bacteria 7575
262 Ga0501035_0011020 3300049822 Bacteria 8371
263 Ga0501045_0009289 3300049824 Bacteria 6878
264 nmdc:mga00v17_46391_c1 3300050491 Bacteria 2629
265 nmdc:mga0yw44_10136_c1 3300050492 Bacteria 4801
266 nmdc:mga0yw44_38012_c1 3300050492 Bacteria 2845
267 nmdc:mga0yw44_8149_c1 3300050492 Bacteria 5205
268 nmdc:mga0k408_2087_c1 3300050493 Bacteria 10691
269 nmdc:mga0k408_21637_c1 3300050493 Bacteria 3614
270 nmdc:mga0k408_9610_c3 3300050493 Bacteria 2609
271 Ga0500635_0000113 3300053080 Bacteria 49202
272 Ga0500578_0000079 3300053086 Bacteria 107137
273 Ga0466962_0003243 3300061719 Bacteria 7731

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003784 Ga0055534_1001997 Ga0055534_10019976 476
2 3300005457 Ga0070662_100063756 Ga0070662_1000637562 517
3 3300025933 Ga0207706_10003127 Ga0207706_100031279 517
4 3300005564 Ga0070664_100015776 Ga0070664_1000157763 541
5 3300003791 Ga0055530_10002840 Ga0055530_100028405 542
6 3300003792 Ga0055540_1000001 Ga0055540_1000001376 542
7 3300003794 Ga0055531_10003946 Ga0055531_100039465 542
8 3300025298 Ga0209050_1001120 Ga0209050_10011204 542
9 3300025303 Ga0209051_1000018 Ga0209051_100001878 542
10 3300025304 Ga0209257_1000324 Ga0209257_100032478 542
11 3300005344 Ga0070661_100001910 Ga0070661_1000019103 543
12 3300005366 Ga0070659_100000260 Ga0070659_10000026032 543
13 3300005564 Ga0070664_100006437 Ga0070664_1000064376 543
14 3300006946 Ga0079104_1000001 Ga0079104_1000001391 543
15 3300025299 Ga0209256_1000015 Ga0209256_1000015479 543
16 3300025920 Ga0207649_10000515 Ga0207649_100005153 543
17 3300025932 Ga0207690_10000906 Ga0207690_1000090611 543
18 3300025945 Ga0207679_10000047 Ga0207679_10000047103 543
19 3300027111 Ga0209281_1000151 Ga0209281_100015174 543
20 3300042531 Ga0450918_000266 Ga0450918_000266_88_1821 544
21 3300014497 Ga0182008_10000191 Ga0182008_1000019112 553
22 3300021361 Ga0213872_10000132 Ga0213872_1000013243 554
23 3300039447 Ga0436361_1206467 Ga0436361_1206467_21448_23133 554
24 3300005336 Ga0070680_100109233 Ga0070680_1001092332 557
25 3300005339 Ga0070660_100017577 Ga0070660_1000175773 557
26 3300005563 Ga0068855_100043313 Ga0068855_1000433133 557
27 3300009093 Ga0105240_10015617 Ga0105240_100156176 557
28 3300009551 Ga0105238_10083758 Ga0105238_100837582 557
29 3300025913 Ga0207695_10068359 Ga0207695_100683592 557
30 3300025924 Ga0207694_10051905 Ga0207694_100519051 557
31 3300025949 Ga0207667_10063994 Ga0207667_100639943 557
32 3300042876 Ga0451577_0025241 Ga0451577_0025241_196_1938 557
33 3300006048 Ga0075363_100016515 Ga0075363_1000165153 558
34 3300006195 Ga0075366_10007913 Ga0075366_100079134 558
35 3300006353 Ga0075370_10032012 Ga0075370_100320123 558
36 3300050493 nmdc:mga0k408_21637_c1 nmdc:mga0k408_21637_c1_1719_3551 558
37 3300037418 Ga0395900_0000050 Ga0395900_0000050_7463_9229 560
38 3300042007 Ga0439449_0000682 Ga0439449_0000682_8547_10277 561
39 3300042015 Ga0439462_0004368 Ga0439462_0004368_205_1935 561
40 3300003794 Ga0055531_10000452 Ga0055531_100004524 562
41 3300003794 Ga0055531_10008909 Ga0055531_100089092 562
42 3300005563 Ga0068855_100254134 Ga0068855_1002541341 562
43 3300006038 Ga0075365_10090773 Ga0075365_100907732 562
44 3300006846 Ga0075430_100035532 Ga0075430_1000355323 562
45 3300025303 Ga0209051_1000114 Ga0209051_100011492 562
46 3300025304 Ga0209257_1000015 Ga0209257_1000015719 562
47 3300033179 Ga0307507_10025176 Ga0307507_100251762 562
48 3300037312 Ga0395899_0025794 Ga0395899_0025794_1499_3256 562
49 3300037418 Ga0395900_0024297 Ga0395900_0024297_2804_4561 562
50 3300037418 Ga0395900_0036713 Ga0395900_0036713_2057_3817 562
