F391198
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 193 | 287 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300049824|Ga0501045_1039151|Ga0501045_1039151_226_561 |
| Length | 111 |
| Sequence | MSDTITMSEQEILDQIQSEVADNRVFLYMKGTPEMPRCGFSNQVVQILNHMGVEYGARDILVDPRIRMVLSEWSEWPTIPQLFVDGKLVGGCDIVTEMFQDGELKELLDTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 2 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 3 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 4 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 5 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 101 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 102 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 109 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 111 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 116 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 117 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 118 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 119 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 122 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 150 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 151 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 162 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 163 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 164 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 165 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 166 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 168 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 169 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 170 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 171 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 172 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 173 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 174 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 175 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 176 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 177 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 178 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 179 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 180 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 181 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 182 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 183 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 184 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 185 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 186 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 188 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.23 |
| Metatranscriptomes | 2.05 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.49 |
| Nodule | 0 |
| Rhizoplane | 2.05 |
| Rhizosphere | 71.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1015639 | 3300002741 | Bacteria | 933 |
| 2 | JGI25153J46596_10058825 | 3300003215 | Bacteria | 1055 |
| 3 | rootH2_10039664 | 3300003320 | Bacteria | 5223 |
| 4 | Ga0055536_1002376 | 3300003781 | Bacteria | 10616 |
| 5 | Ga0055530_10002837 | 3300003791 | Bacteria | 10598 |
| 6 | Ga0055530_10002842 | 3300003791 | Bacteria | 10588 |
| 7 | Ga0055540_1017606 | 3300003792 | Bacteria | 1988 |
| 8 | Ga0055531_10004719 | 3300003794 | Bacteria | 8152 |
| 9 | Ga0055531_10016968 | 3300003794 | Bacteria | 3104 |
| 10 | Ga0058863_11865640 | 3300004799 | Bacteria | 586 |
| 11 | Ga0065165_1000041 | 3300005262 | Bacteria | 203876 |
| 12 | Ga0065165_1014074 | 3300005262 | Bacteria | 3124 |
| 13 | Ga0070670_100000101 | 3300005331 | Bacteria | 79628 |
| 14 | Ga0070670_100269519 | 3300005331 | Bacteria | 1485 |
| 15 | Ga0070666_10022439 | 3300005335 | Bacteria | 4098 |
| 16 | Ga0070668_100002639 | 3300005347 | Bacteria | 13171 |
| 17 | Ga0070668_100005564 | 3300005347 | Bacteria | 9352 |
| 18 | Ga0070668_100010442 | 3300005347 | Bacteria | 6900 |
| 19 | Ga0070668_100024530 | 3300005347 | Bacteria | 4570 |
| 20 | Ga0070669_100063567 | 3300005353 | Bacteria | 2717 |
| 21 | Ga0070669_100399692 | 3300005353 | Bacteria | 1124 |
| 22 | Ga0070669_100428462 | 3300005353 | Bacteria | 1087 |
| 23 | Ga0070671_100239804 | 3300005355 | Bacteria | 1539 |
| 24 | Ga0070673_101449397 | 3300005364 | Bacteria | 647 |
| 25 | Ga0070659_100016461 | 3300005366 | Bacteria | 5552 |
| 26 | Ga0070659_100675441 | 3300005366 | Bacteria | 892 |
| 27 | Ga0070667_100000260 | 3300005367 | Bacteria | 60154 |
| 28 | Ga0070667_100005932 | 3300005367 | Bacteria | 10170 |
| 29 | Ga0070667_100094806 | 3300005367 | Bacteria | 2572 |
| 30 | Ga0070662_100350139 | 3300005457 | Bacteria | 1210 |
| 31 | Ga0070681_11247031 | 3300005458 | Bacteria | 666 |
| 32 | Ga0070679_100465356 | 3300005530 | Bacteria | 1209 |
| 33 | Ga0068853_100031562 | 3300005539 | Bacteria | 4481 |
| 34 | Ga0070665_100002230 | 3300005548 | Bacteria | 21591 |
| 35 | Ga0070665_100010548 | 3300005548 | Bacteria | 9352 |
| 36 | Ga0068855_100478039 | 3300005563 | Bacteria | 1357 |
| 37 | Ga0068855_100512844 | 3300005563 | Bacteria | 1302 |
| 38 | Ga0070664_101723367 | 3300005564 | Bacteria | 594 |
| 39 | Ga0070664_102366199 | 3300005564 | Bacteria | 504 |
| 40 | Ga0068852_100540463 | 3300005616 | Bacteria | 1165 |
| 41 | Ga0068852_102064932 | 3300005616 | Bacteria | 592 |
