F391198

General Info

Members Datasets Scaffolds Average Seq Length
292 193 287 114

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_1039151|Ga0501045_1039151_226_561
Length 111
Sequence MSDTITMSEQEILDQIQSEVADNRVFLYMKGTPEMPRCGFSNQVVQILNHMGVEYGARDILVDPRIRMVLSEWSEWPTIPQLFVDGKLVGGCDIVTEMFQDGELKELLDTA

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
5 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
152 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
178 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
179 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
188 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 2.05
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.49
Nodule 0
Rhizoplane 2.05
Rhizosphere 71.92
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1015639 3300002741 Bacteria 933
2 JGI25153J46596_10058825 3300003215 Bacteria 1055
3 rootH2_10039664 3300003320 Bacteria 5223
4 Ga0055536_1002376 3300003781 Bacteria 10616
5 Ga0055530_10002837 3300003791 Bacteria 10598
6 Ga0055530_10002842 3300003791 Bacteria 10588
7 Ga0055540_1017606 3300003792 Bacteria 1988
8 Ga0055531_10004719 3300003794 Bacteria 8152
9 Ga0055531_10016968 3300003794 Bacteria 3104
10 Ga0058863_11865640 3300004799 Bacteria 586
11 Ga0065165_1000041 3300005262 Bacteria 203876
12 Ga0065165_1014074 3300005262 Bacteria 3124
13 Ga0070670_100000101 3300005331 Bacteria 79628
14 Ga0070670_100269519 3300005331 Bacteria 1485
15 Ga0070666_10022439 3300005335 Bacteria 4098
16 Ga0070668_100002639 3300005347 Bacteria 13171
17 Ga0070668_100005564 3300005347 Bacteria 9352
18 Ga0070668_100010442 3300005347 Bacteria 6900
19 Ga0070668_100024530 3300005347 Bacteria 4570
20 Ga0070669_100063567 3300005353 Bacteria 2717
21 Ga0070669_100399692 3300005353 Bacteria 1124
22 Ga0070669_100428462 3300005353 Bacteria 1087
23 Ga0070671_100239804 3300005355 Bacteria 1539
24 Ga0070673_101449397 3300005364 Bacteria 647
25 Ga0070659_100016461 3300005366 Bacteria 5552
26 Ga0070659_100675441 3300005366 Bacteria 892
27 Ga0070667_100000260 3300005367 Bacteria 60154
28 Ga0070667_100005932 3300005367 Bacteria 10170
29 Ga0070667_100094806 3300005367 Bacteria 2572
30 Ga0070662_100350139 3300005457 Bacteria 1210
31 Ga0070681_11247031 3300005458 Bacteria 666
32 Ga0070679_100465356 3300005530 Bacteria 1209
33 Ga0068853_100031562 3300005539 Bacteria 4481
34 Ga0070665_100002230 3300005548 Bacteria 21591
35 Ga0070665_100010548 3300005548 Bacteria 9352
36 Ga0068855_100478039 3300005563 Bacteria 1357
37 Ga0068855_100512844 3300005563 Bacteria 1302
38 Ga0070664_101723367 3300005564 Bacteria 594
39 Ga0070664_102366199 3300005564 Bacteria 504
40 Ga0068852_100540463 3300005616 Bacteria 1165
41 Ga0068852_102064932 3300005616 Bacteria 592
42 Ga0068859_100016312 3300005617 Bacteria 7462
43 Ga0068859_100070405 3300005617 Bacteria 3533
44 Ga0068864_100000496 3300005618 Bacteria 33880
45 Ga0068861_100031213 3300005719 Bacteria 3912
46 Ga0068863_100001649 3300005841 Bacteria 22078
47 Ga0068863_100009904 3300005841 Bacteria 9281
48 Ga0068863_100113685 3300005841 Bacteria 2579
49 Ga0068863_100297948 3300005841 Bacteria 1564
50 Ga0068863_100572140 3300005841 Bacteria 1117
51 Ga0068858_100036068 3300005842 Bacteria 4585
52 Ga0068860_100000309 3300005843 Bacteria 67252
53 Ga0068860_100090219 3300005843 Bacteria 2919
54 Ga0068860_100176382 3300005843 Bacteria 2065
55 Ga0068860_100655763 3300005843 Bacteria 1057
56 Ga0068862_100001520 3300005844 Bacteria 21267
57 Ga0068862_100014608 3300005844 Bacteria 6520
58 Ga0068862_100205590 3300005844 Bacteria 1777
59 Ga0068862_100319113 3300005844 Bacteria 1433
60 Ga0070717_11218822 3300006028 Bacteria 685
61 Ga0075368_10007687 3300006042 Bacteria 3811
62 Ga0075363_100053494 3300006048 Bacteria 2157
63 Ga0075364_10046198 3300006051 Bacteria 2835
64 Ga0075367_10021752 3300006178 Bacteria 3589
65 Ga0075367_10799489 3300006178 Bacteria 601
66 Ga0075366_10040777 3300006195 Bacteria 2747
67 Ga0075370_10127762 3300006353 Bacteria 1482
68 Ga0097620_100016312 3300006931 Bacteria 7462
69 Ga0097620_100070407 3300006931 Bacteria 3533
70 Ga0105251_10547945 3300009011 Bacteria 545
71 Ga0105240_10005291 3300009093 Bacteria 19267
