F390911

General Info

Members Datasets Scaffolds Average Seq Length
292 178 285 172

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10308832|Ga0105237_103088322
Length 192
Sequence VAERIGVYPGTFDPITLGHADIIRRGAKLVDRLIIGVTTNPSKNPMFTPDERIAIVRREVDAMGLHNIEVVGFNALLMKFAEVQGASVIVRGLRAVADFEYEYQMAGMNQQLNSRIETIFLIHAAHAYPIPSTHRNAALDTIHAYLEPKGIFSRGRFGSWKYEIGNQDHSLMQGVELVDRWLDGSEEKVFRT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
4 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
5 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
6 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
7 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
8 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
128 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
161 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
173 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
174 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
178 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 0
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 0.34
Rhizoplane 5.82
Rhizosphere 73.29
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_254253 2162886007 Bacteria 14576
2 Ga0065704_10070209 3300005289 Bacteria 78459
3 Ga0065704_10077526 3300005289 Bacteria 4705
4 Ga0065704_10243139 3300005289 Bacteria 1009
5 Ga0065707_10091593 3300005295 Bacteria 3912
6 Ga0065707_10413958 3300005295 Bacteria 838
7 Ga0070658_10000273 3300005327 Bacteria 45226
8 Ga0070670_100062503 3300005331 Bacteria 3196
9 Ga0070680_100008923 3300005336 Bacteria 7690
10 Ga0070680_100326050 3300005336 Bacteria 1304
11 Ga0070682_100348568 3300005337 Bacteria 1103
12 Ga0070660_100057790 3300005339 Bacteria 3006
13 Ga0070689_100985243 3300005340 Bacteria 749
14 Ga0070661_100020377 3300005344 Bacteria 4727
15 Ga0070661_100082992 3300005344 Bacteria 2367
16 Ga0070668_100002216 3300005347 Bacteria 14271
17 Ga0070669_100001004 3300005353 Bacteria 20544
18 Ga0070669_100001577 3300005353 Bacteria 16522
19 Ga0070675_100178472 3300005354 Bacteria 1835
20 Ga0070671_100000054 3300005355 Bacteria 77908
21 Ga0070671_100010621 3300005355 Bacteria 7391
22 Ga0070671_100017767 3300005355 Bacteria 5767
23 Ga0070659_100018672 3300005366 Bacteria 5235
24 Ga0070659_100088634 3300005366 Bacteria 2478
25 Ga0070659_100212185 3300005366 Bacteria 1596
26 Ga0070659_100628081 3300005366 Bacteria 925
27 Ga0070667_100022444 3300005367 Bacteria 5234
28 Ga0070663_100067231 3300005455 Bacteria 2599
29 Ga0070663_100641896 3300005455 Bacteria 897
30 Ga0070678_100100011 3300005456 Bacteria 2245
31 Ga0070662_100011517 3300005457 Bacteria 5836
32 Ga0070662_100015843 3300005457 Bacteria 5056
33 Ga0070662_100049757 3300005457 Bacteria 3023
34 Ga0070681_10021252 3300005458 Bacteria 6504
35 Ga0070707_100571234 3300005468 Bacteria 1093
36 Ga0070679_100698506 3300005530 Bacteria 957
37 Ga0070684_100222086 3300005535 Bacteria 1724
38 Ga0068853_100357864 3300005539 Bacteria 1359
39 Ga0070665_100000076 3300005548 Bacteria 189228
40 Ga0070665_100234899 3300005548 Bacteria 1834
41 Ga0068855_100027987 3300005563 Bacteria 6742
42 Ga0068855_100041134 3300005563 Bacteria 5480
43 Ga0068855_100252027 3300005563 Bacteria 1969
44 Ga0070664_100136921 3300005564 Bacteria 2154
45 Ga0070664_100649385 3300005564 Bacteria 980
46 Ga0070664_100847135 3300005564 Bacteria 856
47 Ga0068857_100064487 3300005577 Bacteria 3257
48 Ga0068857_100411592 3300005577 Bacteria 1259
49 Ga0068857_100737201 3300005577 Bacteria 938
50 Ga0068854_100210354 3300005578 Bacteria 1534
51 Ga0068856_100123981 3300005614 Bacteria 2586
52 Ga0068856_100164450 3300005614 Bacteria 2230
53 Ga0068856_100476591 3300005614 Bacteria 1269
54 Ga0068852_100001653 3300005616 Bacteria 15211
55 Ga0068852_100385338 3300005616 Bacteria 1376
56 Ga0068852_100425703 3300005616 Bacteria 1310
57 Ga0068852_100484964 3300005616 Bacteria 1229
58 Ga0068859_100063061 3300005617 Bacteria 3737
59 Ga0068859_100078539 3300005617 Bacteria 3341
60 Ga0068864_100103565 3300005618 Bacteria 2527
61 Ga0068851_10142393 3300005834 Bacteria 1305
62 Ga0068863_100004965 3300005841 Bacteria 13111
63 Ga0068863_100066644 3300005841 Bacteria 3405
64 Ga0068858_100023611 3300005842 Bacteria 5729