| 42 | Ga0068859_100016312 | 3300005617 | Bacteria | 7462 |
| 43 | Ga0068859_100070405 | 3300005617 | Bacteria | 3533 |
| 44 | Ga0068864_100000496 | 3300005618 | Bacteria | 33880 |
| 45 | Ga0068861_100031213 | 3300005719 | Bacteria | 3912 |
| 46 | Ga0068863_100001649 | 3300005841 | Bacteria | 22078 |
| 47 | Ga0068863_100009904 | 3300005841 | Bacteria | 9281 |
| 48 | Ga0068863_100113685 | 3300005841 | Bacteria | 2579 |
| 49 | Ga0068863_100297948 | 3300005841 | Bacteria | 1564 |
| 50 | Ga0068863_100572140 | 3300005841 | Bacteria | 1117 |
| 51 | Ga0068858_100036068 | 3300005842 | Bacteria | 4585 |
| 52 | Ga0068860_100000309 | 3300005843 | Bacteria | 67252 |
| 53 | Ga0068860_100090219 | 3300005843 | Bacteria | 2919 |
| 54 | Ga0068860_100176382 | 3300005843 | Bacteria | 2065 |
| 55 | Ga0068860_100655763 | 3300005843 | Bacteria | 1057 |
| 56 | Ga0068862_100001520 | 3300005844 | Bacteria | 21267 |
| 57 | Ga0068862_100014608 | 3300005844 | Bacteria | 6520 |
| 58 | Ga0068862_100205590 | 3300005844 | Bacteria | 1777 |
| 59 | Ga0068862_100319113 | 3300005844 | Bacteria | 1433 |
| 60 | Ga0070717_11218822 | 3300006028 | Bacteria | 685 |
| 61 | Ga0075368_10007687 | 3300006042 | Bacteria | 3811 |
| 62 | Ga0075363_100053494 | 3300006048 | Bacteria | 2157 |
| 63 | Ga0075364_10046198 | 3300006051 | Bacteria | 2835 |
| 64 | Ga0075367_10021752 | 3300006178 | Bacteria | 3589 |
| 65 | Ga0075367_10799489 | 3300006178 | Bacteria | 601 |
| 66 | Ga0075366_10040777 | 3300006195 | Bacteria | 2747 |
| 67 | Ga0075370_10127762 | 3300006353 | Bacteria | 1482 |
| 68 | Ga0097620_100016312 | 3300006931 | Bacteria | 7462 |
| 69 | Ga0097620_100070407 | 3300006931 | Bacteria | 3533 |
| 70 | Ga0105251_10547945 | 3300009011 | Bacteria | 545 |
| 71 | Ga0105240_10005291 | 3300009093 | Bacteria | 19267 |
| 72 | Ga0105247_10033731 | 3300009101 | Bacteria | 3115 |
| 73 | Ga0105241_10806132 | 3300009174 | Bacteria | 865 |
| 74 | Ga0105242_10780666 | 3300009176 | Bacteria | 943 |
| 75 | Ga0105248_10002557 | 3300009177 | Bacteria | 20245 |
| 76 | Ga0105248_10072017 | 3300009177 | Bacteria | 3884 |
| 77 | Ga0105248_10916925 | 3300009177 | Bacteria | 989 |
| 78 | Ga0105248_11368029 | 3300009177 | Bacteria | 801 |
| 79 | Ga0105248_11936410 | 3300009177 | Bacteria | 669 |
| 80 | Ga0105248_13397708 | 3300009177 | Bacteria | 506 |
| 81 | Ga0105238_10182063 | 3300009551 | Bacteria | 2078 |
| 82 | Ga0105238_10434712 | 3300009551 | Bacteria | 1308 |
| 83 | Ga0105238_11690145 | 3300009551 | Bacteria | 664 |
| 84 | Ga0105238_12885993 | 3300009551 | Bacteria | 517 |
| 85 | Ga0105249_10005538 | 3300009553 | Bacteria | 10915 |
| 86 | Ga0105249_10057270 | 3300009553 | Bacteria | 3570 |
| 87 | Ga0105249_10062995 | 3300009553 | Bacteria | 3405 |
| 88 | Ga0105239_12272041 | 3300010375 | Bacteria | 631 |
| 89 | Ga0157373_10010739 | 3300013100 | Bacteria | 6738 |
| 90 | Ga0157373_10015966 | 3300013100 | Bacteria | 5483 |
| 91 | Ga0157372_11501392 | 3300013307 | Bacteria | 776 |
| 92 | Ga0157379_10000373 | 3300014968 | Bacteria | 36116 |
| 93 | Ga0157376_11338580 | 3300014969 | Bacteria | 747 |
| 94 | Ga0213876_10179981 | 3300021384 | Bacteria | 1124 |
| 95 | Ga0209026_1001465 | 3300025250 | Bacteria | 10416 |
| 96 | Ga0209676_1000134 | 3300025292 | Bacteria | 183222 |
| 97 | Ga0209758_1000555 | 3300025297 | Bacteria | 59166 |
| 98 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 99 | Ga0209050_1000348 | 3300025298 | Bacteria | 90399 |
| 100 | Ga0209050_1091694 | 3300025298 | Bacteria | 621 |
| 101 | Ga0209051_1032528 | 3300025303 | Bacteria | 1988 |
| 102 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 103 | Ga0209257_1000100 | 3300025304 | Bacteria | 253399 |
| 104 | Ga0209257_1000618 | 3300025304 | Bacteria | 57657 |
| 105 | Ga0209257_1011554 | 3300025304 | Bacteria | 4232 |
| 106 | Ga0207710_10026634 | 3300025900 | Bacteria | 2499 |
| 107 | Ga0207680_10070471 | 3300025903 | Bacteria | 2164 |
| 108 | Ga0207680_10194167 | 3300025903 | Bacteria | 1380 |
| 109 | Ga0207680_10807669 | 3300025903 | Bacteria | 672 |
| 110 | Ga0207647_10075282 | 3300025904 | Bacteria | 2032 |
| 111 | Ga0207654_10164337 | 3300025911 | Bacteria | 1436 |
| 112 | Ga0207707_10916322 | 3300025912 | Bacteria | 724 |
| 113 | Ga0207695_10006230 | 3300025913 | Bacteria | 15536 |
| 114 | Ga0207695_10184676 | 3300025913 | Bacteria | 2005 |
| 115 | Ga0207652_10335117 | 3300025921 | Bacteria | 1366 |
| 116 | Ga0207681_10072247 | 3300025923 | Bacteria | 2409 |
| 117 | Ga0207681_10416752 | 3300025923 | Bacteria | 1087 |
| 118 | Ga0207681_10934339 | 3300025923 | Bacteria | 727 |
| 119 | Ga0207694_10364442 | 3300025924 | Bacteria | 1198 |
| 120 | Ga0207694_10637086 | 3300025924 | Bacteria | 898 |
| 121 | Ga0207694_10784939 | 3300025924 | Bacteria | 804 |
| 122 | Ga0207650_10000064 | 3300025925 | Bacteria | 142969 |
| 123 | Ga0207650_10218958 | 3300025925 | Bacteria | 1531 |
| 124 | Ga0207690_10011314 | 3300025932 | Bacteria | 5333 |
| 125 | Ga0207690_10556274 | 3300025932 | Bacteria | 933 |
| 126 | Ga0207706_10312591 | 3300025933 | Bacteria | 1368 |
| 127 | Ga0207711_10001318 | 3300025941 | Bacteria | 23485 |
| 128 | Ga0207711_10039945 | 3300025941 | Bacteria | 3991 |
| 129 | Ga0207711_12113142 | 3300025941 | Bacteria | 506 |
| 130 | Ga0207679_11507235 | 3300025945 | Bacteria | 617 |
| 131 | Ga0207667_10108602 | 3300025949 | Bacteria | 2862 |