51 3300037466 Ga0395898_0004637 Ga0395898_0004637_2237_3991 562
52 3300037466 Ga0395898_0023979 Ga0395898_0023979_3507_5267 562
53 3300037471 Ga0395905_0067485 Ga0395905_0067485_142_1899 562
54 3300038443 Ga0395901_0016283 Ga0395901_0016283_4485_6245 562
55 3300038443 Ga0395901_0037979 Ga0395901_0037979_785_2539 562
56 3300042439 Ga0439464_0011750 Ga0439464_0011750_291_2045 562
57 3300042876 Ga0451577_0022279 Ga0451577_0022279_3740_5503 562
58 3300045051 Ga0451576_0018434 Ga0451576_0018434_5793_7547 562
59 3300045051 Ga0451576_0096009 Ga0451576_0096009_895_2658 562
60 3300050492 nmdc:mga0yw44_38012_c1 nmdc:mga0yw44_38012_c1_297_2048 562
61 iso_pu_bacteria 2881101125 2881104965 562
62 3300014969 Ga0157376_10005532 Ga0157376_100055324 563
63 3300026023 Ga0207677_10025339 Ga0207677_100253393 563
64 3300031235 Ga0265330_10008146 Ga0265330_100081462 563
65 3300031711 Ga0265314_10005055 Ga0265314_100050557 563
66 3300031711 Ga0265314_10009447 Ga0265314_100094478 563
67 3300037418 Ga0395900_0117627 Ga0395900_0117627_553_2310 563
68 3300037471 Ga0395905_0070844 Ga0395905_0070844_1436_3193 563
69 3300049571 Ga0501034_0027893 Ga0501034_0027893_28_1788 563
70 3300049822 Ga0501035_0011020 Ga0501035_0011020_5014_6774 563
71 3300005335 Ga0070666_10014381 Ga0070666_100143814 564
72 3300005338 Ga0068868_100002288 Ga0068868_10000228811 564
73 3300005354 Ga0070675_100006356 Ga0070675_1000063567 564
74 3300005841 Ga0068863_100053903 Ga0068863_1000539032 564
75 3300005842 Ga0068858_100005764 Ga0068858_1000057645 564
76 3300006038 Ga0075365_10007414 Ga0075365_100074143 564
77 3300006237 Ga0097621_100060366 Ga0097621_1000603662 564
78 3300009177 Ga0105248_10089645 Ga0105248_100896453 564
79 3300013296 Ga0157374_10049480 Ga0157374_100494802 564
80 3300014325 Ga0163163_10033316 Ga0163163_100333163 564
81 3300025907 Ga0207645_10021997 Ga0207645_100219971 564
82 3300025923 Ga0207681_10002439 Ga0207681_1000243910 564
83 3300025960 Ga0207651_10100109 Ga0207651_101001092 564
84 3300026089 Ga0207648_10078292 Ga0207648_100782922 564
85 3300026095 Ga0207676_10014719 Ga0207676_100147194 564
86 3300026121 Ga0207683_10019865 Ga0207683_100198655 564
87 3300048925 Ga0496122_0000324 Ga0496122_0000324_74408_76198 564
88 3300048926 Ga0496123_0000160 Ga0496123_0000160_65956_67746 564
89 3300050492 nmdc:mga0yw44_8149_c1 nmdc:mga0yw44_8149_c1_1105_2889 564
90 iso_pu_bacteria 2842747753 2842752684 564
91 3300003187 JGI25151J46595_10001446 JGI25151J46595_100014469 565
92 3300003187 JGI25151J46595_10004971 JGI25151J46595_100049716 565
93 3300003578 Ga0006562J51391_1045467 Ga0006562J51391_10454673 565
94 3300003773 Ga0055537_1000618 Ga0055537_10006182 565
95 3300003781 Ga0055536_1009899 Ga0055536_10098992 565
96 3300003784 Ga0055534_1001207 Ga0055534_10012072 565
97 3300003790 Ga0055528_1015294 Ga0055528_10152942 565
98 3300005288 Ga0065714_10008154 Ga0065714_100081543 565
99 3300005367 Ga0070667_100015275 Ga0070667_1000152754 565
100 3300005578 Ga0068854_100049541 Ga0068854_1000495413 565
101 3300005618 Ga0068864_100005634 Ga0068864_1000056349 565
102 3300006038 Ga0075365_10001995 Ga0075365_100019959 565
103 3300006048 Ga0075363_100004145 Ga0075363_1000041456 565
104 3300006051 Ga0075364_10063259 Ga0075364_100632592 565
105 3300006058 Ga0075432_10010992 Ga0075432_100109922 565
106 3300006353 Ga0075370_10022511 Ga0075370_100225113 565
107 3300009036 Ga0105244_10034401 Ga0105244_100344012 565
108 3300009551 Ga0105238_10091626 Ga0105238_100916262 565
109 3300012502 Ga0157347_1000259 Ga0157347_10002592 565
110 3300013100 Ga0157373_10003982 Ga0157373_100039829 565