72 Ga0105247_10033731 3300009101 Bacteria 3115
73 Ga0105241_10806132 3300009174 Bacteria 865
74 Ga0105242_10780666 3300009176 Bacteria 943
75 Ga0105248_10002557 3300009177 Bacteria 20245
76 Ga0105248_10072017 3300009177 Bacteria 3884
77 Ga0105248_10916925 3300009177 Bacteria 989
78 Ga0105248_11368029 3300009177 Bacteria 801
79 Ga0105248_11936410 3300009177 Bacteria 669
80 Ga0105248_13397708 3300009177 Bacteria 506
81 Ga0105238_10182063 3300009551 Bacteria 2078
82 Ga0105238_10434712 3300009551 Bacteria 1308
83 Ga0105238_11690145 3300009551 Bacteria 664
84 Ga0105238_12885993 3300009551 Bacteria 517
85 Ga0105249_10005538 3300009553 Bacteria 10915
86 Ga0105249_10057270 3300009553 Bacteria 3570
87 Ga0105249_10062995 3300009553 Bacteria 3405
88 Ga0105239_12272041 3300010375 Bacteria 631
89 Ga0157373_10010739 3300013100 Bacteria 6738
90 Ga0157373_10015966 3300013100 Bacteria 5483
91 Ga0157372_11501392 3300013307 Bacteria 776
92 Ga0157379_10000373 3300014968 Bacteria 36116
93 Ga0157376_11338580 3300014969 Bacteria 747
94 Ga0213876_10179981 3300021384 Bacteria 1124
95 Ga0209026_1001465 3300025250 Bacteria 10416
96 Ga0209676_1000134 3300025292 Bacteria 183222
97 Ga0209758_1000555 3300025297 Bacteria 59166
98 Ga0209050_1000034 3300025298 Bacteria 433906
99 Ga0209050_1000348 3300025298 Bacteria 90399
100 Ga0209050_1091694 3300025298 Bacteria 621
101 Ga0209051_1032528 3300025303 Bacteria 1988
102 Ga0209257_1000052 3300025304 Bacteria 430947
103 Ga0209257_1000100 3300025304 Bacteria 253399
104 Ga0209257_1000618 3300025304 Bacteria 57657
105 Ga0209257_1011554 3300025304 Bacteria 4232
106 Ga0207710_10026634 3300025900 Bacteria 2499
107 Ga0207680_10070471 3300025903 Bacteria 2164
108 Ga0207680_10194167 3300025903 Bacteria 1380
109 Ga0207680_10807669 3300025903 Bacteria 672
110 Ga0207647_10075282 3300025904 Bacteria 2032
111 Ga0207654_10164337 3300025911 Bacteria 1436
112 Ga0207707_10916322 3300025912 Bacteria 724
113 Ga0207695_10006230 3300025913 Bacteria 15536
114 Ga0207695_10184676 3300025913 Bacteria 2005
115 Ga0207652_10335117 3300025921 Bacteria 1366
116 Ga0207681_10072247 3300025923 Bacteria 2409
117 Ga0207681_10416752 3300025923 Bacteria 1087
118 Ga0207681_10934339 3300025923 Bacteria 727
119 Ga0207694_10364442 3300025924 Bacteria 1198
120 Ga0207694_10637086 3300025924 Bacteria 898
121 Ga0207694_10784939 3300025924 Bacteria 804
122 Ga0207650_10000064 3300025925 Bacteria 142969
123 Ga0207650_10218958 3300025925 Bacteria 1531
124 Ga0207690_10011314 3300025932 Bacteria 5333
125 Ga0207690_10556274 3300025932 Bacteria 933
126 Ga0207706_10312591 3300025933 Bacteria 1368
127 Ga0207711_10001318 3300025941 Bacteria 23485
128 Ga0207711_10039945 3300025941 Bacteria 3991
129 Ga0207711_12113142 3300025941 Bacteria 506
130 Ga0207679_11507235 3300025945 Bacteria 617
131 Ga0207667_10108602 3300025949 Bacteria 2862
132 Ga0207667_11264852 3300025949 Bacteria 715
133 Ga0207667_11289525 3300025949 Bacteria 707
134 Ga0207712_10000569 3300025961 Bacteria 29784
135 Ga0207712_10110258 3300025961 Bacteria 2063
136 Ga0207712_10632482 3300025961 Bacteria 928
137 Ga0207668_10000003 3300025972 Bacteria 206959
138 Ga0207668_10000678 3300025972 Bacteria 20916
139 Ga0207668_10016025 3300025972 Bacteria 4669
140 Ga0207668_10068169 3300025972 Bacteria 2528
141 Ga0207658_10000470 3300025986 Bacteria 37577
142 Ga0207658_10005614 3300025986 Bacteria 8580
143 Ga0207658_10339877 3300025986 Bacteria 1304
144 Ga0207703_10025799 3300026035 Bacteria 4625
145 Ga0207639_10013969 3300026041 Bacteria 5634
146 Ga0207639_10361149 3300026041 Bacteria 1300
147 Ga0207639_10865306 3300026041 Bacteria 844
148 Ga0207639_11453453 3300026041 Bacteria 643
149 Ga0207702_11302774 3300026078 Bacteria 720
150 Ga0207641_10002399 3300026088 Bacteria 17295
151 Ga0207641_10224075 3300026088 Bacteria 1745
152 Ga0207641_10386205 3300026088 Bacteria 1342
153 Ga0207676_10000285 3300026095 Bacteria 43703
154 Ga0207676_10107829 3300026095 Bacteria 2324
155 Ga0207675_100082509 3300026118 Bacteria 3015
156 Ga0207698_11832509 3300026142 Bacteria 622
157 Ga0209981_1000340 3300027378 Bacteria 6003
158 Ga0209999_1017729 3300027543 Bacteria 1300
159 Ga0209813_10002235 3300027866 Bacteria 4418
