F391071

General Info

Members Datasets Scaffolds Average Seq Length
292 174 584 130

Family's Representative Sequence

Representative Sequence 3300041507|Ga0451851_0077899|Ga0451851_0077899_250_669
Length 139
Sequence MMMTTIAMKPRVTSFAPQFLVDDLERSIAFYNKLGFAFGEPWDGFYAIGKLNGLELHLKEAPKTRRAAMQAERRWRRDNEHLDASAGVDGIEAFYERCVANGVTIIKPLAVTAWGTKDFYIEDPDGNIISFGGSPAAGI

Samples

Sample ID Description Type Environment
1 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 1.03
Rhizosphere 97.6
Stem 0
Stem Tuber 0
Unclassified 31.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451851_0077899 3300041507 Unclassified 875
2 JGI24034J14986_100109 3300001432 Bacteria 3645
3 JGI24748J21848_1000016 3300002074 Bacteria 134042
4 JGI24034J26672_10000016 3300002239 Bacteria 133802
5 Ga0065715_10010072 3300005293 Bacteria 3772
6 Ga0065715_10202829 3300005293 Bacteria 1352
7 Ga0065715_10515478 3300005293 Unclassified 768
8 Ga0065707_10130915 3300005295 Bacteria 1890
9 Ga0065707_10288485 3300005295 Unclassified 1031
10 Ga0065707_10573247 3300005295 Bacteria 706
11 Ga0070676_10472893 3300005328 Unclassified 885
12 Ga0070683_100083780 3300005329 Bacteria 2987
13 Ga0070690_100001230 3300005330 Bacteria 13263
14 Ga0070670_100011452 3300005331 Bacteria 7587
15 Ga0070670_100268379 3300005331 Unclassified 1489
16 Ga0068869_100174809 3300005334 Bacteria 1680
17 Ga0068869_100235181 3300005334 Bacteria 1457
18 Ga0070666_10209297 3300005335 Unclassified 1373
19 Ga0070666_10683248 3300005335 Unclassified 752
20 Ga0070680_100058824 3300005336 Bacteria 3144
21 Ga0070680_101980098 3300005336 Bacteria 505
22 Ga0068868_100432686 3300005338 Bacteria 1141
23 Ga0068868_100931983 3300005338 Unclassified 791
24 Ga0070689_100024310 3300005340 Bacteria 4543
25 Ga0070689_100153331 3300005340 Unclassified 1859
26 Ga0070689_100659043 3300005340 Bacteria 911
27 Ga0070687_100010162 3300005343 Bacteria 4058
28 Ga0070687_100138395 3300005343 Bacteria 1414
29 Ga0070661_100045877 3300005344 Bacteria 3195
30 Ga0070692_10100602 3300005345 Bacteria 1584
31 Ga0070669_100014188 3300005353 Bacteria 5670
32 Ga0070669_100024360 3300005353 Unclassified 4338
33 Ga0070675_101521780 3300005354 Bacteria 617
34 Ga0070671_100039199 3300005355 Bacteria 3933
35 Ga0070674_101563313 3300005356 Unclassified 594
36 Ga0070673_100006439 3300005364 Bacteria 7631
37 Ga0070673_100330642 3300005364 Bacteria 1348
38 Ga0070673_100867021 3300005364 Unclassified 836
39 Ga0070688_100011175 3300005365 Bacteria 4985
40 Ga0070688_100268247 3300005365 Unclassified 1222
41 Ga0070659_100030529 3300005366 Unclassified 4171
42 Ga0070694_100809141 3300005444 Unclassified 769
43 Ga0070708_100102933 3300005445 Bacteria 2617
44 Ga0070663_100264217 3300005455 Unclassified 1366
45 Ga0070678_100576026 3300005456 Bacteria 1002
46 Ga0070662_100254476 3300005457 Bacteria 1413
47 Ga0070662_100523459 3300005457 Unclassified 991
48 Ga0070681_10060828 3300005458 Bacteria 3753
49 Ga0068867_100251906 3300005459 Bacteria 1436
50 Ga0068867_100374285 3300005459 Bacteria 1195
51 Ga0070706_100087419 3300005467 Bacteria 2889
52 Ga0070706_100341895 3300005467 Bacteria 1395