111 3300013306 Ga0163162_10021978 Ga0163162_100219783 565
112 3300013308 Ga0157375_10059326 Ga0157375_100593262 565
113 3300014497 Ga0182008_10006656 Ga0182008_100066563 565
114 3300015262 Ga0182007_10001944 Ga0182007_1000194410 565
115 3300015262 Ga0182007_10002842 Ga0182007_100028424 565
116 3300015683 Ga0183362_10005 Ga0183362_10005154 565
117 3300017792 Ga0163161_10000244 Ga0163161_1000024439 565
118 3300017792 Ga0163161_10020769 Ga0163161_100207693 565
119 3300017792 Ga0163161_10057603 Ga0163161_100576032 565
120 3300025263 Ga0209565_1000020 Ga0209565_1000020108 565
121 3300025273 Ga0209673_1000072 Ga0209673_100007292 565
122 3300025273 Ga0209673_1021343 Ga0209673_10213432 565
123 3300025291 Ga0209675_1000014 Ga0209675_100001496 565
124 3300025292 Ga0209676_1020063 Ga0209676_10200632 565
125 3300025294 Ga0209025_1000286 Ga0209025_10002863 565
126 3300025303 Ga0209051_1002160 Ga0209051_100216013 565
127 3300025728 Ga0207655_1001961 Ga0207655_100196116 565
128 3300025932 Ga0207690_10033812 Ga0207690_100338121 565
129 3300025935 Ga0207709_10002379 Ga0207709_100023799 565
130 3300025945 Ga0207679_10038702 Ga0207679_100387022 565
131 3300025949 Ga0207667_10039365 Ga0207667_100393653 565
132 3300026116 Ga0207674_10016085 Ga0207674_100160858 565
133 3300027666 Ga0209282_1000298 Ga0209282_100029824 565
134 3300030731 Ga0316177_1207751 Ga0316177_12077512 565
135 3300030733 Ga0314311_1032688 Ga0314311_10326882 565
136 3300030744 Ga0316181_1070286 Ga0316181_10702863 565
137 3300031251 Ga0265327_10000945 Ga0265327_100009454 565
138 3300031251 Ga0265327_10005555 Ga0265327_1000555510 565
139 3300031649 Ga0307514_10011687 Ga0307514_100116877 565
140 3300031911 Ga0307412_10017683 Ga0307412_100176833 565
141 3300031911 Ga0307412_10103571 Ga0307412_101035711 565
142 3300032005 Ga0307411_10086734 Ga0307411_100867342 565
143 3300041404 Ga0439436_0005707 Ga0439436_0005707_708_2558 565
144 3300041413 Ga0439465_0004738 Ga0439465_0004738_1891_3684 565
145 3300041999 Ga0439433_0001034 Ga0439433_0001034_3827_5620 565
146 3300042007 Ga0439449_0002064 Ga0439449_0002064_301_2094 565
147 3300042435 Ga0439434_0001557 Ga0439434_0001557_1771_3564 565
148 3300042435 Ga0439434_0006663 Ga0439434_0006663_719_2569 565
149 3300046475 Ga0495639_0002239 Ga0495639_0002239_4810_6603 565
150 3300046660 Ga0495625_0001236 Ga0495625_0001236_8944_10794 565
151 3300048903 Ga0496100_0025814 Ga0496100_0025814_941_2734 565
152 3300048904 Ga0496101_0001647 Ga0496101_0001647_4098_5891 565
153 3300048905 Ga0496102_0081494 Ga0496102_0081494_304_2097 565
154 3300048906 Ga0496103_0053003 Ga0496103_0053003_267_2060 565
155 3300048907 Ga0496104_0024430 Ga0496104_0024430_3714_5507 565
156 3300048908 Ga0496105_0011915 Ga0496105_0011915_288_2081 565
157 3300048910 Ga0496107_0048755 Ga0496107_0048755_891_2684 565
158 3300048913 Ga0496110_0076278 Ga0496110_0076278_883_2676 565
159 3300048921 Ga0496118_0060248 Ga0496118_0060248_575_2401 565
160 3300050491 nmdc:mga00v17_46391_c1 nmdc:mga00v17_46391_c1_382_2232 565
161 3300050492 nmdc:mga0yw44_10136_c1 nmdc:mga0yw44_10136_c1_491_2341 565
162 3300050493 nmdc:mga0k408_2087_c1 nmdc:mga0k408_2087_c1_67_1917 565
163 iso_pu_bacteria 2513020051 2513226970 565
164 iso_pu_bacteria 2643221628 2644164052 565
165 iso_pu_bacteria 2738541277 2738721466 565
166 iso_pu_bacteria 2738543013 2739249673 565
167 iso_pu_bacteria 2738543019 2739281135 565
168 iso_pu_bacteria 2842677519 2842678661 565
169 iso_pu_bacteria 2842733646 2842733924 565
170 iso_pu_bacteria 2885192300 2885193183 565
171 iso_pu_bacteria 2904541872 2904547143 565
172 iso_pu_bacteria 2919462493 2919463645 565