| 132 | Ga0207667_11264852 | 3300025949 | Bacteria | 715 |
| 133 | Ga0207667_11289525 | 3300025949 | Bacteria | 707 |
| 134 | Ga0207712_10000569 | 3300025961 | Bacteria | 29784 |
| 135 | Ga0207712_10110258 | 3300025961 | Bacteria | 2063 |
| 136 | Ga0207712_10632482 | 3300025961 | Bacteria | 928 |
| 137 | Ga0207668_10000003 | 3300025972 | Bacteria | 206959 |
| 138 | Ga0207668_10000678 | 3300025972 | Bacteria | 20916 |
| 139 | Ga0207668_10016025 | 3300025972 | Bacteria | 4669 |
| 140 | Ga0207668_10068169 | 3300025972 | Bacteria | 2528 |
| 141 | Ga0207658_10000470 | 3300025986 | Bacteria | 37577 |
| 142 | Ga0207658_10005614 | 3300025986 | Bacteria | 8580 |
| 143 | Ga0207658_10339877 | 3300025986 | Bacteria | 1304 |
| 144 | Ga0207703_10025799 | 3300026035 | Bacteria | 4625 |
| 145 | Ga0207639_10013969 | 3300026041 | Bacteria | 5634 |
| 146 | Ga0207639_10361149 | 3300026041 | Bacteria | 1300 |
| 147 | Ga0207639_10865306 | 3300026041 | Bacteria | 844 |
| 148 | Ga0207639_11453453 | 3300026041 | Bacteria | 643 |
| 149 | Ga0207702_11302774 | 3300026078 | Bacteria | 720 |
| 150 | Ga0207641_10002399 | 3300026088 | Bacteria | 17295 |
| 151 | Ga0207641_10224075 | 3300026088 | Bacteria | 1745 |
| 152 | Ga0207641_10386205 | 3300026088 | Bacteria | 1342 |
| 153 | Ga0207676_10000285 | 3300026095 | Bacteria | 43703 |
| 154 | Ga0207676_10107829 | 3300026095 | Bacteria | 2324 |
| 155 | Ga0207675_100082509 | 3300026118 | Bacteria | 3015 |
| 156 | Ga0207698_11832509 | 3300026142 | Bacteria | 622 |
| 157 | Ga0209981_1000340 | 3300027378 | Bacteria | 6003 |
| 158 | Ga0209999_1017729 | 3300027543 | Bacteria | 1300 |
| 159 | Ga0209813_10002235 | 3300027866 | Bacteria | 4418 |
| 160 | Ga0268266_10001802 | 3300028379 | Bacteria | 24277 |
| 161 | Ga0268266_10038272 | 3300028379 | Bacteria | 4083 |
| 162 | Ga0268265_10005576 | 3300028380 | Bacteria | 8592 |
| 163 | Ga0268265_10007726 | 3300028380 | Bacteria | 7257 |
| 164 | Ga0268265_10120918 | 3300028380 | Bacteria | 2157 |
| 165 | Ga0268264_10000118 | 3300028381 | Bacteria | 193487 |
| 166 | Ga0268264_10053855 | 3300028381 | Bacteria | 3358 |
| 167 | Ga0268264_10280349 | 3300028381 | Bacteria | 1561 |
| 168 | Ga0265337_1012902 | 3300028556 | Bacteria | 2823 |
| 169 | Ga0307517_10162375 | 3300028786 | Bacteria | 1495 |
| 170 | Ga0307513_10019412 | 3300031456 | Bacteria | 8093 |
| 171 | Ga0307408_102349533 | 3300031548 | Bacteria | 517 |
| 172 | Ga0307508_10336236 | 3300031616 | Bacteria | 1102 |
| 173 | Ga0307413_10577056 | 3300031824 | Bacteria | 917 |
| 174 | Ga0307416_100801149 | 3300032002 | Bacteria | 1038 |
| 175 | Ga0307416_103809748 | 3300032002 | Bacteria | 505 |
| 176 | Ga0307414_10724112 | 3300032004 | Bacteria | 902 |
| 177 | Ga0307414_10850058 | 3300032004 | Bacteria | 834 |
| 178 | Ga0307414_10908740 | 3300032004 | Bacteria | 807 |
| 179 | Ga0307415_101032513 | 3300032126 | Bacteria | 766 |
| 180 | Ga0307415_102343828 | 3300032126 | Bacteria | 524 |
| 181 | Ga0307510_10278308 | 3300033180 | Bacteria | 1145 |
| 182 | Ga0373934_0068283 | 3300035086 | Bacteria | 1420 |
| 183 | Ga0373936_0341960 | 3300035113 | Bacteria | 680 |
| 184 | Ga0373955_0016821 | 3300035172 | Bacteria | 3606 |
| 185 | Ga0373927_0634823 | 3300035695 | Bacteria | 706 |
| 186 | Ga0373933_0170832 | 3300035724 | Bacteria | 1383 |
| 187 | Ga0373925_0436851 | 3300037068 | Bacteria | 1071 |
| 188 | Ga0373925_0580240 | 3300037068 | Bacteria | 923 |
| 189 | Ga0395899_0000004 | 3300037312 | Bacteria | 874267 |
| 190 | Ga0395899_0299056 | 3300037312 | Bacteria | 1089 |
| 191 | Ga0395905_0000155 | 3300037471 | Bacteria | 112355 |
| 192 | Ga0395905_0278303 | 3300037471 | Bacteria | 1559 |
| 193 | Ga0395905_0364976 | 3300037471 | Bacteria | 1337 |
| 194 | Ga0395905_0618114 | 3300037471 | Bacteria | 985 |
| 195 | Ga0395905_0817536 | 3300037471 | Bacteria | 835 |
| 196 | Ga0395905_0863764 | 3300037471 | Bacteria | 808 |
| 197 | Ga0436364_0089736 | 3300037853 | Bacteria | 533 |
| 198 | Ga0395901_0981789 | 3300038443 | Bacteria | 821 |
| 199 | Ga0395901_1256902 | 3300038443 | Bacteria | 704 |
| 200 | Ga0436365_0442593 | 3300039437 | Bacteria | 1541 |
| 201 | Ga0436365_0533319 | 3300039437 | Bacteria | 1127 |
| 202 | Ga0436365_1621116 | 3300039437 | Bacteria | 10089 |
| 203 | Ga0436363_0319448 | 3300039450 | Bacteria | 3165 |
| 204 | Ga0436363_1535470 | 3300039450 | Bacteria | 682 |
| 205 | Ga0451847_0836601 | 3300041503 | Bacteria | 547 |
| 206 | Ga0451853_0009959 | 3300041512 | Bacteria | 741 |
| 207 | Ga0466969_0216411 | 3300044656 | Bacteria | 872 |
| 208 | Ga0466961_0403664 | 3300044693 | Bacteria | 829 |
| 209 | Ga0466961_0732028 | 3300044693 | Bacteria | 592 |
| 210 | Ga0466963_1247754 | 3300044694 | Bacteria | 522 |
| 211 | Ga0466959_0025270 | 3300045049 | Bacteria | 4401 |
| 212 | Ga0495629_0020533 | 3300046459 | Bacteria | 4717 |
| 213 | Ga0495583_0074662 | 3300046506 | Bacteria | 1484 |
| 214 | Ga0495606_0056706 | 3300046507 | Bacteria | 2527 |
| 215 | Ga0495606_0451109 | 3300046507 | Bacteria | 659 |
| 216 | Ga0495610_0128255 | 3300046512 | Bacteria | 1104 |
| 217 | Ga0495620_0283159 | 3300046515 | Bacteria | 630 |
| 218 | Ga0495637_0121959 | 3300046520 | Bacteria | 1002 |
| 219 | Ga0495643_0035583 | 3300046522 | Bacteria | 2741 |
| 220 | Ga0495648_0217459 | 3300046524 | Bacteria | 945 |
| 221 | Ga0495642_0053247 | 3300046528 | Bacteria | 1667 |