53 Ga0070707_100061585 3300005468 Bacteria 3599
54 Ga0070707_100769064 3300005468 Bacteria 927
55 Ga0070698_100326120 3300005471 Bacteria 1466
56 Ga0070698_100536861 3300005471 Bacteria 1108
57 Ga0070698_100757058 3300005471 Bacteria 914
58 Ga0070698_101425936 3300005471 Unclassified 643
59 Ga0070699_100008008 3300005518 Bacteria 9174
60 Ga0070679_100064226 3300005530 Bacteria 3659
61 Ga0070684_100799472 3300005535 Unclassified 882
62 Ga0070697_100077472 3300005536 Bacteria 2735
63 Ga0070697_100242380 3300005536 Bacteria 1540
64 Ga0070672_101582293 3300005543 Bacteria 588
65 Ga0070686_100004449 3300005544 Bacteria 7731
66 Ga0070686_101612410 3300005544 Unclassified 549
67 Ga0070695_101303142 3300005545 Unclassified 600
68 Ga0070696_100864453 3300005546 Bacteria 748
69 Ga0070693_101135159 3300005547 Unclassified 597
70 Ga0070704_100122580 3300005549 Bacteria 2000
71 Ga0068857_100004717 3300005577 Bacteria 11546
72 Ga0068857_100013499 3300005577 Bacteria 7116
73 Ga0068857_100079105 3300005577 Unclassified 2935
74 Ga0068857_100534628 3300005577 Bacteria 1103
75 Ga0068854_100072367 3300005578 Bacteria 2524
76 Ga0068854_100106731 3300005578 Bacteria 2107
77 Ga0068854_101083899 3300005578 Unclassified 713
78 Ga0070702_101031980 3300005615 Unclassified 653
79 Ga0068852_102618407 3300005616 Unclassified 524
80 Ga0068859_100018253 3300005617 Bacteria 7053
81 Ga0068859_100087095 3300005617 Bacteria 3170
82 Ga0068859_100168138 3300005617 Bacteria 2273
83 Ga0068864_100020021 3300005618 Bacteria 5595
84 Ga0068851_10036202 3300005834 Unclassified 2471
85 Ga0068870_10011168 3300005840 Bacteria 4154
86 Ga0068870_10026026 3300005840 Bacteria 2911
87 Ga0068863_100177747 3300005841 Unclassified 2043
88 Ga0068858_100000041 3300005842 Bacteria 133840
89 Ga0068858_100044337 3300005842 Bacteria 4123
90 Ga0068860_100042301 3300005843 Bacteria 4352
91 Ga0068860_100321138 3300005843 Bacteria 1520
92 Ga0068862_100060291 3300005844 Bacteria 3259
93 Ga0068862_101021652 3300005844 Bacteria 818
94 Ga0097621_100119526 3300006237 Bacteria 2234
95 Ga0068871_100086035 3300006358 Unclassified 2612
96 Ga0068871_100294409 3300006358 Unclassified 1423
97 Ga0068871_100324878 3300006358 Bacteria 1356
98 Ga0075430_100006284 3300006846 Bacteria 10022
99 Ga0075430_100076591 3300006846 Bacteria 2804
100 Ga0075431_100028612 3300006847 Bacteria 5729
101 Ga0075431_100307346 3300006847 Unclassified 1601
102 Ga0075433_10066635 3300006852 Bacteria 3159
103 Ga0075433_10268962 3300006852 Unclassified 1511
104 Ga0075433_10794571 3300006852 Unclassified 827
105 Ga0075433_11024744 3300006852 Bacteria 719
106 Ga0075434_100582893 3300006871 Bacteria 1138
107 Ga0075434_100832540 3300006871 Unclassified 939
108 Ga0075429_100265779 3300006880 Unclassified 1502
109 Ga0075429_100510040 3300006880 Bacteria 1054
110 Ga0075429_100914476 3300006880 Bacteria 768
111 Ga0097620_100018251 3300006931 Bacteria 7053
112 Ga0097620_100087094 3300006931 Bacteria 3170
113 Ga0097620_100168120 3300006931 Bacteria 2273
114 Ga0105251_10153092 3300009011 Bacteria 1041
115 Ga0111539_10000165 3300009094 Bacteria 76266
116 Ga0111539_10000884 3300009094 Bacteria 39118