65 Ga0068858_100028923 3300005842 Bacteria 5146
66 Ga0068858_100124456 3300005842 Bacteria 2413
67 Ga0068860_100024976 3300005843 Bacteria 5769
68 Ga0068860_100036007 3300005843 Bacteria 4744
69 Ga0068862_100074055 3300005844 Bacteria 2943
70 Ga0075363_100000344 3300006048 Bacteria 13934
71 Ga0075364_10011689 3300006051 Bacteria 5340
72 Ga0075432_10001164 3300006058 Bacteria 8421
73 Ga0075362_10000021 3300006177 Bacteria 62684
74 Ga0075362_10037820 3300006177 Bacteria 2118
75 Ga0075362_10097502 3300006177 Bacteria 1371
76 Ga0075369_10000873 3300006186 Bacteria 9992
77 Ga0075369_10143823 3300006186 Bacteria 1088
78 Ga0075366_10000599 3300006195 Bacteria 16895
79 Ga0075366_10006378 3300006195 Bacteria 6460
80 Ga0075366_10027873 3300006195 Bacteria 3315
81 Ga0075366_10276567 3300006195 Bacteria 1026
82 Ga0075370_10000068 3300006353 Bacteria 31378
83 Ga0075370_10051857 3300006353 Bacteria 2327
84 Ga0075370_10126821 3300006353 Bacteria 1488
85 Ga0075370_10252154 3300006353 Bacteria 1046
86 Ga0075370_10272081 3300006353 Bacteria 1005
87 Ga0068871_100677511 3300006358 Bacteria 943
88 Ga0097620_100063057 3300006931 Bacteria 3737
89 Ga0097620_100078541 3300006931 Bacteria 3341
90 Ga0079104_1039393 3300006946 Bacteria 1114
91 Ga0105251_10002096 3300009011 Bacteria 16079
92 Ga0105240_10075934 3300009093 Bacteria 4144
93 Ga0111539_10652172 3300009094 Bacteria 1226
94 Ga0105241_10141319 3300009174 Bacteria 1960
95 Ga0105248_10006630 3300009177 Bacteria 12693
96 Ga0105248_10459984 3300009177 Bacteria 1434
97 Ga0105248_10926487 3300009177 Bacteria 984
98 Ga0105237_10308832 3300009545 Bacteria 1584
99 Ga0105249_10254514 3300009553 Bacteria 1742
100 Ga0105239_10114617 3300010375 Bacteria 2989
101 Ga0105246_10000073 3300011119 Bacteria 41786
102 Ga0157373_10018180 3300013100 Bacteria 5119
103 Ga0157373_10035119 3300013100 Bacteria 3600
104 Ga0157371_10008199 3300013102 Bacteria 8354
105 Ga0157371_10055953 3300013102 Bacteria 2798
106 Ga0157369_10039530 3300013105 Bacteria 5154
107 Ga0157369_10299874 3300013105 Bacteria 1672
108 Ga0163162_10058766 3300013306 Bacteria 3875
109 Ga0157372_10051535 3300013307 Bacteria 4581
110 Ga0157372_11036992 3300013307 Bacteria 949
111 Ga0157372_11197425 3300013307 Bacteria 878
112 Ga0157380_10583137 3300014326 Bacteria 1103
113 Ga0207697_10022440 3300025315 Bacteria 2586
114 Ga0207697_10078314 3300025315 Bacteria 1391
115 Ga0207656_10254394 3300025321 Bacteria 861
116 Ga0207713_1003711 3300025735 Bacteria 10268
117 Ga0207680_10052490 3300025903 Bacteria 2443
118 Ga0207647_10013448 3300025904 Bacteria 5671
119 Ga0207647_10223154 3300025904 Bacteria 1086
120 Ga0207645_10082244 3300025907 Bacteria 2064
121 Ga0207705_10000004 3300025909 Bacteria 705756
122 Ga0207705_10000787 3300025909 Bacteria 26021
123 Ga0207705_10042265 3300025909 Bacteria 3273
124 Ga0207705_10644415 3300025909 Bacteria 824
125 Ga0207707_10015036 3300025912 Bacteria 6738
126 Ga0207695_10013984 3300025913 Bacteria 9533
127 Ga0207660_10092767 3300025917 Bacteria 2242
128 Ga0207660_10179970 3300025917 Bacteria 1641
129 Ga0207657_10000196 3300025919 Bacteria 62836
130 Ga0207649_10159459 3300025920 Bacteria 1562
131 Ga0207649_10167180 3300025920 Bacteria 1529
132 Ga0207649_10507694 3300025920 Bacteria 918
133 Ga0207652_10064842 3300025921 Bacteria 3161
134 Ga0207652_10612426 3300025921 Bacteria 976
135 Ga0207652_10690422 3300025921 Bacteria 911
136 Ga0207646_11040689 3300025922 Bacteria 722
137 Ga0207681_10000500 3300025923 Bacteria 27290
138 Ga0207681_10001644 3300025923 Bacteria 14403
139 Ga0207650_10269127 3300025925 Bacteria 1384
140 Ga0207659_10213825 3300025926 Bacteria 1547
141 Ga0207644_10000003 3300025931 Bacteria 585905
142 Ga0207644_10001364 3300025931 Bacteria 15709
143 Ga0207644_10039760 3300025931 Bacteria 3321
144 Ga0207690_10004941 3300025932 Bacteria 7870
145 Ga0207690_10100116 3300025932 Bacteria 2068
146 Ga0207690_10112122 3300025932 Bacteria 1966
147 Ga0207690_10896651 3300025932 Bacteria 735
148 Ga0207706_10024604 3300025933 Bacteria 5398
149 Ga0207706_10030891 3300025933 Bacteria 4776
150 Ga0207706_10039096 3300025933 Bacteria 4206
151 Ga0207711_10015204 3300025941 Bacteria 6391
152 Ga0207661_10489589 3300025944 Bacteria 1123