173 iso_pu_bacteria 2929160207 2929165697 565
174 iso_pu_bacteria 2945909444 2945909649 565
175 iso_pu_bacteria 2945945610 2945945735 565
176 iso_pu_bacteria 2945972063 2945975390 565
177 iso_pu_bacteria 2945984333 2945988377 565
178 3300031730 Ga0307516_10000127 Ga0307516_1000012745 566
179 iso_pu_bacteria 2928115317 2928117940 567
180 3300031730 Ga0307516_10000438 Ga0307516_1000043829 570
181 iso_pu_bacteria 2643221644 2644246581 570
182 3300031548 Ga0307408_100078165 Ga0307408_1000781652 572
183 3300014969 Ga0157376_10023553 Ga0157376_100235534 574
184 3300048927 Ga0496124_0000487 Ga0496124_0000487_47105_48844 574
185 iso_pu_bacteria 2585428062 2587754167 574
186 3300028794 Ga0307515_10090019 Ga0307515_100900194 575
187 3300037466 Ga0395898_0017154 Ga0395898_0017154_5238_7004 575
188 3300037471 Ga0395905_0053738 Ga0395905_0053738_195_1934 575
189 3300037471 Ga0395905_0077512 Ga0395905_0077512_1008_2753 575
190 3300044656 Ga0466969_0000008 Ga0466969_0000008_73877_75646 575
191 3300044658 Ga0466972_0001150 Ga0466972_0001150_4781_6538 575
192 3300045049 Ga0466959_0005783 Ga0466959_0005783_3762_5531 575
193 3300048924 Ga0496121_0021731 Ga0496121_0021731_1164_2984 575
194 3300003215 JGI25153J46596_10000674 JGI25153J46596_1000067414 577
195 3300003771 Ga0055526_1003927 Ga0055526_10039272 577
196 3300005354 Ga0070675_100044369 Ga0070675_1000443693 577
197 3300005456 Ga0070678_100028844 Ga0070678_1000288442 577
198 3300005459 Ga0068867_100021948 Ga0068867_1000219483 577
199 3300005543 Ga0070672_100030178 Ga0070672_1000301782 577
200 3300005844 Ga0068862_100043654 Ga0068862_1000436542 577
201 3300009553 Ga0105249_10018801 Ga0105249_100188015 577
202 3300025245 Ga0207425_1001028 Ga0207425_10010282 577
203 3300025258 Ga0209129_1000062 Ga0209129_1000062142 577
204 3300025295 Ga0209564_1000176 Ga0209564_100017662 577
205 3300025297 Ga0209758_1000129 Ga0209758_100012927 577
206 3300025893 Ga0207682_10022960 Ga0207682_100229602 577
207 3300025940 Ga0207691_10034186 Ga0207691_100341862 577
208 3300025960 Ga0207651_10060455 Ga0207651_100604552 577
209 3300025972 Ga0207668_10070691 Ga0207668_100706912 577
210 3300026118 Ga0207675_100004708 Ga0207675_1000047085 577
211 3300026121 Ga0207683_10045012 Ga0207683_100450122 577
212 3300003215 JGI25153J46596_10006142 JGI25153J46596_100061425 578
213 3300025297 Ga0209758_1000327 Ga0209758_100032724 578
214 3300028794 Ga0307515_10000609 Ga0307515_1000060951 578
215 3300028794 Ga0307515_10001655 Ga0307515_1000165540 578
216 3300031456 Ga0307513_10031678 Ga0307513_100316783 578
217 3300031507 Ga0307509_10039831 Ga0307509_100398313 578
218 3300046660 Ga0495625_0003970 Ga0495625_0003970_9482_11227 578
219 3300049579 Ga0501043_0001042 Ga0501043_0001042_2418_4217 578
220 3300049580 Ga0501046_0000137 Ga0501046_0000137_74325_76124 578
221 3300049581 Ga0501047_0001319 Ga0501047_0001319_2418_4217 578
222 3300049582 Ga0501048_0008861 Ga0501048_0008861_355_2154 578
223 3300049824 Ga0501045_0009289 Ga0501045_0009289_4655_6454 578
224 3300053080 Ga0500635_0000113 Ga0500635_0000113_226_2007 578
225 3300053086 Ga0500578_0000079 Ga0500578_0000079_80094_81881 578
226 3300009093 Ga0105240_10002814 Ga0105240_1000281410 580
227 3300009545 Ga0105237_10002372 Ga0105237_1000237211 580
228 3300010375 Ga0105239_10001168 Ga0105239_1000116818 580
229 3300025913 Ga0207695_10005159 Ga0207695_100051597 580
230 3300025914 Ga0207671_10006688 Ga0207671_100066888 580
231 3300030521 Ga0307511_10027910 Ga0307511_100279102 582
232 3300046475 Ga0495639_0013358 Ga0495639_0013358_408_2195 582
233 3300046506 Ga0495583_0000046 Ga0495583_0000046_91923_93716 582