117 Ga0111539_10012843 3300009094 Bacteria 10481
118 Ga0111539_10086475 3300009094 Bacteria 3684
119 Ga0111539_10194921 3300009094 Bacteria 2363
120 Ga0105245_10712631 3300009098 Unclassified 1037
121 Ga0105245_10824575 3300009098 Bacteria 967
122 Ga0105247_10000083 3300009101 Bacteria 105622
123 Ga0105247_10005500 3300009101 Bacteria 7979
124 Ga0114129_10010800 3300009147 Bacteria 13009
125 Ga0114129_10196592 3300009147 Bacteria 2734
126 Ga0114129_10307813 3300009147 Unclassified 2110
127 Ga0114129_10346062 3300009147 Bacteria 1970
128 Ga0114129_13364970 3300009147 Unclassified 515
129 Ga0105243_11114318 3300009148 Unclassified 798
130 Ga0105243_11708747 3300009148 Unclassified 658
131 Ga0105241_10335317 3300009174 Bacteria 1308
132 Ga0105248_10200121 3300009177 Bacteria 2251
133 Ga0105248_10235114 3300009177 Unclassified 2063
134 Ga0105248_10469299 3300009177 Unclassified 1419
135 Ga0105246_10035276 3300011119 Bacteria 3342
136 Ga0105246_10080294 3300011119 Unclassified 2322
137 Ga0105246_10631801 3300011119 Bacteria 929
138 Ga0157378_10000518 3300013297 Bacteria 36663
139 Ga0157378_10307733 3300013297 Bacteria 1536
140 Ga0163162_10462526 3300013306 Unclassified 1400
141 Ga0163162_10778655 3300013306 Bacteria 1075
142 Ga0157372_10706416 3300013307 Unclassified 1173
143 Ga0157380_10077394 3300014326 Bacteria 2711
144 Ga0157380_12780331 3300014326 Unclassified 556
145 Ga0157380_13283379 3300014326 Unclassified 517
146 Ga0157377_10304741 3300014745 Bacteria 1053
147 Ga0157377_10769597 3300014745 Unclassified 706
148 Ga0157379_10013995 3300014968 Bacteria 7031
149 Ga0157379_10048966 3300014968 Unclassified 3773
150 Ga0213873_10015460 3300021358 Bacteria 1709
151 Ga0213876_10000019 3300021384 Bacteria 279426
152 Ga0207672_1000192 3300025223 Bacteria 8594
153 Ga0207697_10010831 3300025315 Bacteria 3879
154 Ga0207697_10273107 3300025315 Unclassified 749
155 Ga0207656_10038461 3300025321 Unclassified 2018
156 Ga0207710_10000001 3300025900 Bacteria 1797433
157 Ga0207645_10067073 3300025907 Unclassified 2293
158 Ga0207643_10120958 3300025908 Unclassified 1551
159 Ga0207684_10033213 3300025910 Bacteria 4388
160 Ga0207684_10969824 3300025910 Unclassified 712
161 Ga0207654_10593531 3300025911 Unclassified 790
162 Ga0207707_10043880 3300025912 Bacteria 3899
163 Ga0207660_10037940 3300025917 Unclassified 3360
164 Ga0207662_10002738 3300025918 Bacteria 8894
165 Ga0207657_11279286 3300025919 Bacteria 555
166 Ga0207649_10015146 3300025920 Unclassified 4330
167 Ga0207649_10037985 3300025920 Bacteria 2913
168 Ga0207646_10067150 3300025922 Bacteria 3201
169 Ga0207646_10694740 3300025922 Bacteria 910
170 Ga0207681_10116316 3300025923 Bacteria 1953
171 Ga0207681_10574400 3300025923 Unclassified 930
172 Ga0207650_10008360 3300025925 Bacteria 7065
173 Ga0207650_10405323 3300025925 Unclassified 1129
174 Ga0207659_10704759 3300025926 Unclassified 864
175 Ga0207659_11055205 3300025926 Bacteria 699
176 Ga0207687_10830614 3300025927 Bacteria 789
177 Ga0207644_10001124 3300025931 Bacteria 17134
178 Ga0207644_10671936 3300025931 Unclassified 863
179 Ga0207690_10118506 3300025932 Unclassified 1919