153 Ga0207679_10011625 3300025945 Bacteria 5713
154 Ga0207679_10095781 3300025945 Bacteria 2308
155 Ga0207667_10083462 3300025949 Bacteria 3308
156 Ga0207667_10103269 3300025949 Bacteria 2940
157 Ga0207667_10206347 3300025949 Bacteria 2015
158 Ga0207712_10461994 3300025961 Bacteria 1078
159 Ga0207668_10015599 3300025972 Bacteria 4723
160 Ga0207668_10357385 3300025972 Bacteria 1223
161 Ga0207640_10002547 3300025981 Bacteria 9773
162 Ga0207640_10388300 3300025981 Bacteria 1133
163 Ga0207640_10457564 3300025981 Bacteria 1053
164 Ga0207658_10004667 3300025986 Bacteria 9497
165 Ga0207658_10347471 3300025986 Bacteria 1291
166 Ga0207703_10003420 3300026035 Bacteria 13327
167 Ga0207703_10074471 3300026035 Bacteria 2812
168 Ga0207703_10089848 3300026035 Bacteria 2580
169 Ga0207639_10021040 3300026041 Bacteria 4679
170 Ga0207639_10571922 3300026041 Bacteria 1039
171 Ga0207639_11534905 3300026041 Bacteria 625
172 Ga0207678_10103313 3300026067 Bacteria 2433
173 Ga0207702_10057923 3300026078 Bacteria 3295
174 Ga0207641_10036992 3300026088 Bacteria 4075
175 Ga0207676_10032014 3300026095 Bacteria 3959
176 Ga0207676_10272241 3300026095 Bacteria 1534
177 Ga0207674_10015328 3300026116 Bacteria 8424
178 Ga0207674_10061600 3300026116 Bacteria 3791
179 Ga0207683_10134273 3300026121 Bacteria 2227
180 Ga0207698_10000499 3300026142 Bacteria 22908
181 Ga0207698_10316849 3300026142 Bacteria 1459
182 Ga0207698_10478829 3300026142 Bacteria 1207
183 Ga0207698_11152265 3300026142 Bacteria 789
184 Ga0209983_1007430 3300027665 Bacteria 2246
185 Ga0209974_10004671 3300027876 Bacteria 4869
186 Ga0209974_10045456 3300027876 Bacteria 1466
187 Ga0268266_10000317 3300028379 Bacteria 76446
188 Ga0268266_10116288 3300028379 Bacteria 2375
189 Ga0268265_10941159 3300028380 Bacteria 850
190 Ga0268265_11126072 3300028380 Bacteria 780
191 Ga0268264_10013923 3300028381 Bacteria 6610
192 Ga0268264_10026359 3300028381 Bacteria 4748
193 Ga0268264_10030588 3300028381 Bacteria 4413
194 Ga0316579_10031615 3300031691 Bacteria 2424
195 Ga0316576_10328526 3300031727 Bacteria 1140
196 Ga0307405_10019285 3300031731 Bacteria 3784
197 Ga0307405_10499307 3300031731 Bacteria 975
198 Ga0307413_10299807 3300031824 Bacteria 1218
199 Ga0307413_11646123 3300031824 Bacteria 571
200 Ga0307412_10093920 3300031911 Bacteria 2105
201 Ga0307412_10303347 3300031911 Bacteria 1263
202 Ga0307409_100397743 3300031995 Bacteria 1315
203 Ga0307416_100600817 3300032002 Bacteria 1180
204 Ga0307414_10164622 3300032004 Bacteria 1766
205 Ga0307414_10581217 3300032004 Bacteria 1002
206 Ga0307414_10607521 3300032004 Bacteria 981
207 Ga0307411_10327209 3300032005 Bacteria 1240
208 Ga0307411_10952638 3300032005 Bacteria 766
209 Ga0316583_10002928 3300032133 Bacteria 5998
210 Ga0316582_0003592 3300036647 Bacteria 7642
211 Ga0316584_0103861 3300036712 Bacteria 2127
212 Ga0451847_0782764 3300041503 Bacteria 705
213 Ga0451853_0449570 3300041512 Bacteria 841
214 Ga0451853_1059436 3300041512 Bacteria 1282
215 Ga0439431_0236944 3300041997 Bacteria 539
216 Ga0450893_0008300 3300042532 Bacteria 1690
217 Ga0466970_0232523 3300044765 Bacteria 1030
218 Ga0451576_0000007 3300045051 Bacteria 782228
219 Ga0495638_0334220 3300046460 Bacteria 805
220 Ga0495625_0307454 3300046660 Bacteria 1013
221 Ga0495670_0508409 3300046691 Bacteria 654
222 Ga0496100_0301388 3300048903 Bacteria 1199
223 Ga0496101_0033994 3300048904 Bacteria 3599
224 Ga0496102_0250451 3300048905 Bacteria 1670
225 Ga0496102_0322792 3300048905 Bacteria 1454
226 Ga0496103_0017886 3300048906 Bacteria 4247
227 Ga0496103_0200178 3300048906 Bacteria 1284
228 Ga0496104_0183278 3300048907 Bacteria 2004
229 Ga0496105_0031184 3300048908 Bacteria 4369
230 Ga0496105_0443475 3300048908 Bacteria 1025
231 Ga0496106_0000284 3300048909 Bacteria 35805
232 Ga0496108_0819839 3300048911 Bacteria 802
233 Ga0496109_0243726 3300048912 Bacteria 1692
234 Ga0496110_0083876 3300048913 Bacteria 2843
235 Ga0496111_0045724 3300048914 Bacteria 3150
236 Ga0496111_0538902 3300048914 Bacteria 857
237 Ga0496112_0576861 3300048915 Bacteria 1057
238 Ga0496113_0092750 3300048916 Bacteria 2330
239 Ga0496116_0012976 3300048919 Bacteria 6758
240 Ga0496117_0066436 3300048920 Bacteria 2446
241 Ga0496118_0047378 3300048921 Bacteria 3331