| 222 | Ga0495654_0121668 | 3300046530 | Bacteria | 1181 |
| 223 | Ga0495597_0002249 | 3300046542 | Bacteria | 12585 |
| 224 | Ga0495668_0218251 | 3300046616 | Bacteria | 1044 |
| 225 | Ga0495657_0619087 | 3300046675 | Bacteria | 626 |
| 226 | Ga0495623_0192599 | 3300046679 | Bacteria | 1177 |
| 227 | Ga0495669_0195765 | 3300046684 | Bacteria | 965 |
| 228 | Ga0495636_0447725 | 3300047318 | Bacteria | 620 |
| 229 | Ga0495672_0226743 | 3300047320 | Bacteria | 919 |
| 230 | Ga0495686_0041698 | 3300047472 | Bacteria | 2921 |
| 231 | Ga0495593_0010024 | 3300047673 | Bacteria | 5491 |
| 232 | Ga0495602_0130765 | 3300048088 | Bacteria | 2003 |
| 233 | Ga0496101_0487173 | 3300048904 | Bacteria | 974 |
| 234 | Ga0496107_1163630 | 3300048910 | Bacteria | 555 |
| 235 | Ga0496108_0135143 | 3300048911 | Bacteria | 2121 |
| 236 | Ga0496110_1274740 | 3300048913 | Bacteria | 644 |
| 237 | Ga0496115_0047668 | 3300048918 | Bacteria | 3427 |
| 238 | Ga0496115_0308332 | 3300048918 | Bacteria | 1296 |
| 239 | Ga0496125_0059223 | 3300048928 | Bacteria | 3088 |
| 240 | Ga0495682_0032030 | 3300049460 | Bacteria | 1942 |
| 241 | Ga0501319_027084 | 3300049535 | Bacteria | 539 |
| 242 | Ga0501033_0250568 | 3300049570 | Bacteria | 1255 |
| 243 | Ga0501034_0836573 | 3300049571 | Bacteria | 811 |
| 244 | Ga0501038_1181230 | 3300049574 | Bacteria | 556 |
| 245 | Ga0501043_0107691 | 3300049579 | Bacteria | 2189 |
| 246 | Ga0501047_0002345 | 3300049581 | Bacteria | 18110 |
| 247 | Ga0501047_0101100 | 3300049581 | Bacteria | 2763 |
| 248 | Ga0501047_0319011 | 3300049581 | Bacteria | 1394 |
| 249 | Ga0501035_0706060 | 3300049822 | Bacteria | 813 |
| 250 | Ga0501044_0640950 | 3300049823 | Bacteria | 952 |
| 251 | Ga0501045_1039151 | 3300049824 | Bacteria | 600 |
| 252 | nmdc:mga03n38_27631_c1 | 3300050490 | Bacteria | 2356 |
| 253 | nmdc:mga00v17_106269_c1 | 3300050491 | Bacteria | 1777 |
| 254 | nmdc:mga0k408_39217_c1 | 3300050493 | Bacteria | 2720 |
| 255 | nmdc:mga06z11_2536_c1 | 3300050494 | Bacteria | 6982 |
| 256 | nmdc:mga04h51_3728_c1 | 3300050495 | Bacteria | 3731 |
| 257 | Ga0495601_0865332 | 3300053077 | Bacteria | 572 |
| 258 | Ga0500578_0158662 | 3300053086 | Bacteria | 1405 |
| 259 | Ga0500643_007450 | 3300053087 | Bacteria | 4411 |
| 260 | Ga0500651_0038526 | 3300053093 | Bacteria | 3011 |
| 261 | Ga0500641_0048501 | 3300053096 | Bacteria | 1740 |
| 262 | Ga0500641_0228536 | 3300053096 | Bacteria | 787 |
| 263 | Ga0500555_017711 | 3300053103 | Bacteria | 2052 |
| 264 | Ga0500556_0028989 | 3300053104 | Bacteria | 1862 |
| 265 | Ga0500562_002340 | 3300053108 | Bacteria | 4761 |
| 266 | Ga0500569_009054 | 3300053109 | Bacteria | 2301 |
| 267 | Ga0500595_056873 | 3300053119 | Bacteria | 1193 |
| 268 | Ga0500608_000023 | 3300053122 | Bacteria | 72341 |
| 269 | Ga0500608_039533 | 3300053122 | Bacteria | 2258 |
| 270 | Ga0500614_021795 | 3300053123 | Bacteria | 1489 |
| 271 | Ga0500642_0092620 | 3300053130 | Bacteria | 1398 |
| 272 | Ga0500658_0112350 | 3300053134 | Bacteria | 1200 |
| 273 | Ga0500559_0021408 | 3300053136 | Bacteria | 2740 |
| 274 | Ga0500620_012808 | 3300053155 | Bacteria | 2297 |
| 275 | Ga0500622_0174313 | 3300053156 | Bacteria | 998 |
| 276 | Ga0500625_050968 | 3300053729 | Bacteria | 1911 |
| 277 | Ga0500645_003553 | 3300053730 | Bacteria | 6286 |
| 278 | Ga0500596_004623 | 3300053735 | Bacteria | 2509 |
| 279 | Ga0501084_0899968 | 3300054114 | Bacteria | 744 |
| 280 | Ga0500661_066360 | 3300055283 | Bacteria | 656 |
| 281 | Ga0587085_163484 | 3300059506 | Bacteria | 522 |
| 282 | Ga0587098_031805 | 3300059604 | Bacteria | 730 |
| 283 | Ga0587076_016423 | 3300059645 | Bacteria | 1168 |
| 284 | Ga0587114_091725 | 3300059655 | Bacteria | 580 |
| 285 | Ga0501082_0538019 | 3300060353 | Bacteria | 1022 |
| 286 | Ga0466962_0368646 | 3300061719 | Bacteria | 716 |
| 287 | Ga0466962_0610139 | 3300061719 | Bacteria | 556 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10916925 | Ga0105248_109169251 | 105 |
| 2 | 3300035086 | Ga0373934_0068283 | Ga0373934_0068283_56_394 | 107 |
| 3 | 3300035172 | Ga0373955_0016821 | Ga0373955_0016821_2489_2827 | 107 |
| 4 | 3300035724 | Ga0373933_0170832 | Ga0373933_0170832_917_1255 | 107 |
| 5 | 3300048911 | Ga0496108_0135143 | Ga0496108_0135143_1601_1936 | 107 |
| 6 | 3300053077 | Ga0495601_0865332 | Ga0495601_0865332_29_367 | 107 |
| 7 | 3300049571 | Ga0501034_0836573 | Ga0501034_0836573_387_722 | 108 |
| 8 | iso_pu_bacteria | 2739367756 | 2739793296 | 108 |
| 9 | 3300003320 | rootH2_10039664 | rootH2_100396643 | 109 |
| 10 | 3300037471 | Ga0395905_0000155 | Ga0395905_0000155_587_916 | 109 |
| 11 | 3300044693 | Ga0466961_0403664 | Ga0466961_0403664_384_713 | 109 |
| 12 | 3300045049 | Ga0466959_0025270 | Ga0466959_0025270_873_1202 | 109 |
| 13 | 3300049570 | Ga0501033_0250568 | Ga0501033_0250568_101_430 | 109 |
| 14 | 3300049579 | Ga0501043_0107691 | Ga0501043_0107691_1354_1683 | 109 |
| 15 | 3300049581 | Ga0501047_0101100 | Ga0501047_0101100_910_1239 | 109 |
| 16 | 3300049822 | Ga0501035_0706060 | Ga0501035_0706060_418_747 | 109 |
| 17 | 3300049824 | Ga0501045_1039151 | Ga0501045_1039151_226_561 | 109 |
| 18 | 3300054114 | Ga0501084_0899968 | Ga0501084_0899968_252_581 | 109 |
| 19 | 3300061719 | Ga0466962_0368646 | Ga0466962_0368646_166_495 | 109 |