180 Ga0207690_10167519 3300025932 Unclassified 1643
181 Ga0207706_10264925 3300025933 Bacteria 1500
182 Ga0207686_11423572 3300025934 Bacteria 571
183 Ga0207670_10109752 3300025936 Unclassified 1986
184 Ga0207670_10162142 3300025936 Bacteria 1670
185 Ga0207670_10181076 3300025936 Bacteria 1587
186 Ga0207670_10546991 3300025936 Bacteria 945
187 Ga0207669_10819383 3300025937 Bacteria 773
188 Ga0207691_10144473 3300025940 Bacteria 2095
189 Ga0207691_10611755 3300025940 Bacteria 922
190 Ga0207711_10209028 3300025941 Unclassified 1782
191 Ga0207711_10220890 3300025941 Bacteria 1733
192 Ga0207689_10008787 3300025942 Bacteria 8782
193 Ga0207689_10197958 3300025942 Bacteria 1658
194 Ga0207689_10516007 3300025942 Bacteria 1002
195 Ga0207661_10019759 3300025944 Bacteria 5028
196 Ga0207661_10618901 3300025944 Unclassified 994
197 Ga0207679_10035082 3300025945 Unclassified 3545
198 Ga0207679_10042718 3300025945 Bacteria 3260
199 Ga0207679_10762731 3300025945 Unclassified 880
200 Ga0207651_10035864 3300025960 Bacteria 3231
201 Ga0207651_10265976 3300025960 Bacteria 1410
202 Ga0207651_11395117 3300025960 Unclassified 630
203 Ga0207712_10012587 3300025961 Bacteria 5407
204 Ga0207658_10378201 3300025986 Bacteria 1240
205 Ga0207677_10415242 3300026023 Bacteria 1145
206 Ga0207703_10000045 3300026035 Bacteria 156669
207 Ga0207703_10517440 3300026035 Bacteria 1122
208 Ga0207639_11224613 3300026041 Unclassified 704
209 Ga0207702_12461939 3300026078 Unclassified 507
210 Ga0207641_10259940 3300026088 Bacteria 1625
211 Ga0207648_10117957 3300026089 Bacteria 2332
212 Ga0207676_10057931 3300026095 Bacteria 3053
213 Ga0207676_10166945 3300026095 Bacteria 1913
214 Ga0207676_10824424 3300026095 Bacteria 906
215 Ga0207674_10001065 3300026116 Bacteria 35676
216 Ga0207674_10045008 3300026116 Bacteria 4542
217 Ga0207674_10124406 3300026116 Bacteria 2545
218 Ga0207674_10800421 3300026116 Unclassified 910
219 Ga0207675_100226357 3300026118 Bacteria 1803
220 Ga0207675_100600327 3300026118 Unclassified 1104
221 Ga0209981_1064669 3300027378 Bacteria 562
222 Ga0209984_1004213 3300027424 Unclassified 1685
223 Ga0209970_1004233 3300027614 Bacteria 2388
224 Ga0210002_1009259 3300027617 Bacteria 1504
225 Ga0209983_1001849 3300027665 Bacteria 4708
226 Ga0209971_1003707 3300027682 Bacteria 3619
227 Ga0209974_10000811 3300027876 Bacteria 10708
228 Ga0207428_10000038 3300027907 Bacteria 216105
229 Ga0207428_10013615 3300027907 Bacteria 7095
230 Ga0207428_10195996 3300027907 Bacteria 1521
231 Ga0268266_10998720 3300028379 Bacteria 810
232 Ga0268265_10073726 3300028380 Bacteria 2667
233 Ga0268265_10764395 3300028380 Unclassified 939
234 Ga0268264_10701941 3300028381 Bacteria 1005
235 Ga0307410_10127522 3300031852 Unclassified 1865
236 Ga0307409_100354266 3300031995 Bacteria 1386
237 Ga0373945_0365385 3300035116 Unclassified 628
238 Ga0373955_0764937 3300035172 Unclassified 593
239 Ga0373935_0052575 3300035692 Bacteria 2590
240 Ga0373947_0418973 3300035725 Bacteria 905
241 Ga0395898_0132673 3300037466 Unclassified 2385
242 Ga0395901_0307882 3300038443 Unclassified 1641
243 Ga0242420_011551 3300038996 Unclassified 1484
244 Ga0436365_0071333 3300039437 Bacteria 94023
