F391009

General Info

Members Datasets Scaffolds Average Seq Length
292 219 584 166

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10239460|Ga0307514_102394602
Length 197
Sequence MRASEITEILSRPISRELLARDVLRLAYVAKDGTPRNVPIAFTWNGSEIVMCTTKNAPKLPALRENPTVALTIDTEVHPPRILLIRGRAELDVVDGIPEEYLRMNGSYEMTPEQRVEWEAEIRSLYDGMVRIVVTPTWVKLIDFETTLPSAVEELARAVSIPPRSVIHSCRHPRSTSSPRTTCLASGSAPERKAVGG

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
36 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
102 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
114 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
115 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
116 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
117 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
175 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
176 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
193 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
198 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
199 2643221647 Streptomyces sp. Root369 Isolate Unclassified
200 2643221692 Nocardia sp. Root136 Isolate Unclassified
201 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
202 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
203 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
204 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
205 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
206 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
207 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
208 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
209 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
210 2891562705 Microbispora tritici MT50 Isolate Unclassified
211 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
212 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
213 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
214 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
215 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
216 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
217 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
218 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
219 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.78
Metatranscriptomes 0.34
Isolates 7.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 0.34
Rhizoplane 5.14
Rhizosphere 76.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10239460 3300031649 Bacteria 1089
2 Ga0006777J48905_1025294 3300003308 Bacteria 830
3 JGI25407J50210_10037031 3300003373 Bacteria 1254
4 JGI25407J50210_10045408 3300003373 Bacteria 1120
5 Ga0068869_100593337 3300005334 Bacteria 935
6 Ga0070691_10353333 3300005341 Bacteria 817
7 Ga0070668_100113143 3300005347 Bacteria 2162
8 Ga0070674_100670014 3300005356 Bacteria 884
9 Ga0070709_10557031 3300005434 Bacteria 878
10 Ga0070700_101324831 3300005441 Bacteria 606
11 Ga0070663_100431364 3300005455 Bacteria 1083
12 Ga0068853_100023005 3300005539 Bacteria 5212