| 20 | 3300061719 | Ga0466962_0610139 | Ga0466962_0610139_106_435 | 109 |
| 21 | iso_pu_bacteria | 2857504554 | 2857507450 | 109 |
| 22 | iso_pu_bacteria | 2643221614 | 2644088228 | 110 |
| 23 | iso_pu_bacteria | 2643221661 | 2644343466 | 110 |
| 24 | iso_pu_bacteria | 2643221666 | 2644369057 | 110 |
| 25 | 3300005841 | Ga0068863_100572140 | Ga0068863_1005721402 | 111 |
| 26 | 3300009177 | Ga0105248_11936410 | Ga0105248_119364102 | 111 |
| 27 | 3300003781 | Ga0055536_1002376 | Ga0055536_10023768 | 113 |
| 28 | 3300003791 | Ga0055530_10002842 | Ga0055530_100028428 | 113 |
| 29 | 3300003792 | Ga0055540_1017606 | Ga0055540_10176062 | 113 |
| 30 | 3300005364 | Ga0070673_101449397 | Ga0070673_1014493971 | 113 |
| 31 | 3300005458 | Ga0070681_11247031 | Ga0070681_112470311 | 113 |
| 32 | 3300005616 | Ga0068852_100540463 | Ga0068852_1005404632 | 113 |
| 33 | 3300006042 | Ga0075368_10007687 | Ga0075368_100076872 | 113 |
| 34 | 3300006048 | Ga0075363_100053494 | Ga0075363_1000534942 | 113 |
| 35 | 3300006051 | Ga0075364_10046198 | Ga0075364_100461983 | 113 |
| 36 | 3300006178 | Ga0075367_10021752 | Ga0075367_100217524 | 113 |
| 37 | 3300006195 | Ga0075366_10040777 | Ga0075366_100407771 | 113 |
| 38 | 3300006353 | Ga0075370_10127762 | Ga0075370_101277623 | 113 |
| 39 | 3300009011 | Ga0105251_10547945 | Ga0105251_105479451 | 113 |
| 40 | 3300009093 | Ga0105240_10005291 | Ga0105240_100052912 | 113 |
| 41 | 3300009177 | Ga0105248_11368029 | Ga0105248_113680291 | 113 |
| 42 | 3300025292 | Ga0209676_1000134 | Ga0209676_1000134161 | 113 |
| 43 | 3300025298 | Ga0209050_1000348 | Ga0209050_10003489 | 113 |
| 44 | 3300025303 | Ga0209051_1032528 | Ga0209051_10325283 | 113 |
| 45 | 3300025304 | Ga0209257_1011554 | Ga0209257_10115545 | 113 |
| 46 | 3300025903 | Ga0207680_10194167 | Ga0207680_101941672 | 113 |
| 47 | 3300025912 | Ga0207707_10916322 | Ga0207707_109163222 | 113 |
| 48 | 3300025913 | Ga0207695_10006230 | Ga0207695_1000623014 | 113 |
| 49 | 3300025921 | Ga0207652_10335117 | Ga0207652_103351172 | 113 |
| 50 | 3300025924 | Ga0207694_10637086 | Ga0207694_106370861 | 113 |
| 51 | 3300027866 | Ga0209813_10002235 | Ga0209813_100022355 | 113 |
| 52 | 3300031456 | Ga0307513_10019412 | Ga0307513_100194127 | 113 |
| 53 | 3300037068 | Ga0373925_0436851 | Ga0373925_0436851_199_543 | 113 |
| 54 | 3300037312 | Ga0395899_0000004 | Ga0395899_0000004_526831_527172 | 113 |
| 55 | 3300037471 | Ga0395905_0618114 | Ga0395905_0618114_617_961 | 113 |
| 56 | 3300039450 | Ga0436363_0319448 | Ga0436363_0319448_1439_1789 | 113 |
| 57 | 3300041512 | Ga0451853_0009959 | Ga0451853_0009959_22_363 | 113 |
| 58 | 3300044656 | Ga0466969_0216411 | Ga0466969_0216411_56_409 | 113 |
| 59 | 3300044693 | Ga0466961_0732028 | Ga0466961_0732028_28_369 | 113 |
| 60 | 3300048918 | Ga0496115_0047668 | Ga0496115_0047668_2352_2693 | 113 |
| 61 | 3300050490 | nmdc:mga03n38_27631_c1 | nmdc:mga03n38_27631_c1_1363_1707 | 113 |
| 62 | 3300050491 | nmdc:mga00v17_106269_c1 | nmdc:mga00v17_106269_c1_388_732 | 113 |
| 63 | 3300050493 | nmdc:mga0k408_39217_c1 | nmdc:mga0k408_39217_c1_165_509 | 113 |
| 64 | 3300050494 | nmdc:mga06z11_2536_c1 | nmdc:mga06z11_2536_c1_3887_4231 | 113 |
| 65 | 3300050495 | nmdc:mga04h51_3728_c1 | nmdc:mga04h51_3728_c1_613_957 | 113 |
| 66 | 3300053096 | Ga0500641_0228536 | Ga0500641_0228536_162_503 | 113 |
| 67 | 3300053122 | Ga0500608_000023 | Ga0500608_000023_50360_50701 | 113 |
| 68 | 3300053136 | Ga0500559_0021408 | Ga0500559_0021408_2001_2342 | 113 |
| 69 | 3300059655 | Ga0587114_091725 | Ga0587114_091725_103_447 | 113 |
| 70 | 3300002741 | JGI25157J39369_1015639 | JGI25157J39369_10156392 | 114 |
| 71 | 3300003215 | JGI25153J46596_10058825 | JGI25153J46596_100588253 | 114 |
| 72 | 3300003791 | Ga0055530_10002837 | Ga0055530_1000283713 | 114 |
| 73 | 3300003794 | Ga0055531_10004719 | Ga0055531_100047195 | 114 |
| 74 | 3300003794 | Ga0055531_10016968 | Ga0055531_100169685 | 114 |
| 75 | 3300004799 | Ga0058863_11865640 | Ga0058863_118656401 | 114 |
| 76 | 3300005262 | Ga0065165_1000041 | Ga0065165_100004125 | 114 |
| 77 | 3300005262 | Ga0065165_1014074 | Ga0065165_10140747 | 114 |
| 78 | 3300005331 | Ga0070670_100000101 | Ga0070670_1000001012 | 114 |
| 79 | 3300005331 | Ga0070670_100269519 | Ga0070670_1002695191 | 114 |
| 80 | 3300005335 | Ga0070666_10022439 | Ga0070666_100224393 | 114 |
| 81 | 3300005347 | Ga0070668_100002639 | Ga0070668_1000026394 | 114 |
| 82 | 3300005347 | Ga0070668_100005564 | Ga0070668_10000556410 | 114 |
| 83 | 3300005347 | Ga0070668_100010442 | Ga0070668_1000104427 | 114 |
| 84 | 3300005347 | Ga0070668_100024530 | Ga0070668_1000245305 | 114 |
| 85 | 3300005353 | Ga0070669_100063567 | Ga0070669_1000635673 | 114 |
| 86 | 3300005353 | Ga0070669_100399692 | Ga0070669_1003996921 | 114 |
| 87 | 3300005353 | Ga0070669_100428462 | Ga0070669_1004284622 | 114 |
| 88 | 3300005355 | Ga0070671_100239804 | Ga0070671_1002398043 | 114 |
| 89 | 3300005366 | Ga0070659_100016461 | Ga0070659_1000164614 | 114 |
| 90 | 3300005366 | Ga0070659_100675441 | Ga0070659_1006754412 | 114 |
| 91 | 3300005367 | Ga0070667_100000260 | Ga0070667_10000026010 | 114 |
| 92 | 3300005367 | Ga0070667_100005932 | Ga0070667_10000593211 | 114 |
| 93 | 3300005367 | Ga0070667_100094806 | Ga0070667_1000948064 | 114 |
| 94 | 3300005457 | Ga0070662_100350139 | Ga0070662_1003501392 | 114 |