234 3300046507 Ga0495606_0002732 Ga0495606_0002732_9611_11404 582
235 3300046616 Ga0495668_0047957 Ga0495668_0047957_194_1987 582
236 3300046694 Ga0495649_0000548 Ga0495649_0000548_4334_6127 582
237 3300003752 Ga0055539_1000382 Ga0055539_10003823 583
238 3300003756 Ga0055533_1000033 Ga0055533_1000033115 583
239 3300025226 Ga0209674_100064 Ga0209674_100064134 583
240 3300025230 Ga0209563_100099 Ga0209563_100099134 583
241 3300025253 Ga0209677_100175 Ga0209677_1001753 583
242 3300031730 Ga0307516_10003818 Ga0307516_1000381812 584
243 3300044683 Ga0466965_0003338 Ga0466965_0003338_4891_6651 586
244 3300044684 Ga0466966_0011822 Ga0466966_0011822_1976_3736 586
245 3300044719 Ga0466971_0016545 Ga0466971_0016545_251_2011 586
246 3300044765 Ga0466970_0024282 Ga0466970_0024282_1205_2965 586
247 3300045049 Ga0466959_0027222 Ga0466959_0027222_1981_3741 586
248 3300061719 Ga0466962_0003243 Ga0466962_0003243_4161_5921 586
249 3300026078 Ga0207702_10015600 Ga0207702_100156002 588
250 3300003761 Ga0055535_1001531 Ga0055535_10015317 589
251 3300003763 Ga0055529_1000338 Ga0055529_100033849 589
252 3300025242 Ga0209258_100262 Ga0209258_10026291 589
253 3300025256 Ga0209759_1001440 Ga0209759_10014403 589
254 3300025272 Ga0209455_1000191 Ga0209455_100019191 589
255 3300005364 Ga0070673_100002408 Ga0070673_1000024086 590
256 3300025960 Ga0207651_10058493 Ga0207651_100584932 590
257 3300021361 Ga0213872_10012173 Ga0213872_100121733 591
258 3300025303 Ga0209051_1003036 Ga0209051_10030366 591
259 3300039447 Ga0436361_0437739 Ga0436361_0437739_1773_3551 591
260 3300005327 Ga0070658_10057463 Ga0070658_100574632 592
261 3300028666 Ga0265336_10000040 Ga0265336_100000402 592
262 3300029957 Ga0265324_10002437 Ga0265324_100024372 592
263 3300035691 Ga0373931_0000961 Ga0373931_0000961_4871_6652 593
264 3300046492 Ga0495585_0039558 Ga0495585_0039558_69_1850 593
265 3300002705 JGI25156J39149_1001228 JGI25156J39149_10012284 595
266 3300002738 JGI25154J39366_1003095 JGI25154J39366_10030953 595
267 3300002741 JGI25157J39369_1000021 JGI25157J39369_100002146 595
268 3300003752 Ga0055539_1000992 Ga0055539_10009922 595
269 3300005366 Ga0070659_100028708 Ga0070659_1000287083 595
270 3300005563 Ga0068855_100032125 Ga0068855_1000321254 595
271 3300005577 Ga0068857_100025084 Ga0068857_1000250843 595
272 3300005578 Ga0068854_100012982 Ga0068854_1000129824 595
273 3300005719 Ga0068861_100084174 Ga0068861_1000841742 595
274 3300006195 Ga0075366_10022469 Ga0075366_100224692 595
275 3300009093 Ga0105240_10042736 Ga0105240_100427362 595
276 3300009545 Ga0105237_10096073 Ga0105237_100960732 595
277 3300009551 Ga0105238_10109670 Ga0105238_101096703 595
278 3300025231 Ga0207427_100460 Ga0207427_10046017 595
279 3300025242 Ga0209258_100767 Ga0209258_1007673 595
280 3300025246 Ga0209646_1000060 Ga0209646_1000060111 595
281 3300025250 Ga0209026_1000049 Ga0209026_1000049109 595
282 3300025253 Ga0209677_102998 Ga0209677_1029983 595
283 3300025256 Ga0209759_1000069 Ga0209759_1000069109 595
284 3300025913 Ga0207695_10027651 Ga0207695_100276514 595
285 3300025919 Ga0207657_10068675 Ga0207657_100686752 595
286 3300025924 Ga0207694_10036301 Ga0207694_100363014 595
287 3300025932 Ga0207690_10011161 Ga0207690_100111615 595
288 3300025949 Ga0207667_10014707 Ga0207667_100147073 595
289 3300026116 Ga0207674_10019884 Ga0207674_100198844 595
290 3300026118 Ga0207675_100128549 Ga0207675_1001285492 595
291 3300037466 Ga0395898_0053335 Ga0395898_0053335_1434_3221 595
292 3300038443 Ga0395901_0001065 Ga0395901_0001065_24636_26423 595
293 3300050493 nmdc:mga0k408_9610_c3 nmdc:mga0k408_9610_c3_576_2363 595