242 Ga0496119_0058322 3300048922 Bacteria 2327
243 Ga0496121_0000031 3300048924 Bacteria 384119
244 Ga0496121_0031741 3300048924 Bacteria 4818
245 Ga0496122_0132803 3300048925 Bacteria 1577
246 Ga0496123_0048686 3300048926 Bacteria 2849
247 Ga0496124_0215782 3300048927 Bacteria 1447
248 Ga0496125_0041647 3300048928 Bacteria 3923
249 Ga0496126_0003013 3300048929 Bacteria 21851
250 Ga0496126_0008820 3300048929 Bacteria 10813
251 Ga0496126_0446609 3300048929 Bacteria 1041
252 Ga0501034_0490559 3300049571 Bacteria 1143
253 Ga0501043_0254562 3300049579 Bacteria 1352
254 Ga0501047_0485419 3300049581 Bacteria 1063
255 Ga0501249_052614 3300049679 Bacteria 936
256 Ga0501268_037646 3300049765 Bacteria 900
257 Ga0501044_0001291 3300049823 Bacteria 29606
258 Ga0501044_0104537 3300049823 Bacteria 2846
259 Ga0501044_0480751 3300049823 Bacteria 1145
260 nmdc:mga03683_139_c1 3300050489 Bacteria 24530
261 nmdc:mga03683_7233_c1 3300050489 Bacteria 3845
262 nmdc:mga03n38_367_c1 3300050490 Bacteria 11073
263 nmdc:mga00v17_1024_c1 3300050491 Bacteria 14913
264 nmdc:mga0k408_20763_c1 3300050493 Bacteria 3684
265 nmdc:mga0k408_21447_c1 3300050493 Bacteria 2950
266 nmdc:mga0k408_45_c1 3300050493 Bacteria 63055
267 nmdc:mga07m45_39_c1 3300050496 Bacteria 63381
268 nmdc:mga07m45_53336_c1 3300050496 Bacteria 2284
269 nmdc:mga07m45_563552_c1 3300050496 Bacteria 658
270 nmdc:mga07m45_84387_c1 3300050496 Bacteria 1816
271 nmdc:mga08y16_613782_c1 3300050511 Bacteria 1095
272 nmdc:mga0sz30_127279_c1 3300050516 Bacteria 1121
273 nmdc:mga0sz30_1903_c1 3300050516 Bacteria 7450
274 nmdc:mga0sz30_9867_c2 3300050516 Bacteria 1862
275 Ga0500643_000001 3300053087 Bacteria 1440111
276 Ga0500643_022000 3300053087 Bacteria 2060
277 Ga0500595_027915 3300053119 Bacteria 1928
278 Ga0500607_002571 3300053121 Bacteria 14459
279 Ga0500564_221918 3300053138 Bacteria 764
280 Ga0500590_022976 3300053148 Bacteria 3240
281 Ga0500616_0009289 3300053153 Bacteria 5991
282 Ga0500622_0001392 3300053156 Bacteria 19476
283 Ga0500645_008444 3300053730 Bacteria 3518
284 Ga0500645_089585 3300053730 Bacteria 873
285 Ga0500596_015312 3300053735 Bacteria 1152

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041997 Ga0439431_0236944 Ga0439431_0236944_39_509 156
2 3300009545 Ga0105237_10308832 Ga0105237_103088322 160
3 3300041503 Ga0451847_0782764 Ga0451847_0782764_143_655 165
4 iso_pu_bacteria 2643221588 2643949371 166
5 iso_pu_bacteria 2739367664 2739651631 166
6 iso_pu_bacteria 2739367865 2740030104 166
7 iso_pu_bacteria 2882806704 2882807889 166
8 iso_pu_bacteria 2896253425 2896255314 166
9 3300049581 Ga0501047_0485419 Ga0501047_0485419_95_607 167
10 iso_pu_bacteria 2896184354 2896184764 167
11 iso_pu_bacteria 3000865235 3000865958 167
12 3300048924 Ga0496121_0000031 Ga0496121_0000031_376694_377200 168
13 3300049823 Ga0501044_0001291 Ga0501044_0001291_26733_27239 168
14 3300006195 Ga0075366_10006378 Ga0075366_100063785 169
15 3300013102 Ga0157371_10055953 Ga0157371_100559532 169
16 3300013105 Ga0157369_10299874 Ga0157369_102998742 169
17 3300032004 Ga0307414_10581217 Ga0307414_105812172 169
18 3300042532 Ga0450893_0008300 Ga0450893_0008300_272_781 169
19 3300044765 Ga0466970_0232523 Ga0466970_0232523_284_793 169
20 3300005289 Ga0065704_10243139 Ga0065704_102431391 170
21 3300005295 Ga0065707_10091593 Ga0065707_100915934 170
22 3300005295 Ga0065707_10413958 Ga0065707_104139581 170
23 3300005327 Ga0070658_10000273 Ga0070658_1000027311 170
24 3300005336 Ga0070680_100008923 Ga0070680_1000089234 170
25 3300005336 Ga0070680_100326050 Ga0070680_1003260502 170
26 3300005337 Ga0070682_100348568 Ga0070682_1003485682 170
27 3300005339 Ga0070660_100057790 Ga0070660_1000577903 170
28 3300005344 Ga0070661_100020377 Ga0070661_1000203774 170
29 3300005354 Ga0070675_100178472 Ga0070675_1001784722 170
30 3300005355 Ga0070671_100017767 Ga0070671_1000177672 170
31 3300005366 Ga0070659_100088634 Ga0070659_1000886343 170
32 3300005366 Ga0070659_100628081 Ga0070659_1006280812 170
33 3300005455 Ga0070663_100067231 Ga0070663_1000672313 170
34 3300005456 Ga0070678_100100011 Ga0070678_1001000113 170
35 3300005457 Ga0070662_100011517 Ga0070662_1000115173 170
36 3300005457 Ga0070662_100015843 Ga0070662_1000158434 170