| 95 | 3300005530 | Ga0070679_100465356 | Ga0070679_1004653563 | 114 |
| 96 | 3300005539 | Ga0068853_100031562 | Ga0068853_1000315624 | 114 |
| 97 | 3300005548 | Ga0070665_100002230 | Ga0070665_10000223018 | 114 |
| 98 | 3300005548 | Ga0070665_100010548 | Ga0070665_1000105484 | 114 |
| 99 | 3300005563 | Ga0068855_100478039 | Ga0068855_1004780393 | 114 |
| 100 | 3300005563 | Ga0068855_100512844 | Ga0068855_1005128443 | 114 |
| 101 | 3300005564 | Ga0070664_101723367 | Ga0070664_1017233672 | 114 |
| 102 | 3300005564 | Ga0070664_102366199 | Ga0070664_1023661991 | 114 |
| 103 | 3300005616 | Ga0068852_102064932 | Ga0068852_1020649321 | 114 |
| 104 | 3300005617 | Ga0068859_100016312 | Ga0068859_1000163125 | 114 |
| 105 | 3300005617 | Ga0068859_100070405 | Ga0068859_1000704051 | 114 |
| 106 | 3300005618 | Ga0068864_100000496 | Ga0068864_1000004966 | 114 |
| 107 | 3300005719 | Ga0068861_100031213 | Ga0068861_1000312133 | 114 |
| 108 | 3300005841 | Ga0068863_100001649 | Ga0068863_10000164916 | 114 |
| 109 | 3300005841 | Ga0068863_100009904 | Ga0068863_1000099048 | 114 |
| 110 | 3300005841 | Ga0068863_100113685 | Ga0068863_1001136853 | 114 |
| 111 | 3300005841 | Ga0068863_100297948 | Ga0068863_1002979482 | 114 |
| 112 | 3300005842 | Ga0068858_100036068 | Ga0068858_1000360684 | 114 |
| 113 | 3300005843 | Ga0068860_100000309 | Ga0068860_10000030954 | 114 |
| 114 | 3300005843 | Ga0068860_100090219 | Ga0068860_1000902195 | 114 |
| 115 | 3300005843 | Ga0068860_100176382 | Ga0068860_1001763823 | 114 |
| 116 | 3300005843 | Ga0068860_100655763 | Ga0068860_1006557632 | 114 |
| 117 | 3300005844 | Ga0068862_100001520 | Ga0068862_10000152017 | 114 |
| 118 | 3300005844 | Ga0068862_100014608 | Ga0068862_1000146087 | 114 |
| 119 | 3300005844 | Ga0068862_100205590 | Ga0068862_1002055901 | 114 |
| 120 | 3300005844 | Ga0068862_100319113 | Ga0068862_1003191132 | 114 |
| 121 | 3300006028 | Ga0070717_11218822 | Ga0070717_112188222 | 114 |
| 122 | 3300006178 | Ga0075367_10799489 | Ga0075367_107994892 | 114 |
| 123 | 3300006931 | Ga0097620_100016312 | Ga0097620_1000163125 | 114 |
| 124 | 3300006931 | Ga0097620_100070407 | Ga0097620_1000704071 | 114 |
| 125 | 3300009101 | Ga0105247_10033731 | Ga0105247_100337311 | 114 |
| 126 | 3300009174 | Ga0105241_10806132 | Ga0105241_108061322 | 114 |
| 127 | 3300009176 | Ga0105242_10780666 | Ga0105242_107806662 | 114 |
| 128 | 3300009177 | Ga0105248_10002557 | Ga0105248_1000255712 | 114 |
| 129 | 3300009177 | Ga0105248_10072017 | Ga0105248_100720175 | 114 |
| 130 | 3300009177 | Ga0105248_13397708 | Ga0105248_133977082 | 114 |
| 131 | 3300009551 | Ga0105238_10182063 | Ga0105238_101820633 | 114 |
| 132 | 3300009551 | Ga0105238_10434712 | Ga0105238_104347122 | 114 |
| 133 | 3300009551 | Ga0105238_11690145 | Ga0105238_116901452 | 114 |
| 134 | 3300009551 | Ga0105238_12885993 | Ga0105238_128859932 | 114 |
| 135 | 3300009553 | Ga0105249_10005538 | Ga0105249_100055385 | 114 |
| 136 | 3300009553 | Ga0105249_10057270 | Ga0105249_100572702 | 114 |
| 137 | 3300009553 | Ga0105249_10062995 | Ga0105249_100629952 | 114 |
| 138 | 3300010375 | Ga0105239_12272041 | Ga0105239_122720412 | 114 |
| 139 | 3300013100 | Ga0157373_10010739 | Ga0157373_100107393 | 114 |
| 140 | 3300013100 | Ga0157373_10015966 | Ga0157373_100159665 | 114 |
| 141 | 3300013307 | Ga0157372_11501392 | Ga0157372_115013921 | 114 |
| 142 | 3300014968 | Ga0157379_10000373 | Ga0157379_100003735 | 114 |
| 143 | 3300014969 | Ga0157376_11338580 | Ga0157376_113385802 | 114 |
| 144 | 3300021384 | Ga0213876_10179981 | Ga0213876_101799812 | 114 |
| 145 | 3300025250 | Ga0209026_1001465 | Ga0209026_10014657 | 114 |
| 146 | 3300025297 | Ga0209758_1000555 | Ga0209758_100055539 | 114 |
| 147 | 3300025298 | Ga0209050_1000034 | Ga0209050_1000034229 | 114 |
| 148 | 3300025298 | Ga0209050_1091694 | Ga0209050_10916941 | 114 |
| 149 | 3300025304 | Ga0209257_1000052 | Ga0209257_1000052181 | 114 |
| 150 | 3300025304 | Ga0209257_1000100 | Ga0209257_100010046 | 114 |
| 151 | 3300025304 | Ga0209257_1000618 | Ga0209257_100061829 | 114 |
| 152 | 3300025900 | Ga0207710_10026634 | Ga0207710_100266342 | 114 |
| 153 | 3300025903 | Ga0207680_10070471 | Ga0207680_100704713 | 114 |
| 154 | 3300025903 | Ga0207680_10807669 | Ga0207680_108076692 | 114 |
| 155 | 3300025904 | Ga0207647_10075282 | Ga0207647_100752821 | 114 |
| 156 | 3300025911 | Ga0207654_10164337 | Ga0207654_101643372 | 114 |
| 157 | 3300025913 | Ga0207695_10184676 | Ga0207695_101846761 | 114 |
| 158 | 3300025923 | Ga0207681_10072247 | Ga0207681_100722473 | 114 |
| 159 | 3300025923 | Ga0207681_10416752 | Ga0207681_104167523 | 114 |
| 160 | 3300025923 | Ga0207681_10934339 | Ga0207681_109343391 | 114 |
| 161 | 3300025924 | Ga0207694_10364442 | Ga0207694_103644423 | 114 |
| 162 | 3300025924 | Ga0207694_10784939 | Ga0207694_107849392 | 114 |
| 163 | 3300025925 | Ga0207650_10000064 | Ga0207650_100000642 | 114 |
| 164 | 3300025925 | Ga0207650_10218958 | Ga0207650_102189582 | 114 |
| 165 | 3300025932 | Ga0207690_10011314 | Ga0207690_100113143 | 114 |
| 166 | 3300025932 | Ga0207690_10556274 | Ga0207690_105562742 | 114 |
| 167 | 3300025933 | Ga0207706_10312591 | Ga0207706_103125913 | 114 |
| 168 | 3300025941 | Ga0207711_10001318 | Ga0207711_1000131811 | 114 |
| 169 | 3300025941 | Ga0207711_10039945 | Ga0207711_100399454 | 114 |
| 170 | 3300025941 | Ga0207711_12113142 | Ga0207711_121131421 | 114 |