245 Ga0436362_1193981 3300039453 Bacteria 16712
246 Ga0451576_2107865 3300045051 Unclassified 580
247 Ga0495603_0092586 3300046455 Bacteria 1767
248 Ga0495629_0229351 3300046459 Bacteria 1280
249 Ga0495580_0401077 3300046472 Bacteria 925
250 Ga0495596_0163199 3300046500 Unclassified 866
251 Ga0495586_0050740 3300046535 Bacteria 2245
252 Ga0495621_0108847 3300046539 Unclassified 1061
253 Ga0495658_0078490 3300046683 Bacteria 1933
254 Ga0495613_0425310 3300046689 Bacteria 903
255 Ga0496101_0287197 3300048904 Bacteria 1287
256 Ga0496107_0694006 3300048910 Bacteria 749
257 Ga0496112_0077668 3300048915 Bacteria 3284
258 Ga0501036_0825007 3300049572 Bacteria 763
259 Ga0501048_0042137 3300049582 Bacteria 3270
260 Ga0501071_0859012 3300049587 Bacteria 700
261 Ga0501072_0238065 3300049588 Bacteria 1450
262 Ga0501075_0654628 3300049591 Bacteria 801
263 Ga0501076_0013943 3300049592 Bacteria 6037
264 Ga0501249_163438 3300049679 Unclassified 567
265 Ga0501079_0838062 3300049741 Unclassified 724
266 Ga0501081_0770042 3300049743 Bacteria 724
267 Ga0501081_1277116 3300049743 Bacteria 557
268 nmdc:mga0yw44_60098_c1 3300050492 Bacteria 2327
269 nmdc:mga05p37_1095654_c1 3300050507 Unclassified 835
270 nmdc:mga05p37_1190581_c1 3300050507 Unclassified 788
271 nmdc:mga05p37_277980_c1 3300050507 Bacteria 1998
272 nmdc:mga05p37_371639_c1 3300050507 Bacteria 1678
273 nmdc:mga09592_191081_c1 3300050508 Bacteria 1772
274 nmdc:mga09592_245055_c1 3300050508 Bacteria 1553
275 nmdc:mga09592_409179_c1 3300050508 Bacteria 1172
276 nmdc:mga09592_862381_c1 3300050508 Bacteria 763
277 nmdc:mga0qj67_177742_c1 3300050509 Bacteria 1728
278 nmdc:mga0qj67_18684_c1 3300050509 Bacteria 5285
279 nmdc:mga06r32_28763_c1 3300050510 Bacteria 5203
280 nmdc:mga06r32_390707_c1 3300050510 Unclassified 1374
281 nmdc:mga06r32_766187_c1 3300050510 Bacteria 927
282 nmdc:mga06r32_920915_c1 3300050510 Bacteria 830
283 nmdc:mga08y16_137274_c1 3300050511 Bacteria 2542
284 nmdc:mga08y16_27_c1 3300050511 Bacteria 214573
285 nmdc:mga08y16_285189_c1 3300050511 Bacteria 1703
286 nmdc:mga08y16_5172_c1 3300050511 Bacteria 13621
287 nmdc:mga08y16_77698_c1 3300050511 Bacteria 3461
288 nmdc:mga08y16_896766_c1 3300050511 Bacteria 873
289 nmdc:mga0n895_126631_c1 3300050512 Unclassified 2578
290 nmdc:mga0a205_127028_c1 3300050515 Bacteria 2449
291 nmdc:mga0a205_21226_c1 3300050515 Bacteria 6141
292 nmdc:mga0a205_619477_c1 3300050515 Unclassified 935
293 Ga0451851_0077899
294 JGI24034J14986_100109
295 JGI24748J21848_1000016
296 JGI24034J26672_10000016
297 Ga0065715_10010072
298 Ga0065715_10202829
299 Ga0065715_10515478
300 Ga0065707_10130915
301 Ga0065707_10288485
302 Ga0065707_10573247
303 Ga0070676_10472893
304 Ga0070683_100083780
305 Ga0070690_100001230
306 Ga0070670_100011452
307 Ga0070670_100268379
308 Ga0068869_100174809
309 Ga0068869_100235181
310 Ga0070666_10209297
311 Ga0070666_10683248
312 Ga0070680_100058824
313 Ga0070680_101980098
314 Ga0068868_100432686
315 Ga0068868_100931983
316 Ga0070689_100024310
317 Ga0070689_100153331
318 Ga0070689_100659043
319 Ga0070687_100010162
320 Ga0070687_100138395
321 Ga0070661_100045877