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05299

Peptidase_M61

M61 glycyl aminopeptidase

305

422

0.99

PF17899

Peptidase_M61_N

Peptidase M61 N-terminal domain

23

200

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgm-assembly1.cif.gz_A crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. 0.8956 1 593
4fgm-assembly1.cif.gz_A crystal structure of the aminopeptidase n family protein q5qty1 from idiomarina loihiensis. northeast structural genomics consortium target ilr60. 0.8913 1 593
5wyn-assembly1.cif.gz_A htra2 pathogenic mutant 0.8685 486 560
4a8d-assembly1.cif.gz_A degp dodecamer with bound omp 0.8666 485 559
1lcy-assembly1.cif.gz_A crystal structure of the mitochondrial serine protease htra2 0.8642 497 562
ID Description Score Start End Superfamily
4fgmA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.9256 186 460 1.10.390.10
4fgmA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.9223 186 460 1.10.390.10
af_F1QL69_2_87_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8664 497 563 2.30.42.10
af_Q9VFJ3_320_421_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8628 497 563 2.30.42.10
af_Q4D0I1_345_430_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8626 485 536 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A536VFM4-F1-model_v4 M61 family metallopeptidase 0.9505 167 369
AF-A0A522BYE5-F1-model_v4 M61 family peptidase 0.9463 1 351
AF-A0A519YXZ2-F1-model_v4 Peptidase M61 0.9416 1 262
AF-A0A3C1SZ38-F1-model_v4 Peptidase M61 0.939 249 456
AF-A0A519YXZ2-F1-model_v4 Peptidase M61 0.9379 1 262

Feature Viewer

pLDDT pTM Quality
87.01 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map