37 3300005458 Ga0070681_10021252 Ga0070681_100212524 170
38 3300005530 Ga0070679_100698506 Ga0070679_1006985061 170
39 3300005535 Ga0070684_100222086 Ga0070684_1002220862 170
40 3300005539 Ga0068853_100357864 Ga0068853_1003578642 170
41 3300005563 Ga0068855_100027987 Ga0068855_1000279876 170
42 3300005563 Ga0068855_100041134 Ga0068855_1000411343 170
43 3300005563 Ga0068855_100252027 Ga0068855_1002520272 170
44 3300005564 Ga0070664_100649385 Ga0070664_1006493852 170
45 3300005564 Ga0070664_100847135 Ga0070664_1008471351 170
46 3300005577 Ga0068857_100064487 Ga0068857_1000644872 170
47 3300005577 Ga0068857_100411592 Ga0068857_1004115922 170
48 3300005577 Ga0068857_100737201 Ga0068857_1007372012 170
49 3300005578 Ga0068854_100210354 Ga0068854_1002103542 170
50 3300005614 Ga0068856_100123981 Ga0068856_1001239813 170
51 3300005614 Ga0068856_100164450 Ga0068856_1001644504 170
52 3300005614 Ga0068856_100476591 Ga0068856_1004765912 170
53 3300005616 Ga0068852_100001653 Ga0068852_1000016537 170
54 3300005616 Ga0068852_100385338 Ga0068852_1003853381 170
55 3300005616 Ga0068852_100425703 Ga0068852_1004257032 170
56 3300005616 Ga0068852_100484964 Ga0068852_1004849642 170
57 3300005617 Ga0068859_100078539 Ga0068859_1000785392 170
58 3300005834 Ga0068851_10142393 Ga0068851_101423932 170
59 3300005842 Ga0068858_100028923 Ga0068858_1000289236 170
60 3300006058 Ga0075432_10001164 Ga0075432_100011644 170
61 3300006177 Ga0075362_10037820 Ga0075362_100378202 170
62 3300006186 Ga0075369_10143823 Ga0075369_101438232 170
63 3300006353 Ga0075370_10272081 Ga0075370_102720812 170
64 3300006358 Ga0068871_100677511 Ga0068871_1006775112 170
65 3300006931 Ga0097620_100078541 Ga0097620_1000785412 170
66 3300009093 Ga0105240_10075934 Ga0105240_100759342 170
67 3300009174 Ga0105241_10141319 Ga0105241_101413193 170
68 3300009177 Ga0105248_10926487 Ga0105248_109264872 170
69 3300010375 Ga0105239_10114617 Ga0105239_101146174 170
70 3300011119 Ga0105246_10000073 Ga0105246_1000007327 170
71 3300013100 Ga0157373_10018180 Ga0157373_100181802 170
72 3300013100 Ga0157373_10035119 Ga0157373_100351193 170
73 3300013102 Ga0157371_10008199 Ga0157371_100081994 170
74 3300013105 Ga0157369_10039530 Ga0157369_100395304 170
75 3300013307 Ga0157372_10051535 Ga0157372_100515354 170
76 3300013307 Ga0157372_11036992 Ga0157372_110369922 170
77 3300014326 Ga0157380_10583137 Ga0157380_105831372 170
78 3300025315 Ga0207697_10078314 Ga0207697_100783142 170
79 3300025321 Ga0207656_10254394 Ga0207656_102543941 170
80 3300025904 Ga0207647_10013448 Ga0207647_100134485 170
81 3300025904 Ga0207647_10223154 Ga0207647_102231542 170
82 3300025909 Ga0207705_10000004 Ga0207705_10000004454 170
83 3300025909 Ga0207705_10000787 Ga0207705_100007879 170
84 3300025909 Ga0207705_10042265 Ga0207705_100422654 170
85 3300025912 Ga0207707_10015036 Ga0207707_100150365 170
86 3300025913 Ga0207695_10013984 Ga0207695_100139848 170
87 3300025917 Ga0207660_10092767 Ga0207660_100927672 170
88 3300025917 Ga0207660_10179970 Ga0207660_101799702 170
89 3300025919 Ga0207657_10000196 Ga0207657_1000019635 170
90 3300025920 Ga0207649_10159459 Ga0207649_101594592 170
91 3300025920 Ga0207649_10507694 Ga0207649_105076941 170
92 3300025921 Ga0207652_10064842 Ga0207652_100648422 170
93 3300025921 Ga0207652_10612426 Ga0207652_106124262 170
94 3300025926 Ga0207659_10213825 Ga0207659_102138253 170
95 3300025931 Ga0207644_10039760 Ga0207644_100397602 170
96 3300025932 Ga0207690_10004941 Ga0207690_100049417 170
97 3300025932 Ga0207690_10896651 Ga0207690_108966511 170
98 3300025933 Ga0207706_10024604 Ga0207706_100246045 170
99 3300025933 Ga0207706_10030891 Ga0207706_100308914 170
100 3300025944 Ga0207661_10489589 Ga0207661_104895892 170
101 3300025945 Ga0207679_10011625 Ga0207679_100116254 170
102 3300025949 Ga0207667_10083462 Ga0207667_100834623 170
103 3300025949 Ga0207667_10103269 Ga0207667_101032694 170
104 3300025949 Ga0207667_10206347 Ga0207667_102063472 170
105 3300025981 Ga0207640_10002547 Ga0207640_100025474 170
106 3300025981 Ga0207640_10457564 Ga0207640_104575642 170
107 3300025986 Ga0207658_10347471 Ga0207658_103474712 170
108 3300026035 Ga0207703_10003420 Ga0207703_100034206 170