322 Ga0070692_10100602
323 Ga0070669_100014188
324 Ga0070669_100024360
325 Ga0070675_101521780
326 Ga0070671_100039199
327 Ga0070674_101563313
328 Ga0070673_100006439
329 Ga0070673_100330642
330 Ga0070673_100867021
331 Ga0070688_100011175
332 Ga0070688_100268247
333 Ga0070659_100030529
334 Ga0070694_100809141
335 Ga0070708_100102933
336 Ga0070663_100264217
337 Ga0070678_100576026
338 Ga0070662_100254476
339 Ga0070662_100523459
340 Ga0070681_10060828
341 Ga0068867_100251906
342 Ga0068867_100374285
343 Ga0070706_100087419
344 Ga0070706_100341895
345 Ga0070707_100061585
346 Ga0070707_100769064
347 Ga0070698_100326120
348 Ga0070698_100536861
349 Ga0070698_100757058
350 Ga0070698_101425936
351 Ga0070699_100008008
352 Ga0070679_100064226
353 Ga0070684_100799472
354 Ga0070697_100077472
355 Ga0070697_100242380
356 Ga0070672_101582293
357 Ga0070686_100004449
358 Ga0070686_101612410
359 Ga0070695_101303142
360 Ga0070696_100864453
361 Ga0070693_101135159
362 Ga0070704_100122580
363 Ga0068857_100004717
364 Ga0068857_100013499
365 Ga0068857_100079105
366 Ga0068857_100534628
367 Ga0068854_100072367
368 Ga0068854_100106731
369 Ga0068854_101083899
370 Ga0070702_101031980
371 Ga0068852_102618407
372 Ga0068859_100018253
373 Ga0068859_100087095
374 Ga0068859_100168138
375 Ga0068864_100020021
376 Ga0068851_10036202
377 Ga0068870_10011168
378 Ga0068870_10026026
379 Ga0068863_100177747
380 Ga0068858_100000041
381 Ga0068858_100044337
382 Ga0068860_100042301
383 Ga0068860_100321138
384 Ga0068862_100060291
385 Ga0068862_101021652
386 Ga0097621_100119526
387 Ga0068871_100086035
388 Ga0068871_100294409
389 Ga0068871_100324878
390 Ga0075430_100006284
391 Ga0075430_100076591
392 Ga0075431_100028612
393 Ga0075431_100307346
394 Ga0075433_10066635
395 Ga0075433_10268962
396 Ga0075433_10794571
397 Ga0075433_11024744
398 Ga0075434_100582893
399 Ga0075434_100832540
400 Ga0075429_100265779
401 Ga0075429_100510040
402 Ga0075429_100914476
403 Ga0097620_100018251
404 Ga0097620_100087094
405 Ga0097620_100168120
406 Ga0105251_10153092
407 Ga0111539_10000165
408 Ga0111539_10000884
409 Ga0111539_10012843
410 Ga0111539_10086475
411 Ga0111539_10194921
412 Ga0105245_10712631
413 Ga0105245_10824575
414 Ga0105247_10000083
415 Ga0105247_10005500
416 Ga0114129_10010800
417 Ga0114129_10196592
418 Ga0114129_10307813
419 Ga0114129_10346062
420 Ga0114129_13364970
421 Ga0105243_11114318
422 Ga0105243_11708747
423 Ga0105241_10335317
424 Ga0105248_10200121
425 Ga0105248_10235114
426 Ga0105248_10469299
427 Ga0105246_10035276
428 Ga0105246_10080294
429 Ga0105246_10631801
430 Ga0157378_10000518
431 Ga0157378_10307733
432 Ga0163162_10462526
433 Ga0163162_10778655
434 Ga0157372_10706416
435 Ga0157380_10077394
436 Ga0157380_12780331
437 Ga0157380_13283379
438 Ga0157377_10304741
439 Ga0157377_10769597
440 Ga0157379_10013995
441 Ga0157379_10048966
442 Ga0213873_10015460
443 Ga0213876_10000019
444 Ga0207672_1000192
445 Ga0207697_10010831
446 Ga0207697_10273107
447 Ga0207656_10038461
448 Ga0207710_10000001
449 Ga0207645_10067073
450 Ga0207643_10120958
451 Ga0207684_10033213
452 Ga0207684_10969824
453 Ga0207654_10593531
454 Ga0207707_10043880