13 Ga0068853_100400972 3300005539 Bacteria 1284
14 Ga0068855_100010396 3300005563 Bacteria 11225
15 Ga0068854_100009202 3300005578 Bacteria 6374
16 Ga0068854_100475863 3300005578 Bacteria 1048
17 Ga0068852_100010418 3300005616 Bacteria 6948
18 Ga0068864_101273877 3300005618 Bacteria 735
19 Ga0068866_10003822 3300005718 Bacteria 6176
20 Ga0068870_10514532 3300005840 Bacteria 800
21 Ga0068858_101819000 3300005842 Bacteria 602
22 Ga0081455_10248681 3300005937 Bacteria 1302
23 Ga0081538_10002592 3300005981 Bacteria 17542
24 Ga0081538_10021376 3300005981 Bacteria 4726
25 Ga0081538_10199033 3300005981 Bacteria 826
26 Ga0075364_10232572 3300006051 Bacteria 1252
27 Ga0075364_10758363 3300006051 Bacteria 662
28 Ga0070715_10030883 3300006163 Bacteria 2170
29 Ga0075370_10302096 3300006353 Bacteria 952
30 Ga0075428_100003778 3300006844 Bacteria 16594
31 Ga0075428_100286182 3300006844 Bacteria 1773
32 Ga0075431_100230703 3300006847 Bacteria 1886
33 Ga0099826_10228124 3300006948 Bacteria 997
34 Ga0105240_10126315 3300009093 Bacteria 3073
35 Ga0105240_10800806 3300009093 Bacteria 1021
36 Ga0105245_11242517 3300009098 Bacteria 793
37 Ga0114129_10236818 3300009147 Bacteria 2455
38 Ga0105243_10013062 3300009148 Bacteria 6274
39 Ga0105243_10865608 3300009148 Bacteria 896
40 Ga0105243_11102022 3300009148 Bacteria 802
41 Ga0105241_10003145 3300009174 Bacteria 12277
42 Ga0105238_10750005 3300009551 Bacteria 990
43 Ga0105238_11070606 3300009551 Bacteria 828
44 Ga0105249_12375379 3300009553 Bacteria 603
45 Ga0105239_10389065 3300010375 Bacteria 1577
46 Ga0105239_11406625 3300010375 Bacteria 805
47 Ga0157337_1009368 3300012483 Bacteria 737
48 Ga0157326_1017335 3300012513 Bacteria 860
49 Ga0157374_10100600 3300013296 Bacteria 2771
50 Ga0157372_10603309 3300013307 Bacteria 1279
51 Ga0157375_11685702 3300013308 Bacteria 750
52 Ga0157380_10758644 3300014326 Bacteria 982
53 Ga0163161_10104762 3300017792 Bacteria 2109
54 Ga0163161_10323252 3300017792 Bacteria 1220
55 Ga0207647_10043564 3300025904 Bacteria 2808
56 Ga0207685_10021305 3300025905 Bacteria 2170
57 Ga0207705_10315577 3300025909 Bacteria 1200
58 Ga0207654_10116448 3300025911 Bacteria 1671
59 Ga0207695_10017096 3300025913 Bacteria 8458
60 Ga0207671_10002232 3300025914 Bacteria 20992
61 Ga0207681_10785820 3300025923 Bacteria 795
62 Ga0207694_10006856 3300025924 Bacteria 8652
63 Ga0207659_11295784 3300025926 Bacteria 625
64 Ga0207687_10195200 3300025927 Bacteria 1578
65 Ga0207687_10242389 3300025927 Bacteria 1429
66 Ga0207664_10041077 3300025929 Bacteria 3602
67 Ga0207686_11264233 3300025934 Bacteria 605
68 Ga0207709_10094044 3300025935 Bacteria 1967
69 Ga0207669_10359341 3300025937 Bacteria 1128
70 Ga0207704_11654649 3300025938 Bacteria 550
71 Ga0207691_10796138 3300025940 Bacteria 794
72 Ga0207691_10958206 3300025940 Bacteria 715
73 Ga0207667_10681392 3300025949 Bacteria 1031
74 Ga0207712_10520103 3300025961 Bacteria 1020
75 Ga0207668_10825461 3300025972 Bacteria 822
76 Ga0207640_10212663 3300025981 Bacteria 1474
77 Ga0207677_10286230 3300026023 Bacteria 1355