109 3300026041 Ga0207639_10021040 Ga0207639_100210403 170
110 3300026041 Ga0207639_10571922 Ga0207639_105719222 170
111 3300026041 Ga0207639_11534905 Ga0207639_115349051 170
112 3300026067 Ga0207678_10103313 Ga0207678_101033133 170
113 3300026078 Ga0207702_10057923 Ga0207702_100579233 170
114 3300026095 Ga0207676_10272241 Ga0207676_102722412 170
115 3300026116 Ga0207674_10015328 Ga0207674_100153286 170
116 3300026116 Ga0207674_10061600 Ga0207674_100616002 170
117 3300026121 Ga0207683_10134273 Ga0207683_101342733 170
118 3300026142 Ga0207698_10000499 Ga0207698_100004995 170
119 3300026142 Ga0207698_10316849 Ga0207698_103168492 170
120 3300026142 Ga0207698_10478829 Ga0207698_104788292 170
121 3300026142 Ga0207698_11152265 Ga0207698_111522652 170
122 3300027665 Ga0209983_1007430 Ga0209983_10074303 170
123 3300027876 Ga0209974_10004671 Ga0209974_100046713 170
124 3300027876 Ga0209974_10045456 Ga0209974_100454562 170
125 3300028381 Ga0268264_10013923 Ga0268264_100139237 170
126 3300031691 Ga0316579_10031615 Ga0316579_100316153 170
127 3300031727 Ga0316576_10328526 Ga0316576_103285262 170
128 3300031731 Ga0307405_10499307 Ga0307405_104993072 170
129 3300031824 Ga0307413_10299807 Ga0307413_102998072 170
130 3300031824 Ga0307413_11646123 Ga0307413_116461231 170
131 3300031911 Ga0307412_10303347 Ga0307412_103033472 170
132 3300031995 Ga0307409_100397743 Ga0307409_1003977432 170
133 3300032002 Ga0307416_100600817 Ga0307416_1006008171 170
134 3300032004 Ga0307414_10607521 Ga0307414_106075212 170
135 3300032005 Ga0307411_10327209 Ga0307411_103272092 170
136 3300032005 Ga0307411_10952638 Ga0307411_109526382 170
137 3300032133 Ga0316583_10002928 Ga0316583_100029287 170
138 3300036647 Ga0316582_0003592 Ga0316582_0003592_5556_6068 170
139 3300036712 Ga0316584_0103861 Ga0316584_0103861_532_1044 170
140 3300041512 Ga0451853_1059436 Ga0451853_1059436_240_761 170
141 3300045051 Ga0451576_0000007 Ga0451576_0000007_139981_140493 170
142 3300048905 Ga0496102_0250451 Ga0496102_0250451_895_1407 170
143 3300048908 Ga0496105_0443475 Ga0496105_0443475_459_971 170
144 3300048911 Ga0496108_0819839 Ga0496108_0819839_91_603 170
145 3300048912 Ga0496109_0243726 Ga0496109_0243726_1028_1540 170
146 3300048913 Ga0496110_0083876 Ga0496110_0083876_2241_2753 170
147 3300048914 Ga0496111_0538902 Ga0496111_0538902_26_538 170
148 3300048916 Ga0496113_0092750 Ga0496113_0092750_89_601 170
149 3300048929 Ga0496126_0003013 Ga0496126_0003013_3526_4038 170
150 3300049579 Ga0501043_0254562 Ga0501043_0254562_702_1214 170
151 3300049679 Ga0501249_052614 Ga0501249_052614_154_675 170
152 3300049765 Ga0501268_037646 Ga0501268_037646_306_827 170
153 3300049823 Ga0501044_0480751 Ga0501044_0480751_417_929 170
154 3300050496 nmdc:mga07m45_563552_c1 nmdc:mga07m45_563552_c1_77_589 170
155 3300050496 nmdc:mga07m45_84387_c1 nmdc:mga07m45_84387_c1_941_1453 170
156 3300050516 nmdc:mga0sz30_127279_c1 nmdc:mga0sz30_127279_c1_439_951 170
157 3300053087 Ga0500643_000001 Ga0500643_000001_1309200_1309712 170
158 3300053153 Ga0500616_0009289 Ga0500616_0009289_1516_2028 170
159 3300050493 nmdc:mga0k408_21447_c1 nmdc:mga0k408_21447_c1_806_1330 171
160 2162886007 SwRhRL2b_contig_254253 SwRhRL2b_0612.00002790 172
161 3300005289 Ga0065704_10070209 Ga0065704_1007020966 172
162 3300005289 Ga0065704_10077526 Ga0065704_100775266 172
163 3300005331 Ga0070670_100062503 Ga0070670_1000625034 172
164 3300005340 Ga0070689_100985243 Ga0070689_1009852432 172
165 3300005344 Ga0070661_100082992 Ga0070661_1000829924 172
166 3300005347 Ga0070668_100002216 Ga0070668_1000022164 172
167 3300005353 Ga0070669_100001004 Ga0070669_10000100411 172
168 3300005353 Ga0070669_100001577 Ga0070669_1000015777 172
169 3300005355 Ga0070671_100000054 Ga0070671_10000005459 172
170 3300005355 Ga0070671_100010621 Ga0070671_1000106217 172
171 3300005366 Ga0070659_100018672 Ga0070659_1000186725 172
172 3300005366 Ga0070659_100212185 Ga0070659_1002121852 172
173 3300005367 Ga0070667_100022444 Ga0070667_1000224446 172
174 3300005455 Ga0070663_100641896 Ga0070663_1006418962 172
175 3300005457 Ga0070662_100049757 Ga0070662_1000497572 172
176 3300005468 Ga0070707_100571234 Ga0070707_1005712341 172
177 3300005548 Ga0070665_100000076 Ga0070665_100000076155 172