455 Ga0207660_10037940
456 Ga0207662_10002738
457 Ga0207657_11279286
458 Ga0207649_10015146
459 Ga0207649_10037985
460 Ga0207646_10067150
461 Ga0207646_10694740
462 Ga0207681_10116316
463 Ga0207681_10574400
464 Ga0207650_10008360
465 Ga0207650_10405323
466 Ga0207659_10704759
467 Ga0207659_11055205
468 Ga0207687_10830614
469 Ga0207644_10001124
470 Ga0207644_10671936
471 Ga0207690_10118506
472 Ga0207690_10167519
473 Ga0207706_10264925
474 Ga0207686_11423572
475 Ga0207670_10109752
476 Ga0207670_10162142
477 Ga0207670_10181076
478 Ga0207670_10546991
479 Ga0207669_10819383
480 Ga0207691_10144473
481 Ga0207691_10611755
482 Ga0207711_10209028
483 Ga0207711_10220890
484 Ga0207689_10008787
485 Ga0207689_10197958
486 Ga0207689_10516007
487 Ga0207661_10019759
488 Ga0207661_10618901
489 Ga0207679_10035082
490 Ga0207679_10042718
491 Ga0207679_10762731
492 Ga0207651_10035864
493 Ga0207651_10265976
494 Ga0207651_11395117
495 Ga0207712_10012587
496 Ga0207658_10378201
497 Ga0207677_10415242
498 Ga0207703_10000045
499 Ga0207703_10517440
500 Ga0207639_11224613
501 Ga0207702_12461939
502 Ga0207641_10259940
503 Ga0207648_10117957
504 Ga0207676_10057931
505 Ga0207676_10166945
506 Ga0207676_10824424
507 Ga0207674_10001065
508 Ga0207674_10045008
509 Ga0207674_10124406
510 Ga0207674_10800421
511 Ga0207675_100226357
512 Ga0207675_100600327
513 Ga0209981_1064669
514 Ga0209984_1004213
515 Ga0209970_1004233
516 Ga0210002_1009259
517 Ga0209983_1001849
518 Ga0209971_1003707
519 Ga0209974_10000811
520 Ga0207428_10000038
521 Ga0207428_10013615
522 Ga0207428_10195996
523 Ga0268266_10998720
524 Ga0268265_10073726
525 Ga0268265_10764395
526 Ga0268264_10701941
527 Ga0307410_10127522
528 Ga0307409_100354266
529 Ga0373945_0365385
530 Ga0373955_0764937
531 Ga0373935_0052575
532 Ga0373947_0418973
533 Ga0395898_0132673
534 Ga0395901_0307882
535 Ga0242420_011551
536 Ga0436365_0071333
537 Ga0436362_1193981
538 Ga0451576_2107865
539 Ga0495603_0092586
540 Ga0495629_0229351
541 Ga0495580_0401077
542 Ga0495596_0163199
543 Ga0495586_0050740
544 Ga0495621_0108847
545 Ga0495658_0078490
546 Ga0495613_0425310
547 Ga0496101_0287197
548 Ga0496107_0694006
549 Ga0496112_0077668
550 Ga0501036_0825007
551 Ga0501048_0042137
552 Ga0501071_0859012
553 Ga0501072_0238065
554 Ga0501075_0654628
555 Ga0501076_0013943
556 Ga0501249_163438
557 Ga0501079_0838062
558 Ga0501081_0770042
559 Ga0501081_1277116
560 nmdc:mga0yw44_60098_c1
561 nmdc:mga05p37_1095654_c1
562 nmdc:mga05p37_1190581_c1
563 nmdc:mga05p37_277980_c1
564 nmdc:mga05p37_371639_c1
565 nmdc:mga09592_191081_c1
566 nmdc:mga09592_245055_c1
567 nmdc:mga09592_409179_c1
568 nmdc:mga09592_862381_c1
569 nmdc:mga0qj67_177742_c1
570 nmdc:mga0qj67_18684_c1
571 nmdc:mga06r32_28763_c1
572 nmdc:mga06r32_390707_c1
573 nmdc:mga06r32_766187_c1
574 nmdc:mga06r32_920915_c1
575 nmdc:mga08y16_137274_c1
576 nmdc:mga08y16_27_c1
577 nmdc:mga08y16_285189_c1
578 nmdc:mga08y16_5172_c1
579 nmdc:mga08y16_77698_c1
580 nmdc:mga08y16_896766_c1
581 nmdc:mga0n895_126631_c1
582 nmdc:mga0a205_127028_c1
583 nmdc:mga0a205_21226_c1
584 nmdc:mga0a205_619477_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

13

131

0.8

Map