160 Ga0268266_10001802 3300028379 Bacteria 24277
161 Ga0268266_10038272 3300028379 Bacteria 4083
162 Ga0268265_10005576 3300028380 Bacteria 8592
163 Ga0268265_10007726 3300028380 Bacteria 7257
164 Ga0268265_10120918 3300028380 Bacteria 2157
165 Ga0268264_10000118 3300028381 Bacteria 193487
166 Ga0268264_10053855 3300028381 Bacteria 3358
167 Ga0268264_10280349 3300028381 Bacteria 1561
168 Ga0265337_1012902 3300028556 Bacteria 2823
169 Ga0307517_10162375 3300028786 Bacteria 1495
170 Ga0307513_10019412 3300031456 Bacteria 8093
171 Ga0307408_102349533 3300031548 Bacteria 517
172 Ga0307508_10336236 3300031616 Bacteria 1102
173 Ga0307413_10577056 3300031824 Bacteria 917
174 Ga0307416_100801149 3300032002 Bacteria 1038
175 Ga0307416_103809748 3300032002 Bacteria 505
176 Ga0307414_10724112 3300032004 Bacteria 902
177 Ga0307414_10850058 3300032004 Bacteria 834
178 Ga0307414_10908740 3300032004 Bacteria 807
179 Ga0307415_101032513 3300032126 Bacteria 766
180 Ga0307415_102343828 3300032126 Bacteria 524
181 Ga0307510_10278308 3300033180 Bacteria 1145
182 Ga0373934_0068283 3300035086 Bacteria 1420
183 Ga0373936_0341960 3300035113 Bacteria 680
184 Ga0373955_0016821 3300035172 Bacteria 3606
185 Ga0373927_0634823 3300035695 Bacteria 706
186 Ga0373933_0170832 3300035724 Bacteria 1383
187 Ga0373925_0436851 3300037068 Bacteria 1071
188 Ga0373925_0580240 3300037068 Bacteria 923
189 Ga0395899_0000004 3300037312 Bacteria 874267
190 Ga0395899_0299056 3300037312 Bacteria 1089
191 Ga0395905_0000155 3300037471 Bacteria 112355
192 Ga0395905_0278303 3300037471 Bacteria 1559
193 Ga0395905_0364976 3300037471 Bacteria 1337
194 Ga0395905_0618114 3300037471 Bacteria 985
195 Ga0395905_0817536 3300037471 Bacteria 835
196 Ga0395905_0863764 3300037471 Bacteria 808
197 Ga0436364_0089736 3300037853 Bacteria 533
198 Ga0395901_0981789 3300038443 Bacteria 821
199 Ga0395901_1256902 3300038443 Bacteria 704
200 Ga0436365_0442593 3300039437 Bacteria 1541
201 Ga0436365_0533319 3300039437 Bacteria 1127
202 Ga0436365_1621116 3300039437 Bacteria 10089
203 Ga0436363_0319448 3300039450 Bacteria 3165
204 Ga0436363_1535470 3300039450 Bacteria 682
205 Ga0451847_0836601 3300041503 Bacteria 547
206 Ga0451853_0009959 3300041512 Bacteria 741
207 Ga0466969_0216411 3300044656 Bacteria 872
208 Ga0466961_0403664 3300044693 Bacteria 829
209 Ga0466961_0732028 3300044693 Bacteria 592
210 Ga0466963_1247754 3300044694 Bacteria 522
211 Ga0466959_0025270 3300045049 Bacteria 4401
212 Ga0495629_0020533 3300046459 Bacteria 4717
213 Ga0495583_0074662 3300046506 Bacteria 1484
214 Ga0495606_0056706 3300046507 Bacteria 2527
215 Ga0495606_0451109 3300046507 Bacteria 659
216 Ga0495610_0128255 3300046512 Bacteria 1104
217 Ga0495620_0283159 3300046515 Bacteria 630
218 Ga0495637_0121959 3300046520 Bacteria 1002
219 Ga0495643_0035583 3300046522 Bacteria 2741
220 Ga0495648_0217459 3300046524 Bacteria 945
221 Ga0495642_0053247 3300046528 Bacteria 1667
222 Ga0495654_0121668 3300046530 Bacteria 1181
223 Ga0495597_0002249 3300046542 Bacteria 12585
224 Ga0495668_0218251 3300046616 Bacteria 1044
225 Ga0495657_0619087 3300046675 Bacteria 626
226 Ga0495623_0192599 3300046679 Bacteria 1177
227 Ga0495669_0195765 3300046684 Bacteria 965
228 Ga0495636_0447725 3300047318 Bacteria 620
229 Ga0495672_0226743 3300047320 Bacteria 919
230 Ga0495686_0041698 3300047472 Bacteria 2921
231 Ga0495593_0010024 3300047673 Bacteria 5491
232 Ga0495602_0130765 3300048088 Bacteria 2003
233 Ga0496101_0487173 3300048904 Bacteria 974
234 Ga0496107_1163630 3300048910 Bacteria 555
235 Ga0496108_0135143 3300048911 Bacteria 2121
236 Ga0496110_1274740 3300048913 Bacteria 644
237 Ga0496115_0047668 3300048918 Bacteria 3427
238 Ga0496115_0308332 3300048918 Bacteria 1296
239 Ga0496125_0059223 3300048928 Bacteria 3088
240 Ga0495682_0032030 3300049460 Bacteria 1942
241 Ga0501319_027084 3300049535 Bacteria 539
242 Ga0501033_0250568 3300049570 Bacteria 1255
243 Ga0501034_0836573 3300049571 Bacteria 811
244 Ga0501038_1181230 3300049574 Bacteria 556
245 Ga0501043_0107691 3300049579 Bacteria 2189
246 Ga0501047_0002345 3300049581 Bacteria 18110
247 Ga0501047_0101100 3300049581 Bacteria 2763
248 Ga0501047_0319011 3300049581 Bacteria 1394
249 Ga0501035_0706060 3300049822 Bacteria 813
250 Ga0501044_0640950 3300049823 Bacteria 952
251 Ga0501045_1039151 3300049824 Bacteria 600
252 nmdc:mga03n38_27631_c1 3300050490 Bacteria 2356
253 nmdc:mga00v17_106269_c1 3300050491 Bacteria 1777
254 nmdc:mga0k408_39217_c1 3300050493 Bacteria 2720
255 nmdc:mga06z11_2536_c1 3300050494 Bacteria 6982
256 nmdc:mga04h51_3728_c1 3300050495 Bacteria 3731
257 Ga0495601_0865332 3300053077 Bacteria 572
258 Ga0500578_0158662 3300053086 Bacteria 1405
259 Ga0500643_007450 3300053087 Bacteria 4411
260 Ga0500651_0038526 3300053093 Bacteria 3011
261 Ga0500641_0048501 3300053096 Bacteria 1740
262 Ga0500641_0228536 3300053096 Bacteria 787
263 Ga0500555_017711 3300053103 Bacteria 2052
264 Ga0500556_0028989 3300053104 Bacteria 1862
265 Ga0500562_002340 3300053108 Bacteria 4761
266 Ga0500569_009054 3300053109 Bacteria 2301
267 Ga0500595_056873 3300053119 Bacteria 1193
268 Ga0500608_000023 3300053122 Bacteria 72341
269 Ga0500608_039533 3300053122 Bacteria 2258
270 Ga0500614_021795 3300053123 Bacteria 1489
271 Ga0500642_0092620 3300053130 Bacteria 1398
272 Ga0500658_0112350 3300053134 Bacteria 1200
273 Ga0500559_0021408 3300053136 Bacteria 2740
274 Ga0500620_012808 3300053155 Bacteria 2297
275 Ga0500622_0174313 3300053156 Bacteria 998
276 Ga0500625_050968 3300053729 Bacteria 1911
277 Ga0500645_003553 3300053730 Bacteria 6286
278 Ga0500596_004623 3300053735 Bacteria 2509
279 Ga0501084_0899968 3300054114 Bacteria 744
280 Ga0500661_066360 3300055283 Bacteria 656
281 Ga0587085_163484 3300059506 Bacteria 522
282 Ga0587098_031805 3300059604 Bacteria 730
283 Ga0587076_016423 3300059645 Bacteria 1168
284 Ga0587114_091725 3300059655 Bacteria 580
285 Ga0501082_0538019 3300060353 Bacteria 1022
286 Ga0466962_0368646 3300061719 Bacteria 716
287 Ga0466962_0610139 3300061719 Bacteria 556

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10916925 Ga0105248_109169251 105
2 3300035086 Ga0373934_0068283 Ga0373934_0068283_56_394 107
3 3300035172 Ga0373955_0016821 Ga0373955_0016821_2489_2827 107
4 3300035724 Ga0373933_0170832 Ga0373933_0170832_917_1255 107
5 3300048911 Ga0496108_0135143 Ga0496108_0135143_1601_1936 107
6 3300053077 Ga0495601_0865332 Ga0495601_0865332_29_367 107
7 3300049571 Ga0501034_0836573 Ga0501034_0836573_387_722 108
8 iso_pu_bacteria 2739367756 2739793296 108
9 3300003320 rootH2_10039664 rootH2_100396643 109
10 3300037471 Ga0395905_0000155 Ga0395905_0000155_587_916 109
11 3300044693 Ga0466961_0403664 Ga0466961_0403664_384_713 109
12 3300045049 Ga0466959_0025270 Ga0466959_0025270_873_1202 109
13 3300049570 Ga0501033_0250568 Ga0501033_0250568_101_430 109
14 3300049579 Ga0501043_0107691 Ga0501043_0107691_1354_1683 109
15 3300049581 Ga0501047_0101100 Ga0501047_0101100_910_1239 109
16 3300049822 Ga0501035_0706060 Ga0501035_0706060_418_747 109
17 3300049824 Ga0501045_1039151 Ga0501045_1039151_226_561 109
18 3300054114 Ga0501084_0899968 Ga0501084_0899968_252_581 109
19 3300061719 Ga0466962_0368646 Ga0466962_0368646_166_495 109
20 3300061719 Ga0466962_0610139 Ga0466962_0610139_106_435 109
21 iso_pu_bacteria 2857504554 2857507450 109
22 iso_pu_bacteria 2643221614 2644088228 110
23 iso_pu_bacteria 2643221661 2644343466 110
24 iso_pu_bacteria 2643221666 2644369057 110
25 3300005841 Ga0068863_100572140 Ga0068863_1005721402 111
26 3300009177 Ga0105248_11936410 Ga0105248_119364102 111
27 3300003781 Ga0055536_1002376 Ga0055536_10023768 113
28 3300003791 Ga0055530_10002842 Ga0055530_100028428 113
29 3300003792 Ga0055540_1017606 Ga0055540_10176062 113
30 3300005364 Ga0070673_101449397 Ga0070673_1014493971 113
31 3300005458 Ga0070681_11247031 Ga0070681_112470311 113
32 3300005616 Ga0068852_100540463 Ga0068852_1005404632 113
33 3300006042 Ga0075368_10007687 Ga0075368_100076872 113
34 3300006048 Ga0075363_100053494 Ga0075363_1000534942 113
35 3300006051 Ga0075364_10046198 Ga0075364_100461983 113
36 3300006178 Ga0075367_10021752 Ga0075367_100217524 113
37 3300006195 Ga0075366_10040777 Ga0075366_100407771 113
38 3300006353 Ga0075370_10127762 Ga0075370_101277623 113
39 3300009011 Ga0105251_10547945 Ga0105251_105479451 113
40 3300009093 Ga0105240_10005291 Ga0105240_100052912 113
41 3300009177 Ga0105248_11368029 Ga0105248_113680291 113
42 3300025292 Ga0209676_1000134 Ga0209676_1000134161 113
43 3300025298 Ga0209050_1000348 Ga0209050_10003489 113
44 3300025303 Ga0209051_1032528 Ga0209051_10325283 113
45 3300025304 Ga0209257_1011554 Ga0209257_10115545 113
46 3300025903 Ga0207680_10194167 Ga0207680_101941672 113
47 3300025912 Ga0207707_10916322 Ga0207707_109163222 113
48 3300025913 Ga0207695_10006230 Ga0207695_1000623014 113
49 3300025921 Ga0207652_10335117 Ga0207652_103351172 113
50 3300025924 Ga0207694_10637086 Ga0207694_106370861 113
51 3300027866 Ga0209813_10002235 Ga0209813_100022355 113
52 3300031456 Ga0307513_10019412 Ga0307513_100194127 113
53 3300037068 Ga0373925_0436851 Ga0373925_0436851_199_543 113
54 3300037312 Ga0395899_0000004 Ga0395899_0000004_526831_527172 113
55 3300037471 Ga0395905_0618114 Ga0395905_0618114_617_961 113
56 3300039450 Ga0436363_0319448 Ga0436363_0319448_1439_1789 113
57 3300041512 Ga0451853_0009959 Ga0451853_0009959_22_363 113
58 3300044656 Ga0466969_0216411 Ga0466969_0216411_56_409 113
59 3300044693 Ga0466961_0732028 Ga0466961_0732028_28_369 113
60 3300048918 Ga0496115_0047668 Ga0496115_0047668_2352_2693 113
61 3300050490 nmdc:mga03n38_27631_c1 nmdc:mga03n38_27631_c1_1363_1707 113
62 3300050491 nmdc:mga00v17_106269_c1 nmdc:mga00v17_106269_c1_388_732 113
63 3300050493 nmdc:mga0k408_39217_c1 nmdc:mga0k408_39217_c1_165_509 113
64 3300050494 nmdc:mga06z11_2536_c1 nmdc:mga06z11_2536_c1_3887_4231 113
65 3300050495 nmdc:mga04h51_3728_c1 nmdc:mga04h51_3728_c1_613_957 113
66 3300053096 Ga0500641_0228536 Ga0500641_0228536_162_503 113
67 3300053122 Ga0500608_000023 Ga0500608_000023_50360_50701 113
68 3300053136 Ga0500559_0021408 Ga0500559_0021408_2001_2342 113
69 3300059655 Ga0587114_091725 Ga0587114_091725_103_447 113
70 3300002741 JGI25157J39369_1015639 JGI25157J39369_10156392 114
71 3300003215 JGI25153J46596_10058825 JGI25153J46596_100588253 114
72 3300003791 Ga0055530_10002837 Ga0055530_1000283713 114
73 3300003794 Ga0055531_10004719 Ga0055531_100047195 114
74 3300003794 Ga0055531_10016968 Ga0055531_100169685 114
75 3300004799 Ga0058863_11865640 Ga0058863_118656401 114
76 3300005262 Ga0065165_1000041 Ga0065165_100004125 114
77 3300005262 Ga0065165_1014074 Ga0065165_10140747 114
78 3300005331 Ga0070670_100000101 Ga0070670_1000001012 114
79 3300005331 Ga0070670_100269519 Ga0070670_1002695191 114
80 3300005335 Ga0070666_10022439 Ga0070666_100224393 114
81 3300005347 Ga0070668_100002639 Ga0070668_1000026394 114
82 3300005347 Ga0070668_100005564 Ga0070668_10000556410 114
83 3300005347 Ga0070668_100010442 Ga0070668_1000104427 114
84 3300005347 Ga0070668_100024530 Ga0070668_1000245305 114
85 3300005353 Ga0070669_100063567 Ga0070669_1000635673 114
86 3300005353 Ga0070669_100399692 Ga0070669_1003996921 114
87 3300005353 Ga0070669_100428462 Ga0070669_1004284622 114
88 3300005355 Ga0070671_100239804 Ga0070671_1002398043 114
89 3300005366 Ga0070659_100016461 Ga0070659_1000164614 114
90 3300005366 Ga0070659_100675441 Ga0070659_1006754412 114
91 3300005367 Ga0070667_100000260 Ga0070667_10000026010 114
92 3300005367 Ga0070667_100005932 Ga0070667_10000593211 114
93 3300005367 Ga0070667_100094806 Ga0070667_1000948064 114
94 3300005457 Ga0070662_100350139 Ga0070662_1003501392 114
95 3300005530 Ga0070679_100465356 Ga0070679_1004653563 114
96 3300005539 Ga0068853_100031562 Ga0068853_1000315624 114
97 3300005548 Ga0070665_100002230 Ga0070665_10000223018 114
98 3300005548 Ga0070665_100010548 Ga0070665_1000105484 114
99 3300005563 Ga0068855_100478039 Ga0068855_1004780393 114
100 3300005563 Ga0068855_100512844 Ga0068855_1005128443 114
101 3300005564 Ga0070664_101723367 Ga0070664_1017233672 114
102 3300005564 Ga0070664_102366199 Ga0070664_1023661991 114
103 3300005616 Ga0068852_102064932 Ga0068852_1020649321 114
104 3300005617 Ga0068859_100016312 Ga0068859_1000163125 114
105 3300005617 Ga0068859_100070405 Ga0068859_1000704051 114
106 3300005618 Ga0068864_100000496 Ga0068864_1000004966 114
107 3300005719 Ga0068861_100031213 Ga0068861_1000312133 114
108 3300005841 Ga0068863_100001649 Ga0068863_10000164916 114
109 3300005841 Ga0068863_100009904 Ga0068863_1000099048 114
110 3300005841 Ga0068863_100113685 Ga0068863_1001136853 114
111 3300005841 Ga0068863_100297948 Ga0068863_1002979482 114
112 3300005842 Ga0068858_100036068 Ga0068858_1000360684 114
113 3300005843 Ga0068860_100000309 Ga0068860_10000030954 114
114 3300005843 Ga0068860_100090219 Ga0068860_1000902195 114
115 3300005843 Ga0068860_100176382 Ga0068860_1001763823 114
116 3300005843 Ga0068860_100655763 Ga0068860_1006557632 114
117 3300005844 Ga0068862_100001520 Ga0068862_10000152017 114
118 3300005844 Ga0068862_100014608 Ga0068862_1000146087 114
119 3300005844 Ga0068862_100205590 Ga0068862_1002055901 114
120 3300005844 Ga0068862_100319113 Ga0068862_1003191132 114
121 3300006028 Ga0070717_11218822 Ga0070717_112188222 114
122 3300006178 Ga0075367_10799489 Ga0075367_107994892 114
123 3300006931 Ga0097620_100016312 Ga0097620_1000163125 114
124 3300006931 Ga0097620_100070407 Ga0097620_1000704071 114
125 3300009101 Ga0105247_10033731 Ga0105247_100337311 114
126 3300009174 Ga0105241_10806132 Ga0105241_108061322 114
127 3300009176 Ga0105242_10780666 Ga0105242_107806662 114
128 3300009177 Ga0105248_10002557 Ga0105248_1000255712 114
129 3300009177 Ga0105248_10072017 Ga0105248_100720175 114
130 3300009177 Ga0105248_13397708 Ga0105248_133977082 114
131 3300009551 Ga0105238_10182063 Ga0105238_101820633 114
132 3300009551 Ga0105238_10434712 Ga0105238_104347122 114
133 3300009551 Ga0105238_11690145 Ga0105238_116901452 114
134 3300009551 Ga0105238_12885993 Ga0105238_128859932 114
135 3300009553 Ga0105249_10005538 Ga0105249_100055385 114
136 3300009553 Ga0105249_10057270 Ga0105249_100572702 114
137 3300009553 Ga0105249_10062995 Ga0105249_100629952 114
138 3300010375 Ga0105239_12272041 Ga0105239_122720412 114
139 3300013100 Ga0157373_10010739 Ga0157373_100107393 114
140 3300013100 Ga0157373_10015966 Ga0157373_100159665 114
141 3300013307 Ga0157372_11501392 Ga0157372_115013921 114
142 3300014968 Ga0157379_10000373 Ga0157379_100003735 114
143 3300014969 Ga0157376_11338580 Ga0157376_113385802 114
144 3300021384 Ga0213876_10179981 Ga0213876_101799812 114
145 3300025250 Ga0209026_1001465 Ga0209026_10014657 114
146 3300025297 Ga0209758_1000555 Ga0209758_100055539 114
147 3300025298 Ga0209050_1000034 Ga0209050_1000034229 114
148 3300025298 Ga0209050_1091694 Ga0209050_10916941 114
149 3300025304 Ga0209257_1000052 Ga0209257_1000052181 114
150 3300025304 Ga0209257_1000100 Ga0209257_100010046 114
151 3300025304 Ga0209257_1000618 Ga0209257_100061829 114
152 3300025900 Ga0207710_10026634 Ga0207710_100266342 114
153 3300025903 Ga0207680_10070471 Ga0207680_100704713 114
154 3300025903 Ga0207680_10807669 Ga0207680_108076692 114
155 3300025904 Ga0207647_10075282 Ga0207647_100752821 114
156 3300025911 Ga0207654_10164337 Ga0207654_101643372 114
157 3300025913 Ga0207695_10184676 Ga0207695_101846761 114
158 3300025923 Ga0207681_10072247 Ga0207681_100722473 114
159 3300025923 Ga0207681_10416752 Ga0207681_104167523 114
160 3300025923 Ga0207681_10934339 Ga0207681_109343391 114
161 3300025924 Ga0207694_10364442 Ga0207694_103644423 114
162 3300025924 Ga0207694_10784939 Ga0207694_107849392 114
163 3300025925 Ga0207650_10000064 Ga0207650_100000642 114
164 3300025925 Ga0207650_10218958 Ga0207650_102189582 114
165 3300025932 Ga0207690_10011314 Ga0207690_100113143 114
166 3300025932 Ga0207690_10556274 Ga0207690_105562742 114
167 3300025933 Ga0207706_10312591 Ga0207706_103125913 114
168 3300025941 Ga0207711_10001318 Ga0207711_1000131811 114
169 3300025941 Ga0207711_10039945 Ga0207711_100399454 114
170 3300025941 Ga0207711_12113142 Ga0207711_121131421 114
171 3300025945 Ga0207679_11507235 Ga0207679_115072352 114
172 3300025949 Ga0207667_10108602 Ga0207667_101086022 114
173 3300025949 Ga0207667_11264852 Ga0207667_112648522 114
174 3300025949 Ga0207667_11289525 Ga0207667_112895252 114
175 3300025961 Ga0207712_10000569 Ga0207712_100005699 114
176 3300025961 Ga0207712_10110258 Ga0207712_101102583 114
177 3300025961 Ga0207712_10632482 Ga0207712_106324822 114
178 3300025972 Ga0207668_10000003 Ga0207668_1000000366 114
179 3300025972 Ga0207668_10000678 Ga0207668_1000067815 114
180 3300025972 Ga0207668_10016025 Ga0207668_100160255 114
181 3300025972 Ga0207668_10068169 Ga0207668_100681692 114
182 3300025986 Ga0207658_10000470 Ga0207658_1000047032 114
183 3300025986 Ga0207658_10005614 Ga0207658_100056144 114
184 3300025986 Ga0207658_10339877 Ga0207658_103398772 114
185 3300026035 Ga0207703_10025799 Ga0207703_100257995 114
186 3300026041 Ga0207639_10013969 Ga0207639_100139695 114
187 3300026041 Ga0207639_10361149 Ga0207639_103611492 114
188 3300026041 Ga0207639_10865306 Ga0207639_108653061 114
189 3300026041 Ga0207639_11453453 Ga0207639_114534531 114
190 3300026078 Ga0207702_11302774 Ga0207702_113027742 114
191 3300026088 Ga0207641_10002399 Ga0207641_1000239912 114
192 3300026088 Ga0207641_10224075 Ga0207641_102240753 114
193 3300026088 Ga0207641_10386205 Ga0207641_103862052 114
194 3300026095 Ga0207676_10000285 Ga0207676_1000028531 114
195 3300026095 Ga0207676_10107829 Ga0207676_101078293 114
196 3300026118 Ga0207675_100082509 Ga0207675_1000825093 114
197 3300026142 Ga0207698_11832509 Ga0207698_118325091 114
198 3300027378 Ga0209981_1000340 Ga0209981_10003406 114
199 3300027543 Ga0209999_1017729 Ga0209999_10177291 114
200 3300028379 Ga0268266_10001802 Ga0268266_1000180221 114
201 3300028379 Ga0268266_10038272 Ga0268266_100382724 114
202 3300028380 Ga0268265_10005576 Ga0268265_100055764 114
203 3300028380 Ga0268265_10007726 Ga0268265_100077263 114
204 3300028380 Ga0268265_10120918 Ga0268265_101209183 114
205 3300028381 Ga0268264_10000118 Ga0268264_1000011869 114
206 3300028381 Ga0268264_10053855 Ga0268264_100538554 114
207 3300028381 Ga0268264_10280349 Ga0268264_102803492 114
208 3300028556 Ga0265337_1012902 Ga0265337_10129022 114
209 3300028786 Ga0307517_10162375 Ga0307517_101623753 114
210 3300031548 Ga0307408_102349533 Ga0307408_1023495331 114
211 3300031616 Ga0307508_10336236 Ga0307508_103362362 114
212 3300031824 Ga0307413_10577056 Ga0307413_105770562 114
213 3300032002 Ga0307416_100801149 Ga0307416_1008011491 114
214 3300032002 Ga0307416_103809748 Ga0307416_1038097481 114
215 3300032004 Ga0307414_10724112 Ga0307414_107241122 114
216 3300032004 Ga0307414_10850058 Ga0307414_108500582 114
217 3300032004 Ga0307414_10908740 Ga0307414_109087401 114
218 3300032126 Ga0307415_101032513 Ga0307415_1010325132 114
219 3300032126 Ga0307415_102343828 Ga0307415_1023438281 114
220 3300033180 Ga0307510_10278308 Ga0307510_102783082 114
221 3300035113 Ga0373936_0341960 Ga0373936_0341960_77_469 114
222 3300035695 Ga0373927_0634823 Ga0373927_0634823_99_491 114
223 3300037068 Ga0373925_0580240 Ga0373925_0580240_436_780 114
224 3300037312 Ga0395899_0299056 Ga0395899_0299056_393_749 114
225 3300037471 Ga0395905_0278303 Ga0395905_0278303_238_582 114
226 3300037471 Ga0395905_0364976 Ga0395905_0364976_168_512 114
227 3300037471 Ga0395905_0817536 Ga0395905_0817536_115_459 114
228 3300037471 Ga0395905_0863764 Ga0395905_0863764_376_720 114
229 3300037853 Ga0436364_0089736 Ga0436364_0089736_152_505 114
230 3300038443 Ga0395901_0981789 Ga0395901_0981789_269_625 114
231 3300038443 Ga0395901_1256902 Ga0395901_1256902_185_529 114
232 3300039437 Ga0436365_0442593 Ga0436365_0442593_1143_1490 114
233 3300039437 Ga0436365_0533319 Ga0436365_0533319_54_410 114
234 3300039437 Ga0436365_1621116 Ga0436365_1621116_5547_5891 114
235 3300039450 Ga0436363_1535470 Ga0436363_1535470_255_608 114
236 3300041503 Ga0451847_0836601 Ga0451847_0836601_89_433 114
237 3300044694 Ga0466963_1247754 Ga0466963_1247754_133_477 114
238 3300046459 Ga0495629_0020533 Ga0495629_0020533_1140_1484 114
239 3300046506 Ga0495583_0074662 Ga0495583_0074662_303_647 114
240 3300046507 Ga0495606_0056706 Ga0495606_0056706_538_882 114
241 3300046507 Ga0495606_0451109 Ga0495606_0451109_203_550 114
242 3300046512 Ga0495610_0128255 Ga0495610_0128255_375_719 114
243 3300046515 Ga0495620_0283159 Ga0495620_0283159_224_568 114
244 3300046520 Ga0495637_0121959 Ga0495637_0121959_341_685 114
245 3300046522 Ga0495643_0035583 Ga0495643_0035583_1357_1701 114
246 3300046524 Ga0495648_0217459 Ga0495648_0217459_52_399 114
247 3300046528 Ga0495642_0053247 Ga0495642_0053247_183_530 114
248 3300046530 Ga0495654_0121668 Ga0495654_0121668_408_752 114
249 3300046542 Ga0495597_0002249 Ga0495597_0002249_4966_5310 114
250 3300046616 Ga0495668_0218251 Ga0495668_0218251_651_995 114
251 3300046675 Ga0495657_0619087 Ga0495657_0619087_137_490 114
252 3300046679 Ga0495623_0192599 Ga0495623_0192599_668_1015 114
253 3300046684 Ga0495669_0195765 Ga0495669_0195765_500_847 114
254 3300047318 Ga0495636_0447725 Ga0495636_0447725_123_479 114
255 3300047320 Ga0495672_0226743 Ga0495672_0226743_557_904 114
256 3300047472 Ga0495686_0041698 Ga0495686_0041698_1584_1928 114
257 3300047673 Ga0495593_0010024 Ga0495593_0010024_4718_5062 114
258 3300048088 Ga0495602_0130765 Ga0495602_0130765_675_1019 114
259 3300048904 Ga0496101_0487173 Ga0496101_0487173_222_566 114
260 3300048910 Ga0496107_1163630 Ga0496107_1163630_92_436 114
261 3300048913 Ga0496110_1274740 Ga0496110_1274740_254_598 114
262 3300048918 Ga0496115_0308332 Ga0496115_0308332_493_837 114
263 3300048928 Ga0496125_0059223 Ga0496125_0059223_1291_1635 114
264 3300049460 Ga0495682_0032030 Ga0495682_0032030_945_1289 114
265 3300049535 Ga0501319_027084 Ga0501319_027084_10_354 114
266 3300049574 Ga0501038_1181230 Ga0501038_1181230_160_510 114
267 3300049581 Ga0501047_0002345 Ga0501047_0002345_15130_15474 114
268 3300049581 Ga0501047_0319011 Ga0501047_0319011_323_673 114
269 3300049823 Ga0501044_0640950 Ga0501044_0640950_148_498 114
270 3300053086 Ga0500578_0158662 Ga0500578_0158662_726_1070 114
271 3300053087 Ga0500643_007450 Ga0500643_007450_3328_3672 114
272 3300053093 Ga0500651_0038526 Ga0500651_0038526_1851_2195 114
273 3300053096 Ga0500641_0048501 Ga0500641_0048501_924_1268 114
274 3300053103 Ga0500555_017711 Ga0500555_017711_1166_1510 114
275 3300053104 Ga0500556_0028989 Ga0500556_0028989_491_835 114
276 3300053108 Ga0500562_002340 Ga0500562_002340_3193_3537 114
277 3300053109 Ga0500569_009054 Ga0500569_009054_803_1147 114
278 3300053119 Ga0500595_056873 Ga0500595_056873_35_379 114
279 3300053122 Ga0500608_039533 Ga0500608_039533_354_698 114
280 3300053123 Ga0500614_021795 Ga0500614_021795_578_922 114
281 3300053130 Ga0500642_0092620 Ga0500642_0092620_851_1195 114
282 3300053134 Ga0500658_0112350 Ga0500658_0112350_222_566 114
283 3300053155 Ga0500620_012808 Ga0500620_012808_706_1050 114
284 3300053156 Ga0500622_0174313 Ga0500622_0174313_562_930 114
285 3300053729 Ga0500625_050968 Ga0500625_050968_989_1333 114
286 3300053730 Ga0500645_003553 Ga0500645_003553_3449_3793 114
287 3300053735 Ga0500596_004623 Ga0500596_004623_1165_1509 114
288 3300055283 Ga0500661_066360 Ga0500661_066360_90_434 114
289 3300059506 Ga0587085_163484 Ga0587085_163484_54_401 114
290 3300059604 Ga0587098_031805 Ga0587098_031805_198_545 114
291 3300059645 Ga0587076_016423 Ga0587076_016423_634_981 114
292 3300060353 Ga0501082_0538019 Ga0501082_0538019_232_582 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

25

89

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9665 9 108
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9589 11 114
3zyw-assembly1.cif.gz_A crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) 0.9506 10 104
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9504 7 114
5y4u-assembly1.cif.gz_A crystal structure of grx domain of grx3 from saccharomyces cerevisiae 0.9325 13 105
ID Description Score Start End Superfamily
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9885 14 104 3.40.30.10
af_O97232_76_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9879 14 104 3.40.30.10
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.982 15 100 3.40.30.10
af_Q8IBZ7_179_272_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9808 16 104 3.40.30.10
2wemC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9796 14 108 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A529M835-F1-model_v4 Grx4 family monothiol glutaredoxin 1.005 10 96 GO:0015036
GO:0046872
GO:0051537
AF-A0A7Z3DX47-F1-model_v4 Glutaredoxin 1.002 11 113 GO:0015036
GO:0046872
GO:0051537
AF-A0A1Q3VZN9-F1-model_v4 Glutaredoxin 1.001 10 112 GO:0015036
GO:0046872
GO:0051537
AF-A0A5M8P6P4-F1-model_v4 Glutaredoxin 1.001 9 114 GO:0015036
GO:0046872
GO:0051537
AF-A0A1F8ISA2-F1-model_v4 deleted 1.001 14 111

Feature Viewer

pLDDT pTM Quality
91.42 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map