178 3300005548 Ga0070665_100234899 Ga0070665_1002348993 172
179 3300005564 Ga0070664_100136921 Ga0070664_1001369211 172
180 3300005617 Ga0068859_100063061 Ga0068859_1000630615 172
181 3300005618 Ga0068864_100103565 Ga0068864_1001035652 172
182 3300005841 Ga0068863_100004965 Ga0068863_10000496515 172
183 3300005841 Ga0068863_100066644 Ga0068863_1000666443 172
184 3300005842 Ga0068858_100023611 Ga0068858_1000236114 172
185 3300005842 Ga0068858_100124456 Ga0068858_1001244563 172
186 3300005843 Ga0068860_100024976 Ga0068860_1000249764 172
187 3300005843 Ga0068860_100036007 Ga0068860_1000360075 172
188 3300005844 Ga0068862_100074055 Ga0068862_1000740552 172
189 3300006048 Ga0075363_100000344 Ga0075363_1000003445 172
190 3300006051 Ga0075364_10011689 Ga0075364_100116893 172
191 3300006177 Ga0075362_10000021 Ga0075362_1000002156 172
192 3300006177 Ga0075362_10097502 Ga0075362_100975022 172
193 3300006186 Ga0075369_10000873 Ga0075369_100008734 172
194 3300006195 Ga0075366_10000599 Ga0075366_1000059913 172
195 3300006195 Ga0075366_10027873 Ga0075366_100278733 172
196 3300006195 Ga0075366_10276567 Ga0075366_102765672 172
197 3300006353 Ga0075370_10000068 Ga0075370_1000006815 172
198 3300006353 Ga0075370_10051857 Ga0075370_100518572 172
199 3300006353 Ga0075370_10126821 Ga0075370_101268212 172
200 3300006353 Ga0075370_10252154 Ga0075370_102521541 172
201 3300006931 Ga0097620_100063057 Ga0097620_1000630572 172
202 3300006946 Ga0079104_1039393 Ga0079104_10393932 172
203 3300009011 Ga0105251_10002096 Ga0105251_100020968 172
204 3300009094 Ga0111539_10652172 Ga0111539_106521721 172
205 3300009177 Ga0105248_10006630 Ga0105248_100066308 172
206 3300009177 Ga0105248_10459984 Ga0105248_104599842 172
207 3300009553 Ga0105249_10254514 Ga0105249_102545142 172
208 3300013306 Ga0163162_10058766 Ga0163162_100587662 172
209 3300013307 Ga0157372_11197425 Ga0157372_111974252 172
210 3300025315 Ga0207697_10022440 Ga0207697_100224402 172
211 3300025735 Ga0207713_1003711 Ga0207713_10037118 172
212 3300025903 Ga0207680_10052490 Ga0207680_100524902 172
213 3300025907 Ga0207645_10082244 Ga0207645_100822441 172
214 3300025909 Ga0207705_10644415 Ga0207705_106444152 172
215 3300025920 Ga0207649_10167180 Ga0207649_101671802 172
216 3300025921 Ga0207652_10690422 Ga0207652_106904221 172
217 3300025922 Ga0207646_11040689 Ga0207646_110406891 172
218 3300025923 Ga0207681_10000500 Ga0207681_1000050024 172
219 3300025923 Ga0207681_10001644 Ga0207681_1000164411 172
220 3300025925 Ga0207650_10269127 Ga0207650_102691272 172
221 3300025931 Ga0207644_10000003 Ga0207644_10000003422 172
222 3300025931 Ga0207644_10001364 Ga0207644_100013644 172
223 3300025932 Ga0207690_10100116 Ga0207690_101001162 172
224 3300025932 Ga0207690_10112122 Ga0207690_101121222 172
225 3300025933 Ga0207706_10039096 Ga0207706_100390962 172
226 3300025941 Ga0207711_10015204 Ga0207711_100152042 172
227 3300025945 Ga0207679_10095781 Ga0207679_100957814 172
228 3300025961 Ga0207712_10461994 Ga0207712_104619942 172
229 3300025972 Ga0207668_10015599 Ga0207668_100155997 172
230 3300025972 Ga0207668_10357385 Ga0207668_103573852 172
231 3300025981 Ga0207640_10388300 Ga0207640_103883002 172
232 3300025986 Ga0207658_10004667 Ga0207658_100046676 172
233 3300026035 Ga0207703_10074471 Ga0207703_100744712 172
234 3300026035 Ga0207703_10089848 Ga0207703_100898482 172
235 3300026088 Ga0207641_10036992 Ga0207641_100369924 172
236 3300026095 Ga0207676_10032014 Ga0207676_100320144 172
237 3300028379 Ga0268266_10000317 Ga0268266_1000031771 172
238 3300028379 Ga0268266_10116288 Ga0268266_101162882 172
239 3300028380 Ga0268265_10941159 Ga0268265_109411591 172
240 3300028380 Ga0268265_11126072 Ga0268265_111260722 172
241 3300028381 Ga0268264_10026359 Ga0268264_100263593 172
242 3300028381 Ga0268264_10030588 Ga0268264_100305882 172
243 3300031731 Ga0307405_10019285 Ga0307405_100192852 172
244 3300031911 Ga0307412_10093920 Ga0307412_100939202 172
245 3300032004 Ga0307414_10164622 Ga0307414_101646223 172
246 3300041512 Ga0451853_0449570 Ga0451853_0449570_116_640 172
247 3300046460 Ga0495638_0334220 Ga0495638_0334220_153_671 172
248 3300046660 Ga0495625_0307454 Ga0495625_0307454_130_648 172
249 3300046691 Ga0495670_0508409 Ga0495670_0508409_115_633 172