78 Ga0207678_10000091 3300026067 Bacteria 75052
79 Ga0207678_10457499 3300026067 Bacteria 1110
80 Ga0207678_10575562 3300026067 Bacteria 986
81 Ga0207702_10261163 3300026078 Bacteria 1631
82 Ga0207676_10664497 3300026095 Bacteria 1007
83 Ga0207674_10738214 3300026116 Bacteria 950
84 Ga0207674_11880458 3300026116 Bacteria 565
85 Ga0207683_10401004 3300026121 Bacteria 1262
86 Ga0207698_10276405 3300026142 Bacteria 1551
87 Ga0209371_1045470 3300027312 Bacteria 868
88 Ga0268264_10791686 3300028381 Bacteria 947
89 Ga0268264_11278808 3300028381 Bacteria 744
90 Ga0307517_10023570 3300028786 Bacteria 7641
91 Ga0307515_10000621 3300028794 Bacteria 82840
92 Ga0307515_10053617 3300028794 Bacteria 5944
93 Ga0307515_10212607 3300028794 Bacteria 1774
94 Ga0268256_1058299 3300030500 Bacteria 784
95 Ga0307511_10006414 3300030521 Bacteria 11858
96 Ga0307511_10011937 3300030521 Bacteria 8543
97 Ga0307511_10089657 3300030521 Bacteria 2094
98 Ga0314311_1108274 3300030733 Bacteria 968
99 Ga0307509_10000421 3300031507 Bacteria 71431
100 Ga0307509_10007003 3300031507 Bacteria 14931
101 Ga0307509_10008533 3300031507 Bacteria 13040
102 Ga0307408_100016971 3300031548 Bacteria 4868
103 Ga0307408_100114264 3300031548 Bacteria 2080
104 Ga0307508_10005894 3300031616 Bacteria 11565
105 Ga0307508_10031871 3300031616 Bacteria 4763
106 Ga0307508_10308490 3300031616 Bacteria 1175
107 Ga0307516_10010745 3300031730 Bacteria 10029
108 Ga0307405_10230538 3300031731 Bacteria 1365
109 Ga0307405_10330679 3300031731 Bacteria 1168
110 Ga0307405_10537440 3300031731 Bacteria 943
111 Ga0307518_10087899 3300031838 Bacteria 2239
112 Ga0307410_10093487 3300031852 Bacteria 2140
113 Ga0307410_10996872 3300031852 Bacteria 722
114 Ga0326468_10000019 3300031889 Bacteria 12247
115 Ga0307406_10140352 3300031901 Bacteria 1709
116 Ga0307407_10941256 3300031903 Bacteria 665
117 Ga0307412_10074539 3300031911 Bacteria 2325
118 Ga0307409_100048071 3300031995 Bacteria 3243
119 Ga0307409_100049516 3300031995 Bacteria 3204
120 Ga0307409_100055381 3300031995 Bacteria 3061
121 Ga0307409_100090523 3300031995 Bacteria 2505
122 Ga0307409_100109048 3300031995 Bacteria 2317
123 Ga0307409_100493984 3300031995 Bacteria 1190
124 Ga0307409_100674039 3300031995 Bacteria 1030
125 Ga0307409_101225796 3300031995 Bacteria 774
126 Ga0307416_100033207 3300032002 Bacteria 3909
127 Ga0307416_100109505 3300032002 Bacteria 2430
128 Ga0307416_100216780 3300032002 Bacteria 1831
129 Ga0307416_100243440 3300032002 Bacteria 1745
130 Ga0307416_100243845 3300032002 Bacteria 1743
131 Ga0307416_100254597 3300032002 Bacteria 1711
132 Ga0307416_101073183 3300032002 Bacteria 909
133 Ga0307416_101102128 3300032002 Bacteria 898
134 Ga0307414_10931605 3300032004 Bacteria 797
135 Ga0307415_100004150 3300032126 Bacteria 7473
136 Ga0307415_100136674 3300032126 Bacteria 1865
137 Ga0307415_100167125 3300032126 Bacteria 1712
138 Ga0307415_100371255 3300032126 Bacteria 1211
139 Ga0307415_101105277 3300032126 Bacteria 742
140 Ga0307507_10051979 3300033179 Bacteria 3936