| 171 | 3300025945 | Ga0207679_11507235 | Ga0207679_115072352 | 114 |
| 172 | 3300025949 | Ga0207667_10108602 | Ga0207667_101086022 | 114 |
| 173 | 3300025949 | Ga0207667_11264852 | Ga0207667_112648522 | 114 |
| 174 | 3300025949 | Ga0207667_11289525 | Ga0207667_112895252 | 114 |
| 175 | 3300025961 | Ga0207712_10000569 | Ga0207712_100005699 | 114 |
| 176 | 3300025961 | Ga0207712_10110258 | Ga0207712_101102583 | 114 |
| 177 | 3300025961 | Ga0207712_10632482 | Ga0207712_106324822 | 114 |
| 178 | 3300025972 | Ga0207668_10000003 | Ga0207668_1000000366 | 114 |
| 179 | 3300025972 | Ga0207668_10000678 | Ga0207668_1000067815 | 114 |
| 180 | 3300025972 | Ga0207668_10016025 | Ga0207668_100160255 | 114 |
| 181 | 3300025972 | Ga0207668_10068169 | Ga0207668_100681692 | 114 |
| 182 | 3300025986 | Ga0207658_10000470 | Ga0207658_1000047032 | 114 |
| 183 | 3300025986 | Ga0207658_10005614 | Ga0207658_100056144 | 114 |
| 184 | 3300025986 | Ga0207658_10339877 | Ga0207658_103398772 | 114 |
| 185 | 3300026035 | Ga0207703_10025799 | Ga0207703_100257995 | 114 |
| 186 | 3300026041 | Ga0207639_10013969 | Ga0207639_100139695 | 114 |
| 187 | 3300026041 | Ga0207639_10361149 | Ga0207639_103611492 | 114 |
| 188 | 3300026041 | Ga0207639_10865306 | Ga0207639_108653061 | 114 |
| 189 | 3300026041 | Ga0207639_11453453 | Ga0207639_114534531 | 114 |
| 190 | 3300026078 | Ga0207702_11302774 | Ga0207702_113027742 | 114 |
| 191 | 3300026088 | Ga0207641_10002399 | Ga0207641_1000239912 | 114 |
| 192 | 3300026088 | Ga0207641_10224075 | Ga0207641_102240753 | 114 |
| 193 | 3300026088 | Ga0207641_10386205 | Ga0207641_103862052 | 114 |
| 194 | 3300026095 | Ga0207676_10000285 | Ga0207676_1000028531 | 114 |
| 195 | 3300026095 | Ga0207676_10107829 | Ga0207676_101078293 | 114 |
| 196 | 3300026118 | Ga0207675_100082509 | Ga0207675_1000825093 | 114 |
| 197 | 3300026142 | Ga0207698_11832509 | Ga0207698_118325091 | 114 |
| 198 | 3300027378 | Ga0209981_1000340 | Ga0209981_10003406 | 114 |
| 199 | 3300027543 | Ga0209999_1017729 | Ga0209999_10177291 | 114 |
| 200 | 3300028379 | Ga0268266_10001802 | Ga0268266_1000180221 | 114 |
| 201 | 3300028379 | Ga0268266_10038272 | Ga0268266_100382724 | 114 |
| 202 | 3300028380 | Ga0268265_10005576 | Ga0268265_100055764 | 114 |
| 203 | 3300028380 | Ga0268265_10007726 | Ga0268265_100077263 | 114 |
| 204 | 3300028380 | Ga0268265_10120918 | Ga0268265_101209183 | 114 |
| 205 | 3300028381 | Ga0268264_10000118 | Ga0268264_1000011869 | 114 |
| 206 | 3300028381 | Ga0268264_10053855 | Ga0268264_100538554 | 114 |
| 207 | 3300028381 | Ga0268264_10280349 | Ga0268264_102803492 | 114 |
| 208 | 3300028556 | Ga0265337_1012902 | Ga0265337_10129022 | 114 |
| 209 | 3300028786 | Ga0307517_10162375 | Ga0307517_101623753 | 114 |
| 210 | 3300031548 | Ga0307408_102349533 | Ga0307408_1023495331 | 114 |
| 211 | 3300031616 | Ga0307508_10336236 | Ga0307508_103362362 | 114 |
| 212 | 3300031824 | Ga0307413_10577056 | Ga0307413_105770562 | 114 |
| 213 | 3300032002 | Ga0307416_100801149 | Ga0307416_1008011491 | 114 |
| 214 | 3300032002 | Ga0307416_103809748 | Ga0307416_1038097481 | 114 |
| 215 | 3300032004 | Ga0307414_10724112 | Ga0307414_107241122 | 114 |
| 216 | 3300032004 | Ga0307414_10850058 | Ga0307414_108500582 | 114 |
| 217 | 3300032004 | Ga0307414_10908740 | Ga0307414_109087401 | 114 |
| 218 | 3300032126 | Ga0307415_101032513 | Ga0307415_1010325132 | 114 |
| 219 | 3300032126 | Ga0307415_102343828 | Ga0307415_1023438281 | 114 |
| 220 | 3300033180 | Ga0307510_10278308 | Ga0307510_102783082 | 114 |
| 221 | 3300035113 | Ga0373936_0341960 | Ga0373936_0341960_77_469 | 114 |
| 222 | 3300035695 | Ga0373927_0634823 | Ga0373927_0634823_99_491 | 114 |
| 223 | 3300037068 | Ga0373925_0580240 | Ga0373925_0580240_436_780 | 114 |
| 224 | 3300037312 | Ga0395899_0299056 | Ga0395899_0299056_393_749 | 114 |
| 225 | 3300037471 | Ga0395905_0278303 | Ga0395905_0278303_238_582 | 114 |
| 226 | 3300037471 | Ga0395905_0364976 | Ga0395905_0364976_168_512 | 114 |
| 227 | 3300037471 | Ga0395905_0817536 | Ga0395905_0817536_115_459 | 114 |
| 228 | 3300037471 | Ga0395905_0863764 | Ga0395905_0863764_376_720 | 114 |
| 229 | 3300037853 | Ga0436364_0089736 | Ga0436364_0089736_152_505 | 114 |
| 230 | 3300038443 | Ga0395901_0981789 | Ga0395901_0981789_269_625 | 114 |
| 231 | 3300038443 | Ga0395901_1256902 | Ga0395901_1256902_185_529 | 114 |
| 232 | 3300039437 | Ga0436365_0442593 | Ga0436365_0442593_1143_1490 | 114 |
| 233 | 3300039437 | Ga0436365_0533319 | Ga0436365_0533319_54_410 | 114 |
| 234 | 3300039437 | Ga0436365_1621116 | Ga0436365_1621116_5547_5891 | 114 |
| 235 | 3300039450 | Ga0436363_1535470 | Ga0436363_1535470_255_608 | 114 |
| 236 | 3300041503 | Ga0451847_0836601 | Ga0451847_0836601_89_433 | 114 |
| 237 | 3300044694 | Ga0466963_1247754 | Ga0466963_1247754_133_477 | 114 |
| 238 | 3300046459 | Ga0495629_0020533 | Ga0495629_0020533_1140_1484 | 114 |
| 239 | 3300046506 | Ga0495583_0074662 | Ga0495583_0074662_303_647 | 114 |
| 240 | 3300046507 | Ga0495606_0056706 | Ga0495606_0056706_538_882 | 114 |
| 241 | 3300046507 | Ga0495606_0451109 | Ga0495606_0451109_203_550 | 114 |
| 242 | 3300046512 | Ga0495610_0128255 | Ga0495610_0128255_375_719 | 114 |
| 243 | 3300046515 | Ga0495620_0283159 | Ga0495620_0283159_224_568 | 114 |
| 244 | 3300046520 | Ga0495637_0121959 | Ga0495637_0121959_341_685 | 114 |