250 3300048903 Ga0496100_0301388 Ga0496100_0301388_458_985 172
251 3300048904 Ga0496101_0033994 Ga0496101_0033994_2187_2714 172
252 3300048905 Ga0496102_0322792 Ga0496102_0322792_661_1188 172
253 3300048906 Ga0496103_0017886 Ga0496103_0017886_81_599 172
254 3300048906 Ga0496103_0200178 Ga0496103_0200178_661_1188 172
255 3300048907 Ga0496104_0183278 Ga0496104_0183278_586_1116 172
256 3300048908 Ga0496105_0031184 Ga0496105_0031184_2343_2870 172
257 3300048909 Ga0496106_0000284 Ga0496106_0000284_32969_33496 172
258 3300048914 Ga0496111_0045724 Ga0496111_0045724_333_860 172
259 3300048915 Ga0496112_0576861 Ga0496112_0576861_378_905 172
260 3300048919 Ga0496116_0012976 Ga0496116_0012976_2202_2720 172
261 3300048920 Ga0496117_0066436 Ga0496117_0066436_1301_1819 172
262 3300048921 Ga0496118_0047378 Ga0496118_0047378_459_977 172
263 3300048922 Ga0496119_0058322 Ga0496119_0058322_1602_2120 172
264 3300048924 Ga0496121_0031741 Ga0496121_0031741_3972_4490 172
265 3300048925 Ga0496122_0132803 Ga0496122_0132803_59_577 172
266 3300048926 Ga0496123_0048686 Ga0496123_0048686_1589_2107 172
267 3300048927 Ga0496124_0215782 Ga0496124_0215782_481_999 172
268 3300048928 Ga0496125_0041647 Ga0496125_0041647_3240_3758 172
269 3300048929 Ga0496126_0008820 Ga0496126_0008820_8344_8868 172
270 3300048929 Ga0496126_0446609 Ga0496126_0446609_122_640 172
271 3300049571 Ga0501034_0490559 Ga0501034_0490559_26_553 172
272 3300049823 Ga0501044_0104537 Ga0501044_0104537_2285_2812 172
273 3300050489 nmdc:mga03683_139_c1 nmdc:mga03683_139_c1_13418_13942 172
274 3300050489 nmdc:mga03683_7233_c1 nmdc:mga03683_7233_c1_2412_2951 172
275 3300050490 nmdc:mga03n38_367_c1 nmdc:mga03n38_367_c1_6838_7362 172
276 3300050491 nmdc:mga00v17_1024_c1 nmdc:mga00v17_1024_c1_11872_12411 172
277 3300050493 nmdc:mga0k408_20763_c1 nmdc:mga0k408_20763_c1_1840_2358 172
278 3300050493 nmdc:mga0k408_45_c1 nmdc:mga0k408_45_c1_13710_14234 172
279 3300050496 nmdc:mga07m45_39_c1 nmdc:mga07m45_39_c1_14961_15485 172
280 3300050496 nmdc:mga07m45_53336_c1 nmdc:mga07m45_53336_c1_738_1256 172
281 3300050511 nmdc:mga08y16_613782_c1 nmdc:mga08y16_613782_c1_441_965 172
282 3300050516 nmdc:mga0sz30_1903_c1 nmdc:mga0sz30_1903_c1_2389_2913 172
283 3300050516 nmdc:mga0sz30_9867_c2 nmdc:mga0sz30_9867_c2_454_993 172
284 3300053087 Ga0500643_022000 Ga0500643_022000_350_868 172
285 3300053119 Ga0500595_027915 Ga0500595_027915_119_637 172
286 3300053121 Ga0500607_002571 Ga0500607_002571_12407_12931 172
287 3300053138 Ga0500564_221918 Ga0500564_221918_69_626 172
288 3300053148 Ga0500590_022976 Ga0500590_022976_1388_1945 172
289 3300053156 Ga0500622_0001392 Ga0500622_0001392_4589_5107 172
290 3300053730 Ga0500645_008444 Ga0500645_008444_1106_1630 172
291 3300053730 Ga0500645_089585 Ga0500645_089585_186_704 172
292 3300053735 Ga0500596_015312 Ga0500596_015312_139_696 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

7

135

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9624 5 164
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9607 5 164
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.9593 5 162
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9532 5 163
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9509 6 163
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9508 6 163 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9422 5 162 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9415 5 163 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9321 6 163 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9233 5 158 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7G6VR98-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9764 2 172 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0K8N6A8-F1-model_v4 deleted 0.9734 3 164
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9709 6 170 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-X5MHH6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9708 5 166 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A660VY32-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9699 6 166 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
90.67 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map