141 Ga0307507_10205625 3300033179 Bacteria 1353
142 Ga0307510_10043932 3300033180 Bacteria 4848
143 Ga0307510_10338776 3300033180 Bacteria 956
144 Ga0373941_0189606 3300035115 Bacteria 776
145 Ga0373925_0088455 3300037068 Bacteria 2366
146 Ga0395900_0063149 3300037418 Bacteria 3807
147 Ga0395898_0107726 3300037466 Bacteria 2672
148 Ga0395905_0059535 3300037471 Bacteria 3570
149 Ga0395901_0167892 3300038443 Bacteria 2303
150 Ga0451793_0403416 3300041452 Bacteria 9394
151 Ga0451797_1519131 3300041453 Bacteria 2677
152 Ga0451795_0494653 3300041456 Bacteria 973
153 Ga0451837_0334531 3300041494 Bacteria 1071
154 Ga0451839_0041590 3300041496 Bacteria 3730
155 Ga0451849_0791596 3300041505 Bacteria 1419
156 Ga0451851_1042314 3300041507 Bacteria 863
157 Ga0451843_1047599 3300041509 Bacteria 7640
158 Ga0451853_2383788 3300041512 Bacteria 2843
159 Ga0439443_044874 3300042003 Bacteria 762
160 Ga0439448_0014096 3300042005 Bacteria 2408
161 Ga0439448_0055811 3300042005 Bacteria 1299
162 Ga0439432_104037 3300042006 Bacteria 848
163 Ga0439449_0122486 3300042007 Bacteria 966
164 Ga0439455_0195886 3300042012 Bacteria 584
165 Ga0450923_023239 3300042125 Bacteria 1222
166 Ga0450903_000096 3300042138 Bacteria 18469
167 Ga0439444_0072570 3300042437 Bacteria 740
168 Ga0439464_0045495 3300042439 Bacteria 1260
169 Ga0450901_027586 3300042533 Bacteria 622
170 Ga0466969_0003194 3300044656 Bacteria 8737
171 Ga0466972_0026127 3300044658 Bacteria 2892
172 Ga0466972_0046226 3300044658 Bacteria 2108
173 Ga0466972_0132433 3300044658 Bacteria 1174
174 Ga0466965_0050363 3300044683 Bacteria 2065
175 Ga0466966_0029864 3300044684 Bacteria 3544
176 Ga0466966_0065089 3300044684 Bacteria 2293
177 Ga0466966_0407056 3300044684 Bacteria 817
178 Ga0466961_0030598 3300044693 Bacteria 3459
179 Ga0466961_0056149 3300044693 Bacteria 2509
180 Ga0466961_0210414 3300044693 Bacteria 1200
181 Ga0466963_0023964 3300044694 Bacteria 3882
182 Ga0466971_0038908 3300044719 Bacteria 2135
183 Ga0466971_0135364 3300044719 Bacteria 1146
184 Ga0466970_0131690 3300044765 Bacteria 1374
185 Ga0466957_0295803 3300044842 Bacteria 1087
186 Ga0466957_0379945 3300044842 Bacteria 963
187 Ga0466960_0005686 3300044901 Bacteria 4951
188 Ga0466960_0213033 3300044901 Bacteria 1060
189 Ga0466960_0235701 3300044901 Bacteria 1011
190 Ga0466959_0003274 3300045049 Bacteria 10553
191 Ga0466967_0482111 3300045976 Bacteria 1215
192 Ga0466967_0616275 3300045976 Bacteria 1072
193 Ga0466967_0880847 3300045976 Bacteria 890
194 Ga0495627_038949 3300046453 Bacteria 1468
195 Ga0495629_0007502 3300046459 Bacteria 8041
196 Ga0495618_0188401 3300046514 Bacteria 1309
197 Ga0495628_0137714 3300046516 Bacteria 1864
198 Ga0495628_0148511 3300046516 Bacteria 1786
199 Ga0495643_0305429 3300046522 Bacteria 724
200 Ga0495644_0122031 3300046523 Bacteria 992
201 Ga0495652_0001107 3300046529 Bacteria 30520
202 Ga0495586_0434374 3300046535 Bacteria 757
203 Ga0495645_0059073 3300046543 Bacteria 2781
204 Ga0495634_0291602 3300046642 Bacteria 988
205 Ga0495625_0022576 3300046660 Bacteria 4821
206 Ga0495635_0004982 3300046663 Bacteria 9247
207 Ga0495588_0025764 3300046674 Bacteria 2932
208 Ga0495646_0022190 3300046680 Bacteria 4005
209 Ga0495613_0356221 3300046689 Bacteria 1004
210 Ga0495600_0006023 3300046809 Bacteria 7340
211 Ga0495581_0056288 3300047315 Bacteria 2270
212 Ga0495636_0255958 3300047318 Bacteria 811
213 Ga0495687_006204 3300047443 Bacteria 7381
214 Ga0495675_0330283 3300047444 Bacteria 901
215 Ga0495681_0014964 3300047470 Bacteria 4417
216 Ga0495686_0084982 3300047472 Bacteria 1928
217 Ga0495602_0099942 3300048088 Bacteria 2384
218 Ga0495614_0020636 3300048089 Bacteria 2846
219 Ga0496100_0458241 3300048903 Bacteria 978
220 Ga0496103_0486076 3300048906 Bacteria 791
221 Ga0496105_0036096 3300048908 Bacteria 4071
222 Ga0496108_0048101 3300048911 Bacteria 3565
223 Ga0496108_0132801 3300048911 Bacteria 2140
224 Ga0496108_0735783 3300048911 Bacteria 854
225 Ga0496109_0044413 3300048912 Bacteria 4031
226 Ga0496110_0001608 3300048913 Bacteria 16536
227 Ga0496111_0007842 3300048914 Bacteria 7031
228 Ga0496113_0454245 3300048916 Bacteria 1030
229 Ga0496114_0060193 3300048917 Bacteria 3173
230 Ga0496115_1231862 3300048918 Bacteria 561
231 Ga0501032_0437033 3300049569 Bacteria 839
232 Ga0501038_0453558 3300049574 Bacteria 986
233 Ga0501040_0063726 3300049576 Bacteria 2537
234 Ga0501042_0244390 3300049578 Bacteria 1295
235 Ga0501046_0334419 3300049580 Bacteria 1102
236 Ga0501047_0149170 3300049581 Bacteria 2215
237 Ga0501047_0875393 3300049581 Bacteria 712
238 Ga0501048_0148595 3300049582 Bacteria 1657
239 Ga0501071_0041012 3300049587 Bacteria 3314
240 Ga0501074_1076065 3300049590 Bacteria 565
241 Ga0501076_0564491 3300049592 Bacteria 939
242 Ga0501209_112522 3300049656 Bacteria 804
243 Ga0501247_067604 3300049677 Bacteria 559
244 Ga0501252_067264 3300049682 Bacteria 571
245 Ga0501225_0144519 3300049705 Bacteria 721
246 Ga0501271_035484 3300049768 Bacteria 632
247 Ga0501035_0481787 3300049822 Bacteria 1023
248 nmdc:mga03n38_124228_c1 3300050490 Bacteria 1272
249 nmdc:mga03n38_141893_c1 3300050490 Bacteria 1200
250 nmdc:mga00v17_616257_c1 3300050491 Bacteria 699
251 nmdc:mga0yw44_33251_c1 3300050492 Bacteria 3012
252 nmdc:mga07m45_221343_c1 3300050496 Bacteria 1101
253 nmdc:mga09592_36025_c1 3300050508 Bacteria 4145
254 nmdc:mga0qj67_139305_c1 3300050509 Bacteria 1967
255 nmdc:mga0qj67_299777_c1 3300050509 Bacteria 1302
256 nmdc:mga06r32_286936_c1 3300050510 Bacteria 1633
257 Ga0495601_0012166 3300053077 Bacteria 5159
258 Ga0495601_0019048 3300053077 Bacteria 4182
259 Ga0495601_0063231 3300053077 Bacteria 2352
260 Ga0495612_0008425 3300053078 Bacteria 4181
261 Ga0500610_0101410 3300053079 Bacteria 1489
262 Ga0500560_001200 3300053107 Bacteria 4321
263 Ga0500568_0052652 3300053139 Bacteria 1597
264 Ga0500579_022877 3300053143 Bacteria 4047
265 Ga0500600_0087832 3300053149 Bacteria 1666
266 Ga0501084_0708164 3300054114 Bacteria 849
267 Ga0590071_026198 3300059421 Bacteria 1383
268 Ga0466962_0000809 3300061719 Bacteria 14128
269 Ga0466962_0146024 3300061719 Bacteria 1147
270 2515851842 2515154155 Bacteria 7985436
271 2552105786 2551306166 Bacteria 9731570
272 2644266991 2643221647 Bacteria 10741251
273 2644518079 2643221692 Bacteria 7282860
274 2739328535 2738543027 Bacteria 6409078
275 2739608651 2739367654 Bacteria 6049412
276 2786674126 2786546132 Bacteria 10419719
277 2856747951 2856741275 Bacteria 8096094
278 2862281642 2862281513 Bacteria 9621493
279 2867304243 2867302475 Bacteria 7087181
280 2877684642 2877676314 Bacteria 9512378
281 2891399541 2891395885 Bacteria 9251614
282 2891555931 2891554331 Bacteria 8812224
283 2891566432 2891562705 Bacteria 8039471
284 2906800758 2906799679 Bacteria 4031749
285 2919713892 2919713450 Bacteria 7431245
286 2954681286 2954673503 Bacteria 9685905
287 2954682872 2954682443 Bacteria 9862841
288 2954692588 2954691527 Bacteria 10720516
289 2954707660 2954701450 Bacteria 10834262
290 3003002557 3002998708 Bacteria 11715108
291 8003320045 8003314358 Bacteria 10575343
292 8055070913 8055066027 Bacteria 9479577
293 Ga0307514_10239460
294 Ga0006777J48905_1025294
295 JGI25407J50210_10037031
296 JGI25407J50210_10045408
297 Ga0068869_100593337
298 Ga0070691_10353333
299 Ga0070668_100113143
300 Ga0070674_100670014
301 Ga0070709_10557031
302 Ga0070700_101324831
303 Ga0070663_100431364
304 Ga0068853_100023005
305 Ga0068853_100400972
306 Ga0068855_100010396
307 Ga0068854_100009202
308 Ga0068854_100475863
309 Ga0068852_100010418
310 Ga0068864_101273877
311 Ga0068866_10003822
312 Ga0068870_10514532
313 Ga0068858_101819000
314 Ga0081455_10248681
315 Ga0081538_10002592
316 Ga0081538_10021376
317 Ga0081538_10199033
318 Ga0075364_10232572
319 Ga0075364_10758363
320 Ga0070715_10030883
321 Ga0075370_10302096
322 Ga0075428_100003778
323 Ga0075428_100286182
324 Ga0075431_100230703
325 Ga0099826_10228124
326 Ga0105240_10126315
327 Ga0105240_10800806
328 Ga0105245_11242517
329 Ga0114129_10236818
330 Ga0105243_10013062
331 Ga0105243_10865608
332 Ga0105243_11102022
333 Ga0105241_10003145
334 Ga0105238_10750005
335 Ga0105238_11070606
336 Ga0105249_12375379
337 Ga0105239_10389065
338 Ga0105239_11406625
339 Ga0157337_1009368
340 Ga0157326_1017335
341 Ga0157374_10100600
342 Ga0157372_10603309
343 Ga0157375_11685702
344 Ga0157380_10758644
345 Ga0163161_10104762
346 Ga0163161_10323252
347 Ga0207647_10043564
348 Ga0207685_10021305
349 Ga0207705_10315577
350 Ga0207654_10116448
351 Ga0207695_10017096
352 Ga0207671_10002232
353 Ga0207681_10785820
354 Ga0207694_10006856
355 Ga0207659_11295784
356 Ga0207687_10195200
357 Ga0207687_10242389
358 Ga0207664_10041077
359 Ga0207686_11264233
360 Ga0207709_10094044
361 Ga0207669_10359341
362 Ga0207704_11654649
363 Ga0207691_10796138
364 Ga0207691_10958206
365 Ga0207667_10681392
366 Ga0207712_10520103
367 Ga0207668_10825461
368 Ga0207640_10212663
369 Ga0207677_10286230
370 Ga0207678_10000091
371 Ga0207678_10457499
372 Ga0207678_10575562
373 Ga0207702_10261163
374 Ga0207676_10664497
375 Ga0207674_10738214
376 Ga0207674_11880458
377 Ga0207683_10401004
378 Ga0207698_10276405
379 Ga0209371_1045470
380 Ga0268264_10791686
381 Ga0268264_11278808
382 Ga0307517_10023570
383 Ga0307515_10000621
384 Ga0307515_10053617
385 Ga0307515_10212607
386 Ga0268256_1058299
387 Ga0307511_10006414
388 Ga0307511_10011937
389 Ga0307511_10089657
390 Ga0314311_1108274
391 Ga0307509_10000421
392 Ga0307509_10007003
393 Ga0307509_10008533
394 Ga0307408_100016971
395 Ga0307408_100114264
396 Ga0307508_10005894
397 Ga0307508_10031871
398 Ga0307508_10308490
399 Ga0307516_10010745
400 Ga0307405_10230538
401 Ga0307405_10330679
402 Ga0307405_10537440
403 Ga0307518_10087899
404 Ga0307410_10093487
405 Ga0307410_10996872
406 Ga0326468_10000019
407 Ga0307406_10140352
408 Ga0307407_10941256
409 Ga0307412_10074539
410 Ga0307409_100048071
411 Ga0307409_100049516
412 Ga0307409_100055381
413 Ga0307409_100090523
414 Ga0307409_100109048
415 Ga0307409_100493984
416 Ga0307409_100674039
417 Ga0307409_101225796
418 Ga0307416_100033207
419 Ga0307416_100109505
420 Ga0307416_100216780
421 Ga0307416_100243440
422 Ga0307416_100243845
423 Ga0307416_100254597
424 Ga0307416_101073183
425 Ga0307416_101102128
426 Ga0307414_10931605
427 Ga0307415_100004150
428 Ga0307415_100136674
429 Ga0307415_100167125
430 Ga0307415_100371255
431 Ga0307415_101105277
432 Ga0307507_10051979
433 Ga0307507_10205625
434 Ga0307510_10043932
435 Ga0307510_10338776
436 Ga0373941_0189606
437 Ga0373925_0088455
438 Ga0395900_0063149
439 Ga0395898_0107726
440 Ga0395905_0059535
441 Ga0395901_0167892
442 Ga0451793_0403416
443 Ga0451797_1519131
444 Ga0451795_0494653
445 Ga0451837_0334531
446 Ga0451839_0041590
447 Ga0451849_0791596
448 Ga0451851_1042314
449 Ga0451843_1047599
450 Ga0451853_2383788
451 Ga0439443_044874
452 Ga0439448_0014096
453 Ga0439448_0055811
454 Ga0439432_104037
455 Ga0439449_0122486
456 Ga0439455_0195886
457 Ga0450923_023239
458 Ga0450903_000096
459 Ga0439444_0072570
460 Ga0439464_0045495
461 Ga0450901_027586
462 Ga0466969_0003194
463 Ga0466972_0026127
464 Ga0466972_0046226
465 Ga0466972_0132433
466 Ga0466965_0050363
467 Ga0466966_0029864
468 Ga0466966_0065089
469 Ga0466966_0407056
470 Ga0466961_0030598
471 Ga0466961_0056149
472 Ga0466961_0210414
473 Ga0466963_0023964
474 Ga0466971_0038908
475 Ga0466971_0135364
476 Ga0466970_0131690
477 Ga0466957_0295803
478 Ga0466957_0379945
479 Ga0466960_0005686
480 Ga0466960_0213033
481 Ga0466960_0235701
482 Ga0466959_0003274
483 Ga0466967_0482111
484 Ga0466967_0616275
485 Ga0466967_0880847
486 Ga0495627_038949
487 Ga0495629_0007502
488 Ga0495618_0188401
489 Ga0495628_0137714
490 Ga0495628_0148511
491 Ga0495643_0305429
492 Ga0495644_0122031
493 Ga0495652_0001107
494 Ga0495586_0434374
495 Ga0495645_0059073
496 Ga0495634_0291602
497 Ga0495625_0022576
498 Ga0495635_0004982
499 Ga0495588_0025764
500 Ga0495646_0022190
501 Ga0495613_0356221
502 Ga0495600_0006023
503 Ga0495581_0056288
504 Ga0495636_0255958
505 Ga0495687_006204
506 Ga0495675_0330283
507 Ga0495681_0014964
508 Ga0495686_0084982
509 Ga0495602_0099942
510 Ga0495614_0020636
511 Ga0496100_0458241
512 Ga0496103_0486076
513 Ga0496105_0036096
514 Ga0496108_0048101
515 Ga0496108_0132801
516 Ga0496108_0735783
517 Ga0496109_0044413
518 Ga0496110_0001608
519 Ga0496111_0007842
520 Ga0496113_0454245
521 Ga0496114_0060193
522 Ga0496115_1231862
523 Ga0501032_0437033
524 Ga0501038_0453558
525 Ga0501040_0063726
526 Ga0501042_0244390
527 Ga0501046_0334419
528 Ga0501047_0149170
529 Ga0501047_0875393
530 Ga0501048_0148595
531 Ga0501071_0041012
532 Ga0501074_1076065
533 Ga0501076_0564491
534 Ga0501209_112522
535 Ga0501247_067604
536 Ga0501252_067264
537 Ga0501225_0144519
538 Ga0501271_035484
539 Ga0501035_0481787
540 nmdc:mga03n38_124228_c1
541 nmdc:mga03n38_141893_c1
542 nmdc:mga00v17_616257_c1
543 nmdc:mga0yw44_33251_c1
544 nmdc:mga07m45_221343_c1
545 nmdc:mga09592_36025_c1
546 nmdc:mga0qj67_139305_c1
547 nmdc:mga0qj67_299777_c1
548 nmdc:mga06r32_286936_c1
549 Ga0495601_0012166
550 Ga0495601_0019048
551 Ga0495601_0063231
552 Ga0495612_0008425
553 Ga0500610_0101410
554 Ga0500560_001200
555 Ga0500568_0052652
556 Ga0500579_022877
557 Ga0500600_0087832
558 Ga0501084_0708164
559 Ga0590071_026198
560 Ga0466962_0000809
561 Ga0466962_0146024
562 2515851842
563 2552105786
564 2644266991
565 2644518079
566 2739328535
567 2739608651
568 2786674126
569 2856747951
570 2862281642
571 2867304243
572 2877684642
573 2891399541
574 2891555931
575 2891566432
576 2906800758
577 2919713892
578 2954681286
579 2954682872
580 2954692588
581 2954707660
582 3003002557
583 8003320045
584 8055070913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

10

96

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2htd-assembly1.cif.gz_A crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution 0.7517 1 140
6vna-assembly1.cif.gz_C pden_1323 0.7481 2 142
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.743 16 140
3db0-assembly1.cif.gz_B crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.742 16 142
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.7418 5 143
ID Description Score Start End Superfamily
af_O86340_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.765 17 88 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7544 1 140 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7471 12 143 2.30.110.10
2fhqB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7427 11 141 2.30.110.10
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7419 5 143 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7W7WAT2-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9536 1 78
AF-A0A537Y3Z7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.835 12 142 GO:0005829
GO:0016627
GO:0070967
AF-A0A535I1Z7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.8319 17 143 GO:0005829
GO:0016627
GO:0070967
AF-A0A1A3U5S4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.8092 14 150
AF-A0A6L3F1G0-F1-model_v4 TIGR03667 family PPOX class F420-dependent oxidoreductase 0.7903 10 138 GO:0005829
GO:0016627
GO:0070967

Map