| 245 | 3300046522 | Ga0495643_0035583 | Ga0495643_0035583_1357_1701 | 114 |
| 246 | 3300046524 | Ga0495648_0217459 | Ga0495648_0217459_52_399 | 114 |
| 247 | 3300046528 | Ga0495642_0053247 | Ga0495642_0053247_183_530 | 114 |
| 248 | 3300046530 | Ga0495654_0121668 | Ga0495654_0121668_408_752 | 114 |
| 249 | 3300046542 | Ga0495597_0002249 | Ga0495597_0002249_4966_5310 | 114 |
| 250 | 3300046616 | Ga0495668_0218251 | Ga0495668_0218251_651_995 | 114 |
| 251 | 3300046675 | Ga0495657_0619087 | Ga0495657_0619087_137_490 | 114 |
| 252 | 3300046679 | Ga0495623_0192599 | Ga0495623_0192599_668_1015 | 114 |
| 253 | 3300046684 | Ga0495669_0195765 | Ga0495669_0195765_500_847 | 114 |
| 254 | 3300047318 | Ga0495636_0447725 | Ga0495636_0447725_123_479 | 114 |
| 255 | 3300047320 | Ga0495672_0226743 | Ga0495672_0226743_557_904 | 114 |
| 256 | 3300047472 | Ga0495686_0041698 | Ga0495686_0041698_1584_1928 | 114 |
| 257 | 3300047673 | Ga0495593_0010024 | Ga0495593_0010024_4718_5062 | 114 |
| 258 | 3300048088 | Ga0495602_0130765 | Ga0495602_0130765_675_1019 | 114 |
| 259 | 3300048904 | Ga0496101_0487173 | Ga0496101_0487173_222_566 | 114 |
| 260 | 3300048910 | Ga0496107_1163630 | Ga0496107_1163630_92_436 | 114 |
| 261 | 3300048913 | Ga0496110_1274740 | Ga0496110_1274740_254_598 | 114 |
| 262 | 3300048918 | Ga0496115_0308332 | Ga0496115_0308332_493_837 | 114 |
| 263 | 3300048928 | Ga0496125_0059223 | Ga0496125_0059223_1291_1635 | 114 |
| 264 | 3300049460 | Ga0495682_0032030 | Ga0495682_0032030_945_1289 | 114 |
| 265 | 3300049535 | Ga0501319_027084 | Ga0501319_027084_10_354 | 114 |
| 266 | 3300049574 | Ga0501038_1181230 | Ga0501038_1181230_160_510 | 114 |
| 267 | 3300049581 | Ga0501047_0002345 | Ga0501047_0002345_15130_15474 | 114 |
| 268 | 3300049581 | Ga0501047_0319011 | Ga0501047_0319011_323_673 | 114 |
| 269 | 3300049823 | Ga0501044_0640950 | Ga0501044_0640950_148_498 | 114 |
| 270 | 3300053086 | Ga0500578_0158662 | Ga0500578_0158662_726_1070 | 114 |
| 271 | 3300053087 | Ga0500643_007450 | Ga0500643_007450_3328_3672 | 114 |
| 272 | 3300053093 | Ga0500651_0038526 | Ga0500651_0038526_1851_2195 | 114 |
| 273 | 3300053096 | Ga0500641_0048501 | Ga0500641_0048501_924_1268 | 114 |
| 274 | 3300053103 | Ga0500555_017711 | Ga0500555_017711_1166_1510 | 114 |
| 275 | 3300053104 | Ga0500556_0028989 | Ga0500556_0028989_491_835 | 114 |
| 276 | 3300053108 | Ga0500562_002340 | Ga0500562_002340_3193_3537 | 114 |
| 277 | 3300053109 | Ga0500569_009054 | Ga0500569_009054_803_1147 | 114 |
| 278 | 3300053119 | Ga0500595_056873 | Ga0500595_056873_35_379 | 114 |
| 279 | 3300053122 | Ga0500608_039533 | Ga0500608_039533_354_698 | 114 |
| 280 | 3300053123 | Ga0500614_021795 | Ga0500614_021795_578_922 | 114 |
| 281 | 3300053130 | Ga0500642_0092620 | Ga0500642_0092620_851_1195 | 114 |
| 282 | 3300053134 | Ga0500658_0112350 | Ga0500658_0112350_222_566 | 114 |
| 283 | 3300053155 | Ga0500620_012808 | Ga0500620_012808_706_1050 | 114 |
| 284 | 3300053156 | Ga0500622_0174313 | Ga0500622_0174313_562_930 | 114 |
| 285 | 3300053729 | Ga0500625_050968 | Ga0500625_050968_989_1333 | 114 |
| 286 | 3300053730 | Ga0500645_003553 | Ga0500645_003553_3449_3793 | 114 |
| 287 | 3300053735 | Ga0500596_004623 | Ga0500596_004623_1165_1509 | 114 |
| 288 | 3300055283 | Ga0500661_066360 | Ga0500661_066360_90_434 | 114 |
| 289 | 3300059506 | Ga0587085_163484 | Ga0587085_163484_54_401 | 114 |
| 290 | 3300059604 | Ga0587098_031805 | Ga0587098_031805_198_545 | 114 |
| 291 | 3300059645 | Ga0587076_016423 | Ga0587076_016423_634_981 | 114 |
| 292 | 3300060353 | Ga0501082_0538019 | Ga0501082_0538019_232_582 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2mma-assembly1.cif.gz_A | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.9665 | 9 | 108 |
| 2wul-assembly1.cif.gz_D | crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster | 0.9589 | 11 | 114 |
| 3zyw-assembly1.cif.gz_A | crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) | 0.9506 | 10 | 104 |
| 3gx8-assembly1.cif.gz_A | structural and biochemical characterization of yeast monothiol glutaredoxin grx5 | 0.9504 | 7 | 114 |
| 5y4u-assembly1.cif.gz_A | crystal structure of grx domain of grx3 from saccharomyces cerevisiae | 0.9325 | 13 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSR7_119_214_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9885 | 14 | 104 | 3.40.30.10 |
| af_O97232_76_171_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9879 | 14 | 104 | 3.40.30.10 |
| af_K7UQQ8_80_167_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.982 | 15 | 100 | 3.40.30.10 |
| af_Q8IBZ7_179_272_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9808 | 16 | 104 | 3.40.30.10 |
| 2wemC01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9796 | 14 | 108 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529M835-F1-model_v4 | Grx4 family monothiol glutaredoxin | 1.005 | 10 | 96 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A7Z3DX47-F1-model_v4 | Glutaredoxin | 1.002 | 11 | 113 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A1Q3VZN9-F1-model_v4 | Glutaredoxin | 1.001 | 10 | 112 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A5M8P6P4-F1-model_v4 | Glutaredoxin | 1.001 | 9 | 114 |
GO:0015036
GO:0046872 GO:0051537 |
| AF-A0A1F8ISA2-F1-model_v4 | deleted | 1.001 | 14 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar