F390911
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 178 | 285 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10308832|Ga0105237_103088322 |
| Length | 192 |
| Sequence | VAERIGVYPGTFDPITLGHADIIRRGAKLVDRLIIGVTTNPSKNPMFTPDERIAIVRREVDAMGLHNIEVVGFNALLMKFAEVQGASVIVRGLRAVADFEYEYQMAGMNQQLNSRIETIFLIHAAHAYPIPSTHRNAALDTIHAYLEPKGIFSRGRFGSWKYEIGNQDHSLMQGVELVDRWLDGSEEKVFRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 3 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 4 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 5 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 6 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 7 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 8 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 114 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 115 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 123 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 124 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 125 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 126 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 127 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 128 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 137 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 138 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 139 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 140 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 141 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 144 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 147 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 148 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 149 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 150 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 151 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 152 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 153 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 154 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 155 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 156 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 161 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 162 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 167 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 171 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 172 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 173 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 174 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 175 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 176 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 177 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 178 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.6 |
| Metatranscriptomes | 0 |
| Isolates | 2.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.04 |
| Nodule | 0.34 |
| Rhizoplane | 5.82 |
| Rhizosphere | 73.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_254253 | 2162886007 | Bacteria | 14576 |
| 2 | Ga0065704_10070209 | 3300005289 | Bacteria | 78459 |
| 3 | Ga0065704_10077526 | 3300005289 | Bacteria | 4705 |
| 4 | Ga0065704_10243139 | 3300005289 | Bacteria | 1009 |
| 5 | Ga0065707_10091593 | 3300005295 | Bacteria | 3912 |
| 6 | Ga0065707_10413958 | 3300005295 | Bacteria | 838 |
| 7 | Ga0070658_10000273 | 3300005327 | Bacteria | 45226 |
| 8 | Ga0070670_100062503 | 3300005331 | Bacteria | 3196 |
| 9 | Ga0070680_100008923 | 3300005336 | Bacteria | 7690 |
| 10 | Ga0070680_100326050 | 3300005336 | Bacteria | 1304 |
| 11 | Ga0070682_100348568 | 3300005337 | Bacteria | 1103 |
| 12 | Ga0070660_100057790 | 3300005339 | Bacteria | 3006 |
| 13 | Ga0070689_100985243 | 3300005340 | Bacteria | 749 |
| 14 | Ga0070661_100020377 | 3300005344 | Bacteria | 4727 |
| 15 | Ga0070661_100082992 | 3300005344 | Bacteria | 2367 |
| 16 | Ga0070668_100002216 | 3300005347 | Bacteria | 14271 |
| 17 | Ga0070669_100001004 | 3300005353 | Bacteria | 20544 |
| 18 | Ga0070669_100001577 | 3300005353 | Bacteria | 16522 |
| 19 | Ga0070675_100178472 | 3300005354 | Bacteria | 1835 |
| 20 | Ga0070671_100000054 | 3300005355 | Bacteria | 77908 |
| 21 | Ga0070671_100010621 | 3300005355 | Bacteria | 7391 |
| 22 | Ga0070671_100017767 | 3300005355 | Bacteria | 5767 |
| 23 | Ga0070659_100018672 | 3300005366 | Bacteria | 5235 |
| 24 | Ga0070659_100088634 | 3300005366 | Bacteria | 2478 |
| 25 | Ga0070659_100212185 | 3300005366 | Bacteria | 1596 |
| 26 | Ga0070659_100628081 | 3300005366 | Bacteria | 925 |
| 27 | Ga0070667_100022444 | 3300005367 | Bacteria | 5234 |
| 28 | Ga0070663_100067231 | 3300005455 | Bacteria | 2599 |
| 29 | Ga0070663_100641896 | 3300005455 | Bacteria | 897 |
| 30 | Ga0070678_100100011 | 3300005456 | Bacteria | 2245 |
| 31 | Ga0070662_100011517 | 3300005457 | Bacteria | 5836 |
| 32 | Ga0070662_100015843 | 3300005457 | Bacteria | 5056 |
| 33 | Ga0070662_100049757 | 3300005457 | Bacteria | 3023 |
| 34 | Ga0070681_10021252 | 3300005458 | Bacteria | 6504 |
| 35 | Ga0070707_100571234 | 3300005468 | Bacteria | 1093 |
| 36 | Ga0070679_100698506 | 3300005530 | Bacteria | 957 |
| 37 | Ga0070684_100222086 | 3300005535 | Bacteria | 1724 |
| 38 | Ga0068853_100357864 | 3300005539 | Bacteria | 1359 |
| 39 | Ga0070665_100000076 | 3300005548 | Bacteria | 189228 |
| 40 | Ga0070665_100234899 | 3300005548 | Bacteria | 1834 |
| 41 | Ga0068855_100027987 | 3300005563 | Bacteria | 6742 |
| 42 | Ga0068855_100041134 | 3300005563 | Bacteria | 5480 |
| 43 | Ga0068855_100252027 | 3300005563 | Bacteria | 1969 |
| 44 | Ga0070664_100136921 | 3300005564 | Bacteria | 2154 |
| 45 | Ga0070664_100649385 | 3300005564 | Bacteria | 980 |
| 46 | Ga0070664_100847135 | 3300005564 | Bacteria | 856 |
| 47 | Ga0068857_100064487 | 3300005577 | Bacteria | 3257 |
| 48 | Ga0068857_100411592 | 3300005577 | Bacteria | 1259 |
| 49 | Ga0068857_100737201 | 3300005577 | Bacteria | 938 |
| 50 | Ga0068854_100210354 | 3300005578 | Bacteria | 1534 |
| 51 | Ga0068856_100123981 | 3300005614 | Bacteria | 2586 |
| 52 | Ga0068856_100164450 | 3300005614 | Bacteria | 2230 |
| 53 | Ga0068856_100476591 | 3300005614 | Bacteria | 1269 |
| 54 | Ga0068852_100001653 | 3300005616 | Bacteria | 15211 |
| 55 | Ga0068852_100385338 | 3300005616 | Bacteria | 1376 |
| 56 | Ga0068852_100425703 | 3300005616 | Bacteria | 1310 |
| 57 | Ga0068852_100484964 | 3300005616 | Bacteria | 1229 |
| 58 | Ga0068859_100063061 | 3300005617 | Bacteria | 3737 |
| 59 | Ga0068859_100078539 | 3300005617 | Bacteria | 3341 |
| 60 | Ga0068864_100103565 | 3300005618 | Bacteria | 2527 |
| 61 | Ga0068851_10142393 | 3300005834 | Bacteria | 1305 |
| 62 | Ga0068863_100004965 | 3300005841 | Bacteria | 13111 |
| 63 | Ga0068863_100066644 | 3300005841 | Bacteria | 3405 |
| 64 | Ga0068858_100023611 | 3300005842 | Bacteria | 5729 |
| 65 | Ga0068858_100028923 | 3300005842 | Bacteria | 5146 |
| 66 | Ga0068858_100124456 | 3300005842 | Bacteria | 2413 |
| 67 | Ga0068860_100024976 | 3300005843 | Bacteria | 5769 |
| 68 | Ga0068860_100036007 | 3300005843 | Bacteria | 4744 |
| 69 | Ga0068862_100074055 | 3300005844 | Bacteria | 2943 |
| 70 | Ga0075363_100000344 | 3300006048 | Bacteria | 13934 |
| 71 | Ga0075364_10011689 | 3300006051 | Bacteria | 5340 |
| 72 | Ga0075432_10001164 | 3300006058 | Bacteria | 8421 |
| 73 | Ga0075362_10000021 | 3300006177 | Bacteria | 62684 |
| 74 | Ga0075362_10037820 | 3300006177 | Bacteria | 2118 |
| 75 | Ga0075362_10097502 | 3300006177 | Bacteria | 1371 |
| 76 | Ga0075369_10000873 | 3300006186 | Bacteria | 9992 |
| 77 | Ga0075369_10143823 | 3300006186 | Bacteria | 1088 |
| 78 | Ga0075366_10000599 | 3300006195 | Bacteria | 16895 |
| 79 | Ga0075366_10006378 | 3300006195 | Bacteria | 6460 |
| 80 | Ga0075366_10027873 | 3300006195 | Bacteria | 3315 |
| 81 | Ga0075366_10276567 | 3300006195 | Bacteria | 1026 |
| 82 | Ga0075370_10000068 | 3300006353 | Bacteria | 31378 |
| 83 | Ga0075370_10051857 | 3300006353 | Bacteria | 2327 |
| 84 | Ga0075370_10126821 | 3300006353 | Bacteria | 1488 |
| 85 | Ga0075370_10252154 | 3300006353 | Bacteria | 1046 |
| 86 | Ga0075370_10272081 | 3300006353 | Bacteria | 1005 |
| 87 | Ga0068871_100677511 | 3300006358 | Bacteria | 943 |
| 88 | Ga0097620_100063057 | 3300006931 | Bacteria | 3737 |
| 89 | Ga0097620_100078541 | 3300006931 | Bacteria | 3341 |
| 90 | Ga0079104_1039393 | 3300006946 | Bacteria | 1114 |
| 91 | Ga0105251_10002096 | 3300009011 | Bacteria | 16079 |
| 92 | Ga0105240_10075934 | 3300009093 | Bacteria | 4144 |
| 93 | Ga0111539_10652172 | 3300009094 | Bacteria | 1226 |
| 94 | Ga0105241_10141319 | 3300009174 | Bacteria | 1960 |
| 95 | Ga0105248_10006630 | 3300009177 | Bacteria | 12693 |
| 96 | Ga0105248_10459984 | 3300009177 | Bacteria | 1434 |
| 97 | Ga0105248_10926487 | 3300009177 | Bacteria | 984 |
| 98 | Ga0105237_10308832 | 3300009545 | Bacteria | 1584 |
| 99 | Ga0105249_10254514 | 3300009553 | Bacteria | 1742 |
| 100 | Ga0105239_10114617 | 3300010375 | Bacteria | 2989 |
| 101 | Ga0105246_10000073 | 3300011119 | Bacteria | 41786 |
| 102 | Ga0157373_10018180 | 3300013100 | Bacteria | 5119 |
| 103 | Ga0157373_10035119 | 3300013100 | Bacteria | 3600 |
| 104 | Ga0157371_10008199 | 3300013102 | Bacteria | 8354 |
| 105 | Ga0157371_10055953 | 3300013102 | Bacteria | 2798 |
| 106 | Ga0157369_10039530 | 3300013105 | Bacteria | 5154 |
| 107 | Ga0157369_10299874 | 3300013105 | Bacteria | 1672 |
| 108 | Ga0163162_10058766 | 3300013306 | Bacteria | 3875 |
| 109 | Ga0157372_10051535 | 3300013307 | Bacteria | 4581 |
| 110 | Ga0157372_11036992 | 3300013307 | Bacteria | 949 |
| 111 | Ga0157372_11197425 | 3300013307 | Bacteria | 878 |
| 112 | Ga0157380_10583137 | 3300014326 | Bacteria | 1103 |
| 113 | Ga0207697_10022440 | 3300025315 | Bacteria | 2586 |
| 114 | Ga0207697_10078314 | 3300025315 | Bacteria | 1391 |
| 115 | Ga0207656_10254394 | 3300025321 | Bacteria | 861 |
| 116 | Ga0207713_1003711 | 3300025735 | Bacteria | 10268 |
| 117 | Ga0207680_10052490 | 3300025903 | Bacteria | 2443 |
| 118 | Ga0207647_10013448 | 3300025904 | Bacteria | 5671 |
| 119 | Ga0207647_10223154 | 3300025904 | Bacteria | 1086 |
| 120 | Ga0207645_10082244 | 3300025907 | Bacteria | 2064 |
| 121 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 122 | Ga0207705_10000787 | 3300025909 | Bacteria | 26021 |
| 123 | Ga0207705_10042265 | 3300025909 | Bacteria | 3273 |
| 124 | Ga0207705_10644415 | 3300025909 | Bacteria | 824 |
| 125 | Ga0207707_10015036 | 3300025912 | Bacteria | 6738 |
| 126 | Ga0207695_10013984 | 3300025913 | Bacteria | 9533 |
| 127 | Ga0207660_10092767 | 3300025917 | Bacteria | 2242 |
| 128 | Ga0207660_10179970 | 3300025917 | Bacteria | 1641 |
| 129 | Ga0207657_10000196 | 3300025919 | Bacteria | 62836 |
| 130 | Ga0207649_10159459 | 3300025920 | Bacteria | 1562 |
| 131 | Ga0207649_10167180 | 3300025920 | Bacteria | 1529 |
| 132 | Ga0207649_10507694 | 3300025920 | Bacteria | 918 |
| 133 | Ga0207652_10064842 | 3300025921 | Bacteria | 3161 |
| 134 | Ga0207652_10612426 | 3300025921 | Bacteria | 976 |
| 135 | Ga0207652_10690422 | 3300025921 | Bacteria | 911 |
| 136 | Ga0207646_11040689 | 3300025922 | Bacteria | 722 |
| 137 | Ga0207681_10000500 | 3300025923 | Bacteria | 27290 |
| 138 | Ga0207681_10001644 | 3300025923 | Bacteria | 14403 |
| 139 | Ga0207650_10269127 | 3300025925 | Bacteria | 1384 |
| 140 | Ga0207659_10213825 | 3300025926 | Bacteria | 1547 |
| 141 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 142 | Ga0207644_10001364 | 3300025931 | Bacteria | 15709 |
| 143 | Ga0207644_10039760 | 3300025931 | Bacteria | 3321 |
| 144 | Ga0207690_10004941 | 3300025932 | Bacteria | 7870 |
| 145 | Ga0207690_10100116 | 3300025932 | Bacteria | 2068 |
| 146 | Ga0207690_10112122 | 3300025932 | Bacteria | 1966 |
| 147 | Ga0207690_10896651 | 3300025932 | Bacteria | 735 |
| 148 | Ga0207706_10024604 | 3300025933 | Bacteria | 5398 |
| 149 | Ga0207706_10030891 | 3300025933 | Bacteria | 4776 |
| 150 | Ga0207706_10039096 | 3300025933 | Bacteria | 4206 |
| 151 | Ga0207711_10015204 | 3300025941 | Bacteria | 6391 |
| 152 | Ga0207661_10489589 | 3300025944 | Bacteria | 1123 |
| 153 | Ga0207679_10011625 | 3300025945 | Bacteria | 5713 |
| 154 | Ga0207679_10095781 | 3300025945 | Bacteria | 2308 |
| 155 | Ga0207667_10083462 | 3300025949 | Bacteria | 3308 |
| 156 | Ga0207667_10103269 | 3300025949 | Bacteria | 2940 |
| 157 | Ga0207667_10206347 | 3300025949 | Bacteria | 2015 |
| 158 | Ga0207712_10461994 | 3300025961 | Bacteria | 1078 |
| 159 | Ga0207668_10015599 | 3300025972 | Bacteria | 4723 |
| 160 | Ga0207668_10357385 | 3300025972 | Bacteria | 1223 |
| 161 | Ga0207640_10002547 | 3300025981 | Bacteria | 9773 |
| 162 | Ga0207640_10388300 | 3300025981 | Bacteria | 1133 |
| 163 | Ga0207640_10457564 | 3300025981 | Bacteria | 1053 |
| 164 | Ga0207658_10004667 | 3300025986 | Bacteria | 9497 |
| 165 | Ga0207658_10347471 | 3300025986 | Bacteria | 1291 |
| 166 | Ga0207703_10003420 | 3300026035 | Bacteria | 13327 |
| 167 | Ga0207703_10074471 | 3300026035 | Bacteria | 2812 |
| 168 | Ga0207703_10089848 | 3300026035 | Bacteria | 2580 |
| 169 | Ga0207639_10021040 | 3300026041 | Bacteria | 4679 |
| 170 | Ga0207639_10571922 | 3300026041 | Bacteria | 1039 |
| 171 | Ga0207639_11534905 | 3300026041 | Bacteria | 625 |
| 172 | Ga0207678_10103313 | 3300026067 | Bacteria | 2433 |
| 173 | Ga0207702_10057923 | 3300026078 | Bacteria | 3295 |
| 174 | Ga0207641_10036992 | 3300026088 | Bacteria | 4075 |
| 175 | Ga0207676_10032014 | 3300026095 | Bacteria | 3959 |
| 176 | Ga0207676_10272241 | 3300026095 | Bacteria | 1534 |
| 177 | Ga0207674_10015328 | 3300026116 | Bacteria | 8424 |
| 178 | Ga0207674_10061600 | 3300026116 | Bacteria | 3791 |
| 179 | Ga0207683_10134273 | 3300026121 | Bacteria | 2227 |
| 180 | Ga0207698_10000499 | 3300026142 | Bacteria | 22908 |
| 181 | Ga0207698_10316849 | 3300026142 | Bacteria | 1459 |
| 182 | Ga0207698_10478829 | 3300026142 | Bacteria | 1207 |
| 183 | Ga0207698_11152265 | 3300026142 | Bacteria | 789 |
| 184 | Ga0209983_1007430 | 3300027665 | Bacteria | 2246 |
| 185 | Ga0209974_10004671 | 3300027876 | Bacteria | 4869 |
| 186 | Ga0209974_10045456 | 3300027876 | Bacteria | 1466 |
| 187 | Ga0268266_10000317 | 3300028379 | Bacteria | 76446 |
| 188 | Ga0268266_10116288 | 3300028379 | Bacteria | 2375 |
| 189 | Ga0268265_10941159 | 3300028380 | Bacteria | 850 |
| 190 | Ga0268265_11126072 | 3300028380 | Bacteria | 780 |
| 191 | Ga0268264_10013923 | 3300028381 | Bacteria | 6610 |
| 192 | Ga0268264_10026359 | 3300028381 | Bacteria | 4748 |
| 193 | Ga0268264_10030588 | 3300028381 | Bacteria | 4413 |
| 194 | Ga0316579_10031615 | 3300031691 | Bacteria | 2424 |
| 195 | Ga0316576_10328526 | 3300031727 | Bacteria | 1140 |
| 196 | Ga0307405_10019285 | 3300031731 | Bacteria | 3784 |
| 197 | Ga0307405_10499307 | 3300031731 | Bacteria | 975 |
| 198 | Ga0307413_10299807 | 3300031824 | Bacteria | 1218 |
| 199 | Ga0307413_11646123 | 3300031824 | Bacteria | 571 |
| 200 | Ga0307412_10093920 | 3300031911 | Bacteria | 2105 |
| 201 | Ga0307412_10303347 | 3300031911 | Bacteria | 1263 |
| 202 | Ga0307409_100397743 | 3300031995 | Bacteria | 1315 |
| 203 | Ga0307416_100600817 | 3300032002 | Bacteria | 1180 |
| 204 | Ga0307414_10164622 | 3300032004 | Bacteria | 1766 |
| 205 | Ga0307414_10581217 | 3300032004 | Bacteria | 1002 |
| 206 | Ga0307414_10607521 | 3300032004 | Bacteria | 981 |
| 207 | Ga0307411_10327209 | 3300032005 | Bacteria | 1240 |
| 208 | Ga0307411_10952638 | 3300032005 | Bacteria | 766 |
| 209 | Ga0316583_10002928 | 3300032133 | Bacteria | 5998 |
| 210 | Ga0316582_0003592 | 3300036647 | Bacteria | 7642 |
| 211 | Ga0316584_0103861 | 3300036712 | Bacteria | 2127 |
| 212 | Ga0451847_0782764 | 3300041503 | Bacteria | 705 |
| 213 | Ga0451853_0449570 | 3300041512 | Bacteria | 841 |
| 214 | Ga0451853_1059436 | 3300041512 | Bacteria | 1282 |
| 215 | Ga0439431_0236944 | 3300041997 | Bacteria | 539 |
| 216 | Ga0450893_0008300 | 3300042532 | Bacteria | 1690 |
| 217 | Ga0466970_0232523 | 3300044765 | Bacteria | 1030 |
| 218 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 219 | Ga0495638_0334220 | 3300046460 | Bacteria | 805 |
| 220 | Ga0495625_0307454 | 3300046660 | Bacteria | 1013 |
| 221 | Ga0495670_0508409 | 3300046691 | Bacteria | 654 |
| 222 | Ga0496100_0301388 | 3300048903 | Bacteria | 1199 |
| 223 | Ga0496101_0033994 | 3300048904 | Bacteria | 3599 |
| 224 | Ga0496102_0250451 | 3300048905 | Bacteria | 1670 |
| 225 | Ga0496102_0322792 | 3300048905 | Bacteria | 1454 |
| 226 | Ga0496103_0017886 | 3300048906 | Bacteria | 4247 |
| 227 | Ga0496103_0200178 | 3300048906 | Bacteria | 1284 |
| 228 | Ga0496104_0183278 | 3300048907 | Bacteria | 2004 |
| 229 | Ga0496105_0031184 | 3300048908 | Bacteria | 4369 |
| 230 | Ga0496105_0443475 | 3300048908 | Bacteria | 1025 |
| 231 | Ga0496106_0000284 | 3300048909 | Bacteria | 35805 |
| 232 | Ga0496108_0819839 | 3300048911 | Bacteria | 802 |
| 233 | Ga0496109_0243726 | 3300048912 | Bacteria | 1692 |
| 234 | Ga0496110_0083876 | 3300048913 | Bacteria | 2843 |
| 235 | Ga0496111_0045724 | 3300048914 | Bacteria | 3150 |
| 236 | Ga0496111_0538902 | 3300048914 | Bacteria | 857 |
| 237 | Ga0496112_0576861 | 3300048915 | Bacteria | 1057 |
| 238 | Ga0496113_0092750 | 3300048916 | Bacteria | 2330 |
| 239 | Ga0496116_0012976 | 3300048919 | Bacteria | 6758 |
| 240 | Ga0496117_0066436 | 3300048920 | Bacteria | 2446 |
| 241 | Ga0496118_0047378 | 3300048921 | Bacteria | 3331 |
| 242 | Ga0496119_0058322 | 3300048922 | Bacteria | 2327 |
| 243 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 244 | Ga0496121_0031741 | 3300048924 | Bacteria | 4818 |
| 245 | Ga0496122_0132803 | 3300048925 | Bacteria | 1577 |
| 246 | Ga0496123_0048686 | 3300048926 | Bacteria | 2849 |
| 247 | Ga0496124_0215782 | 3300048927 | Bacteria | 1447 |
| 248 | Ga0496125_0041647 | 3300048928 | Bacteria | 3923 |
| 249 | Ga0496126_0003013 | 3300048929 | Bacteria | 21851 |
| 250 | Ga0496126_0008820 | 3300048929 | Bacteria | 10813 |
| 251 | Ga0496126_0446609 | 3300048929 | Bacteria | 1041 |
| 252 | Ga0501034_0490559 | 3300049571 | Bacteria | 1143 |
| 253 | Ga0501043_0254562 | 3300049579 | Bacteria | 1352 |
| 254 | Ga0501047_0485419 | 3300049581 | Bacteria | 1063 |
| 255 | Ga0501249_052614 | 3300049679 | Bacteria | 936 |
| 256 | Ga0501268_037646 | 3300049765 | Bacteria | 900 |
| 257 | Ga0501044_0001291 | 3300049823 | Bacteria | 29606 |
| 258 | Ga0501044_0104537 | 3300049823 | Bacteria | 2846 |
| 259 | Ga0501044_0480751 | 3300049823 | Bacteria | 1145 |
| 260 | nmdc:mga03683_139_c1 | 3300050489 | Bacteria | 24530 |
| 261 | nmdc:mga03683_7233_c1 | 3300050489 | Bacteria | 3845 |
| 262 | nmdc:mga03n38_367_c1 | 3300050490 | Bacteria | 11073 |
| 263 | nmdc:mga00v17_1024_c1 | 3300050491 | Bacteria | 14913 |
| 264 | nmdc:mga0k408_20763_c1 | 3300050493 | Bacteria | 3684 |
| 265 | nmdc:mga0k408_21447_c1 | 3300050493 | Bacteria | 2950 |
| 266 | nmdc:mga0k408_45_c1 | 3300050493 | Bacteria | 63055 |
| 267 | nmdc:mga07m45_39_c1 | 3300050496 | Bacteria | 63381 |
| 268 | nmdc:mga07m45_53336_c1 | 3300050496 | Bacteria | 2284 |
| 269 | nmdc:mga07m45_563552_c1 | 3300050496 | Bacteria | 658 |
| 270 | nmdc:mga07m45_84387_c1 | 3300050496 | Bacteria | 1816 |
| 271 | nmdc:mga08y16_613782_c1 | 3300050511 | Bacteria | 1095 |
| 272 | nmdc:mga0sz30_127279_c1 | 3300050516 | Bacteria | 1121 |
| 273 | nmdc:mga0sz30_1903_c1 | 3300050516 | Bacteria | 7450 |
| 274 | nmdc:mga0sz30_9867_c2 | 3300050516 | Bacteria | 1862 |
| 275 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 276 | Ga0500643_022000 | 3300053087 | Bacteria | 2060 |
| 277 | Ga0500595_027915 | 3300053119 | Bacteria | 1928 |
| 278 | Ga0500607_002571 | 3300053121 | Bacteria | 14459 |
| 279 | Ga0500564_221918 | 3300053138 | Bacteria | 764 |
| 280 | Ga0500590_022976 | 3300053148 | Bacteria | 3240 |
| 281 | Ga0500616_0009289 | 3300053153 | Bacteria | 5991 |
| 282 | Ga0500622_0001392 | 3300053156 | Bacteria | 19476 |
| 283 | Ga0500645_008444 | 3300053730 | Bacteria | 3518 |
| 284 | Ga0500645_089585 | 3300053730 | Bacteria | 873 |
| 285 | Ga0500596_015312 | 3300053735 | Bacteria | 1152 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041997 | Ga0439431_0236944 | Ga0439431_0236944_39_509 | 156 |
| 2 | 3300009545 | Ga0105237_10308832 | Ga0105237_103088322 | 160 |
| 3 | 3300041503 | Ga0451847_0782764 | Ga0451847_0782764_143_655 | 165 |
| 4 | iso_pu_bacteria | 2643221588 | 2643949371 | 166 |
| 5 | iso_pu_bacteria | 2739367664 | 2739651631 | 166 |
| 6 | iso_pu_bacteria | 2739367865 | 2740030104 | 166 |
| 7 | iso_pu_bacteria | 2882806704 | 2882807889 | 166 |
| 8 | iso_pu_bacteria | 2896253425 | 2896255314 | 166 |
| 9 | 3300049581 | Ga0501047_0485419 | Ga0501047_0485419_95_607 | 167 |
| 10 | iso_pu_bacteria | 2896184354 | 2896184764 | 167 |
| 11 | iso_pu_bacteria | 3000865235 | 3000865958 | 167 |
| 12 | 3300048924 | Ga0496121_0000031 | Ga0496121_0000031_376694_377200 | 168 |
| 13 | 3300049823 | Ga0501044_0001291 | Ga0501044_0001291_26733_27239 | 168 |
| 14 | 3300006195 | Ga0075366_10006378 | Ga0075366_100063785 | 169 |
| 15 | 3300013102 | Ga0157371_10055953 | Ga0157371_100559532 | 169 |
| 16 | 3300013105 | Ga0157369_10299874 | Ga0157369_102998742 | 169 |
| 17 | 3300032004 | Ga0307414_10581217 | Ga0307414_105812172 | 169 |
| 18 | 3300042532 | Ga0450893_0008300 | Ga0450893_0008300_272_781 | 169 |
| 19 | 3300044765 | Ga0466970_0232523 | Ga0466970_0232523_284_793 | 169 |
| 20 | 3300005289 | Ga0065704_10243139 | Ga0065704_102431391 | 170 |
| 21 | 3300005295 | Ga0065707_10091593 | Ga0065707_100915934 | 170 |
| 22 | 3300005295 | Ga0065707_10413958 | Ga0065707_104139581 | 170 |
| 23 | 3300005327 | Ga0070658_10000273 | Ga0070658_1000027311 | 170 |
| 24 | 3300005336 | Ga0070680_100008923 | Ga0070680_1000089234 | 170 |
| 25 | 3300005336 | Ga0070680_100326050 | Ga0070680_1003260502 | 170 |
| 26 | 3300005337 | Ga0070682_100348568 | Ga0070682_1003485682 | 170 |
| 27 | 3300005339 | Ga0070660_100057790 | Ga0070660_1000577903 | 170 |
| 28 | 3300005344 | Ga0070661_100020377 | Ga0070661_1000203774 | 170 |
| 29 | 3300005354 | Ga0070675_100178472 | Ga0070675_1001784722 | 170 |
| 30 | 3300005355 | Ga0070671_100017767 | Ga0070671_1000177672 | 170 |
| 31 | 3300005366 | Ga0070659_100088634 | Ga0070659_1000886343 | 170 |
| 32 | 3300005366 | Ga0070659_100628081 | Ga0070659_1006280812 | 170 |
| 33 | 3300005455 | Ga0070663_100067231 | Ga0070663_1000672313 | 170 |
| 34 | 3300005456 | Ga0070678_100100011 | Ga0070678_1001000113 | 170 |
| 35 | 3300005457 | Ga0070662_100011517 | Ga0070662_1000115173 | 170 |
| 36 | 3300005457 | Ga0070662_100015843 | Ga0070662_1000158434 | 170 |
| 37 | 3300005458 | Ga0070681_10021252 | Ga0070681_100212524 | 170 |
| 38 | 3300005530 | Ga0070679_100698506 | Ga0070679_1006985061 | 170 |
| 39 | 3300005535 | Ga0070684_100222086 | Ga0070684_1002220862 | 170 |
| 40 | 3300005539 | Ga0068853_100357864 | Ga0068853_1003578642 | 170 |
| 41 | 3300005563 | Ga0068855_100027987 | Ga0068855_1000279876 | 170 |
| 42 | 3300005563 | Ga0068855_100041134 | Ga0068855_1000411343 | 170 |
| 43 | 3300005563 | Ga0068855_100252027 | Ga0068855_1002520272 | 170 |
| 44 | 3300005564 | Ga0070664_100649385 | Ga0070664_1006493852 | 170 |
| 45 | 3300005564 | Ga0070664_100847135 | Ga0070664_1008471351 | 170 |
| 46 | 3300005577 | Ga0068857_100064487 | Ga0068857_1000644872 | 170 |
| 47 | 3300005577 | Ga0068857_100411592 | Ga0068857_1004115922 | 170 |
| 48 | 3300005577 | Ga0068857_100737201 | Ga0068857_1007372012 | 170 |
| 49 | 3300005578 | Ga0068854_100210354 | Ga0068854_1002103542 | 170 |
| 50 | 3300005614 | Ga0068856_100123981 | Ga0068856_1001239813 | 170 |
| 51 | 3300005614 | Ga0068856_100164450 | Ga0068856_1001644504 | 170 |
| 52 | 3300005614 | Ga0068856_100476591 | Ga0068856_1004765912 | 170 |
| 53 | 3300005616 | Ga0068852_100001653 | Ga0068852_1000016537 | 170 |
| 54 | 3300005616 | Ga0068852_100385338 | Ga0068852_1003853381 | 170 |
| 55 | 3300005616 | Ga0068852_100425703 | Ga0068852_1004257032 | 170 |
| 56 | 3300005616 | Ga0068852_100484964 | Ga0068852_1004849642 | 170 |
| 57 | 3300005617 | Ga0068859_100078539 | Ga0068859_1000785392 | 170 |
| 58 | 3300005834 | Ga0068851_10142393 | Ga0068851_101423932 | 170 |
| 59 | 3300005842 | Ga0068858_100028923 | Ga0068858_1000289236 | 170 |
| 60 | 3300006058 | Ga0075432_10001164 | Ga0075432_100011644 | 170 |
| 61 | 3300006177 | Ga0075362_10037820 | Ga0075362_100378202 | 170 |
| 62 | 3300006186 | Ga0075369_10143823 | Ga0075369_101438232 | 170 |
| 63 | 3300006353 | Ga0075370_10272081 | Ga0075370_102720812 | 170 |
| 64 | 3300006358 | Ga0068871_100677511 | Ga0068871_1006775112 | 170 |
| 65 | 3300006931 | Ga0097620_100078541 | Ga0097620_1000785412 | 170 |
| 66 | 3300009093 | Ga0105240_10075934 | Ga0105240_100759342 | 170 |
| 67 | 3300009174 | Ga0105241_10141319 | Ga0105241_101413193 | 170 |
| 68 | 3300009177 | Ga0105248_10926487 | Ga0105248_109264872 | 170 |
| 69 | 3300010375 | Ga0105239_10114617 | Ga0105239_101146174 | 170 |
| 70 | 3300011119 | Ga0105246_10000073 | Ga0105246_1000007327 | 170 |
| 71 | 3300013100 | Ga0157373_10018180 | Ga0157373_100181802 | 170 |
| 72 | 3300013100 | Ga0157373_10035119 | Ga0157373_100351193 | 170 |
| 73 | 3300013102 | Ga0157371_10008199 | Ga0157371_100081994 | 170 |
| 74 | 3300013105 | Ga0157369_10039530 | Ga0157369_100395304 | 170 |
| 75 | 3300013307 | Ga0157372_10051535 | Ga0157372_100515354 | 170 |
| 76 | 3300013307 | Ga0157372_11036992 | Ga0157372_110369922 | 170 |
| 77 | 3300014326 | Ga0157380_10583137 | Ga0157380_105831372 | 170 |
| 78 | 3300025315 | Ga0207697_10078314 | Ga0207697_100783142 | 170 |
| 79 | 3300025321 | Ga0207656_10254394 | Ga0207656_102543941 | 170 |
| 80 | 3300025904 | Ga0207647_10013448 | Ga0207647_100134485 | 170 |
| 81 | 3300025904 | Ga0207647_10223154 | Ga0207647_102231542 | 170 |
| 82 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004454 | 170 |
| 83 | 3300025909 | Ga0207705_10000787 | Ga0207705_100007879 | 170 |
| 84 | 3300025909 | Ga0207705_10042265 | Ga0207705_100422654 | 170 |
| 85 | 3300025912 | Ga0207707_10015036 | Ga0207707_100150365 | 170 |
| 86 | 3300025913 | Ga0207695_10013984 | Ga0207695_100139848 | 170 |
| 87 | 3300025917 | Ga0207660_10092767 | Ga0207660_100927672 | 170 |
| 88 | 3300025917 | Ga0207660_10179970 | Ga0207660_101799702 | 170 |
| 89 | 3300025919 | Ga0207657_10000196 | Ga0207657_1000019635 | 170 |
| 90 | 3300025920 | Ga0207649_10159459 | Ga0207649_101594592 | 170 |
| 91 | 3300025920 | Ga0207649_10507694 | Ga0207649_105076941 | 170 |
| 92 | 3300025921 | Ga0207652_10064842 | Ga0207652_100648422 | 170 |
| 93 | 3300025921 | Ga0207652_10612426 | Ga0207652_106124262 | 170 |
| 94 | 3300025926 | Ga0207659_10213825 | Ga0207659_102138253 | 170 |
| 95 | 3300025931 | Ga0207644_10039760 | Ga0207644_100397602 | 170 |
| 96 | 3300025932 | Ga0207690_10004941 | Ga0207690_100049417 | 170 |
| 97 | 3300025932 | Ga0207690_10896651 | Ga0207690_108966511 | 170 |
| 98 | 3300025933 | Ga0207706_10024604 | Ga0207706_100246045 | 170 |
| 99 | 3300025933 | Ga0207706_10030891 | Ga0207706_100308914 | 170 |
| 100 | 3300025944 | Ga0207661_10489589 | Ga0207661_104895892 | 170 |
| 101 | 3300025945 | Ga0207679_10011625 | Ga0207679_100116254 | 170 |
| 102 | 3300025949 | Ga0207667_10083462 | Ga0207667_100834623 | 170 |
| 103 | 3300025949 | Ga0207667_10103269 | Ga0207667_101032694 | 170 |
| 104 | 3300025949 | Ga0207667_10206347 | Ga0207667_102063472 | 170 |
| 105 | 3300025981 | Ga0207640_10002547 | Ga0207640_100025474 | 170 |
| 106 | 3300025981 | Ga0207640_10457564 | Ga0207640_104575642 | 170 |
| 107 | 3300025986 | Ga0207658_10347471 | Ga0207658_103474712 | 170 |
| 108 | 3300026035 | Ga0207703_10003420 | Ga0207703_100034206 | 170 |
| 109 | 3300026041 | Ga0207639_10021040 | Ga0207639_100210403 | 170 |
| 110 | 3300026041 | Ga0207639_10571922 | Ga0207639_105719222 | 170 |
| 111 | 3300026041 | Ga0207639_11534905 | Ga0207639_115349051 | 170 |
| 112 | 3300026067 | Ga0207678_10103313 | Ga0207678_101033133 | 170 |
| 113 | 3300026078 | Ga0207702_10057923 | Ga0207702_100579233 | 170 |
| 114 | 3300026095 | Ga0207676_10272241 | Ga0207676_102722412 | 170 |
| 115 | 3300026116 | Ga0207674_10015328 | Ga0207674_100153286 | 170 |
| 116 | 3300026116 | Ga0207674_10061600 | Ga0207674_100616002 | 170 |
| 117 | 3300026121 | Ga0207683_10134273 | Ga0207683_101342733 | 170 |
| 118 | 3300026142 | Ga0207698_10000499 | Ga0207698_100004995 | 170 |
| 119 | 3300026142 | Ga0207698_10316849 | Ga0207698_103168492 | 170 |
| 120 | 3300026142 | Ga0207698_10478829 | Ga0207698_104788292 | 170 |
| 121 | 3300026142 | Ga0207698_11152265 | Ga0207698_111522652 | 170 |
| 122 | 3300027665 | Ga0209983_1007430 | Ga0209983_10074303 | 170 |
| 123 | 3300027876 | Ga0209974_10004671 | Ga0209974_100046713 | 170 |
| 124 | 3300027876 | Ga0209974_10045456 | Ga0209974_100454562 | 170 |
| 125 | 3300028381 | Ga0268264_10013923 | Ga0268264_100139237 | 170 |
| 126 | 3300031691 | Ga0316579_10031615 | Ga0316579_100316153 | 170 |
| 127 | 3300031727 | Ga0316576_10328526 | Ga0316576_103285262 | 170 |
| 128 | 3300031731 | Ga0307405_10499307 | Ga0307405_104993072 | 170 |
| 129 | 3300031824 | Ga0307413_10299807 | Ga0307413_102998072 | 170 |
| 130 | 3300031824 | Ga0307413_11646123 | Ga0307413_116461231 | 170 |
| 131 | 3300031911 | Ga0307412_10303347 | Ga0307412_103033472 | 170 |
| 132 | 3300031995 | Ga0307409_100397743 | Ga0307409_1003977432 | 170 |
| 133 | 3300032002 | Ga0307416_100600817 | Ga0307416_1006008171 | 170 |
| 134 | 3300032004 | Ga0307414_10607521 | Ga0307414_106075212 | 170 |
| 135 | 3300032005 | Ga0307411_10327209 | Ga0307411_103272092 | 170 |
| 136 | 3300032005 | Ga0307411_10952638 | Ga0307411_109526382 | 170 |
| 137 | 3300032133 | Ga0316583_10002928 | Ga0316583_100029287 | 170 |
| 138 | 3300036647 | Ga0316582_0003592 | Ga0316582_0003592_5556_6068 | 170 |
| 139 | 3300036712 | Ga0316584_0103861 | Ga0316584_0103861_532_1044 | 170 |
| 140 | 3300041512 | Ga0451853_1059436 | Ga0451853_1059436_240_761 | 170 |
| 141 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_139981_140493 | 170 |
| 142 | 3300048905 | Ga0496102_0250451 | Ga0496102_0250451_895_1407 | 170 |
| 143 | 3300048908 | Ga0496105_0443475 | Ga0496105_0443475_459_971 | 170 |
| 144 | 3300048911 | Ga0496108_0819839 | Ga0496108_0819839_91_603 | 170 |
| 145 | 3300048912 | Ga0496109_0243726 | Ga0496109_0243726_1028_1540 | 170 |
| 146 | 3300048913 | Ga0496110_0083876 | Ga0496110_0083876_2241_2753 | 170 |
| 147 | 3300048914 | Ga0496111_0538902 | Ga0496111_0538902_26_538 | 170 |
| 148 | 3300048916 | Ga0496113_0092750 | Ga0496113_0092750_89_601 | 170 |
| 149 | 3300048929 | Ga0496126_0003013 | Ga0496126_0003013_3526_4038 | 170 |
| 150 | 3300049579 | Ga0501043_0254562 | Ga0501043_0254562_702_1214 | 170 |
| 151 | 3300049679 | Ga0501249_052614 | Ga0501249_052614_154_675 | 170 |
| 152 | 3300049765 | Ga0501268_037646 | Ga0501268_037646_306_827 | 170 |
| 153 | 3300049823 | Ga0501044_0480751 | Ga0501044_0480751_417_929 | 170 |
| 154 | 3300050496 | nmdc:mga07m45_563552_c1 | nmdc:mga07m45_563552_c1_77_589 | 170 |
| 155 | 3300050496 | nmdc:mga07m45_84387_c1 | nmdc:mga07m45_84387_c1_941_1453 | 170 |
| 156 | 3300050516 | nmdc:mga0sz30_127279_c1 | nmdc:mga0sz30_127279_c1_439_951 | 170 |
| 157 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1309200_1309712 | 170 |
| 158 | 3300053153 | Ga0500616_0009289 | Ga0500616_0009289_1516_2028 | 170 |
| 159 | 3300050493 | nmdc:mga0k408_21447_c1 | nmdc:mga0k408_21447_c1_806_1330 | 171 |
| 160 | 2162886007 | SwRhRL2b_contig_254253 | SwRhRL2b_0612.00002790 | 172 |
| 161 | 3300005289 | Ga0065704_10070209 | Ga0065704_1007020966 | 172 |
| 162 | 3300005289 | Ga0065704_10077526 | Ga0065704_100775266 | 172 |
| 163 | 3300005331 | Ga0070670_100062503 | Ga0070670_1000625034 | 172 |
| 164 | 3300005340 | Ga0070689_100985243 | Ga0070689_1009852432 | 172 |
| 165 | 3300005344 | Ga0070661_100082992 | Ga0070661_1000829924 | 172 |
| 166 | 3300005347 | Ga0070668_100002216 | Ga0070668_1000022164 | 172 |
| 167 | 3300005353 | Ga0070669_100001004 | Ga0070669_10000100411 | 172 |
| 168 | 3300005353 | Ga0070669_100001577 | Ga0070669_1000015777 | 172 |
| 169 | 3300005355 | Ga0070671_100000054 | Ga0070671_10000005459 | 172 |
| 170 | 3300005355 | Ga0070671_100010621 | Ga0070671_1000106217 | 172 |
| 171 | 3300005366 | Ga0070659_100018672 | Ga0070659_1000186725 | 172 |
| 172 | 3300005366 | Ga0070659_100212185 | Ga0070659_1002121852 | 172 |
| 173 | 3300005367 | Ga0070667_100022444 | Ga0070667_1000224446 | 172 |
| 174 | 3300005455 | Ga0070663_100641896 | Ga0070663_1006418962 | 172 |
| 175 | 3300005457 | Ga0070662_100049757 | Ga0070662_1000497572 | 172 |
| 176 | 3300005468 | Ga0070707_100571234 | Ga0070707_1005712341 | 172 |
| 177 | 3300005548 | Ga0070665_100000076 | Ga0070665_100000076155 | 172 |
| 178 | 3300005548 | Ga0070665_100234899 | Ga0070665_1002348993 | 172 |
| 179 | 3300005564 | Ga0070664_100136921 | Ga0070664_1001369211 | 172 |
| 180 | 3300005617 | Ga0068859_100063061 | Ga0068859_1000630615 | 172 |
| 181 | 3300005618 | Ga0068864_100103565 | Ga0068864_1001035652 | 172 |
| 182 | 3300005841 | Ga0068863_100004965 | Ga0068863_10000496515 | 172 |
| 183 | 3300005841 | Ga0068863_100066644 | Ga0068863_1000666443 | 172 |
| 184 | 3300005842 | Ga0068858_100023611 | Ga0068858_1000236114 | 172 |
| 185 | 3300005842 | Ga0068858_100124456 | Ga0068858_1001244563 | 172 |
| 186 | 3300005843 | Ga0068860_100024976 | Ga0068860_1000249764 | 172 |
| 187 | 3300005843 | Ga0068860_100036007 | Ga0068860_1000360075 | 172 |
| 188 | 3300005844 | Ga0068862_100074055 | Ga0068862_1000740552 | 172 |
| 189 | 3300006048 | Ga0075363_100000344 | Ga0075363_1000003445 | 172 |
| 190 | 3300006051 | Ga0075364_10011689 | Ga0075364_100116893 | 172 |
| 191 | 3300006177 | Ga0075362_10000021 | Ga0075362_1000002156 | 172 |
| 192 | 3300006177 | Ga0075362_10097502 | Ga0075362_100975022 | 172 |
| 193 | 3300006186 | Ga0075369_10000873 | Ga0075369_100008734 | 172 |
| 194 | 3300006195 | Ga0075366_10000599 | Ga0075366_1000059913 | 172 |
| 195 | 3300006195 | Ga0075366_10027873 | Ga0075366_100278733 | 172 |
| 196 | 3300006195 | Ga0075366_10276567 | Ga0075366_102765672 | 172 |
| 197 | 3300006353 | Ga0075370_10000068 | Ga0075370_1000006815 | 172 |
| 198 | 3300006353 | Ga0075370_10051857 | Ga0075370_100518572 | 172 |
| 199 | 3300006353 | Ga0075370_10126821 | Ga0075370_101268212 | 172 |
| 200 | 3300006353 | Ga0075370_10252154 | Ga0075370_102521541 | 172 |
| 201 | 3300006931 | Ga0097620_100063057 | Ga0097620_1000630572 | 172 |
| 202 | 3300006946 | Ga0079104_1039393 | Ga0079104_10393932 | 172 |
| 203 | 3300009011 | Ga0105251_10002096 | Ga0105251_100020968 | 172 |
| 204 | 3300009094 | Ga0111539_10652172 | Ga0111539_106521721 | 172 |
| 205 | 3300009177 | Ga0105248_10006630 | Ga0105248_100066308 | 172 |
| 206 | 3300009177 | Ga0105248_10459984 | Ga0105248_104599842 | 172 |
| 207 | 3300009553 | Ga0105249_10254514 | Ga0105249_102545142 | 172 |
| 208 | 3300013306 | Ga0163162_10058766 | Ga0163162_100587662 | 172 |
| 209 | 3300013307 | Ga0157372_11197425 | Ga0157372_111974252 | 172 |
| 210 | 3300025315 | Ga0207697_10022440 | Ga0207697_100224402 | 172 |
| 211 | 3300025735 | Ga0207713_1003711 | Ga0207713_10037118 | 172 |
| 212 | 3300025903 | Ga0207680_10052490 | Ga0207680_100524902 | 172 |
| 213 | 3300025907 | Ga0207645_10082244 | Ga0207645_100822441 | 172 |
| 214 | 3300025909 | Ga0207705_10644415 | Ga0207705_106444152 | 172 |
| 215 | 3300025920 | Ga0207649_10167180 | Ga0207649_101671802 | 172 |
| 216 | 3300025921 | Ga0207652_10690422 | Ga0207652_106904221 | 172 |
| 217 | 3300025922 | Ga0207646_11040689 | Ga0207646_110406891 | 172 |
| 218 | 3300025923 | Ga0207681_10000500 | Ga0207681_1000050024 | 172 |
| 219 | 3300025923 | Ga0207681_10001644 | Ga0207681_1000164411 | 172 |
| 220 | 3300025925 | Ga0207650_10269127 | Ga0207650_102691272 | 172 |
| 221 | 3300025931 | Ga0207644_10000003 | Ga0207644_10000003422 | 172 |
| 222 | 3300025931 | Ga0207644_10001364 | Ga0207644_100013644 | 172 |
| 223 | 3300025932 | Ga0207690_10100116 | Ga0207690_101001162 | 172 |
| 224 | 3300025932 | Ga0207690_10112122 | Ga0207690_101121222 | 172 |
| 225 | 3300025933 | Ga0207706_10039096 | Ga0207706_100390962 | 172 |
| 226 | 3300025941 | Ga0207711_10015204 | Ga0207711_100152042 | 172 |
| 227 | 3300025945 | Ga0207679_10095781 | Ga0207679_100957814 | 172 |
| 228 | 3300025961 | Ga0207712_10461994 | Ga0207712_104619942 | 172 |
| 229 | 3300025972 | Ga0207668_10015599 | Ga0207668_100155997 | 172 |
| 230 | 3300025972 | Ga0207668_10357385 | Ga0207668_103573852 | 172 |
| 231 | 3300025981 | Ga0207640_10388300 | Ga0207640_103883002 | 172 |
| 232 | 3300025986 | Ga0207658_10004667 | Ga0207658_100046676 | 172 |
| 233 | 3300026035 | Ga0207703_10074471 | Ga0207703_100744712 | 172 |
| 234 | 3300026035 | Ga0207703_10089848 | Ga0207703_100898482 | 172 |
| 235 | 3300026088 | Ga0207641_10036992 | Ga0207641_100369924 | 172 |
| 236 | 3300026095 | Ga0207676_10032014 | Ga0207676_100320144 | 172 |
| 237 | 3300028379 | Ga0268266_10000317 | Ga0268266_1000031771 | 172 |
| 238 | 3300028379 | Ga0268266_10116288 | Ga0268266_101162882 | 172 |
| 239 | 3300028380 | Ga0268265_10941159 | Ga0268265_109411591 | 172 |
| 240 | 3300028380 | Ga0268265_11126072 | Ga0268265_111260722 | 172 |
| 241 | 3300028381 | Ga0268264_10026359 | Ga0268264_100263593 | 172 |
| 242 | 3300028381 | Ga0268264_10030588 | Ga0268264_100305882 | 172 |
| 243 | 3300031731 | Ga0307405_10019285 | Ga0307405_100192852 | 172 |
| 244 | 3300031911 | Ga0307412_10093920 | Ga0307412_100939202 | 172 |
| 245 | 3300032004 | Ga0307414_10164622 | Ga0307414_101646223 | 172 |
| 246 | 3300041512 | Ga0451853_0449570 | Ga0451853_0449570_116_640 | 172 |
| 247 | 3300046460 | Ga0495638_0334220 | Ga0495638_0334220_153_671 | 172 |
| 248 | 3300046660 | Ga0495625_0307454 | Ga0495625_0307454_130_648 | 172 |
| 249 | 3300046691 | Ga0495670_0508409 | Ga0495670_0508409_115_633 | 172 |
| 250 | 3300048903 | Ga0496100_0301388 | Ga0496100_0301388_458_985 | 172 |
| 251 | 3300048904 | Ga0496101_0033994 | Ga0496101_0033994_2187_2714 | 172 |
| 252 | 3300048905 | Ga0496102_0322792 | Ga0496102_0322792_661_1188 | 172 |
| 253 | 3300048906 | Ga0496103_0017886 | Ga0496103_0017886_81_599 | 172 |
| 254 | 3300048906 | Ga0496103_0200178 | Ga0496103_0200178_661_1188 | 172 |
| 255 | 3300048907 | Ga0496104_0183278 | Ga0496104_0183278_586_1116 | 172 |
| 256 | 3300048908 | Ga0496105_0031184 | Ga0496105_0031184_2343_2870 | 172 |
| 257 | 3300048909 | Ga0496106_0000284 | Ga0496106_0000284_32969_33496 | 172 |
| 258 | 3300048914 | Ga0496111_0045724 | Ga0496111_0045724_333_860 | 172 |
| 259 | 3300048915 | Ga0496112_0576861 | Ga0496112_0576861_378_905 | 172 |
| 260 | 3300048919 | Ga0496116_0012976 | Ga0496116_0012976_2202_2720 | 172 |
| 261 | 3300048920 | Ga0496117_0066436 | Ga0496117_0066436_1301_1819 | 172 |
| 262 | 3300048921 | Ga0496118_0047378 | Ga0496118_0047378_459_977 | 172 |
| 263 | 3300048922 | Ga0496119_0058322 | Ga0496119_0058322_1602_2120 | 172 |
| 264 | 3300048924 | Ga0496121_0031741 | Ga0496121_0031741_3972_4490 | 172 |
| 265 | 3300048925 | Ga0496122_0132803 | Ga0496122_0132803_59_577 | 172 |
| 266 | 3300048926 | Ga0496123_0048686 | Ga0496123_0048686_1589_2107 | 172 |
| 267 | 3300048927 | Ga0496124_0215782 | Ga0496124_0215782_481_999 | 172 |
| 268 | 3300048928 | Ga0496125_0041647 | Ga0496125_0041647_3240_3758 | 172 |
| 269 | 3300048929 | Ga0496126_0008820 | Ga0496126_0008820_8344_8868 | 172 |
| 270 | 3300048929 | Ga0496126_0446609 | Ga0496126_0446609_122_640 | 172 |
| 271 | 3300049571 | Ga0501034_0490559 | Ga0501034_0490559_26_553 | 172 |
| 272 | 3300049823 | Ga0501044_0104537 | Ga0501044_0104537_2285_2812 | 172 |
| 273 | 3300050489 | nmdc:mga03683_139_c1 | nmdc:mga03683_139_c1_13418_13942 | 172 |
| 274 | 3300050489 | nmdc:mga03683_7233_c1 | nmdc:mga03683_7233_c1_2412_2951 | 172 |
| 275 | 3300050490 | nmdc:mga03n38_367_c1 | nmdc:mga03n38_367_c1_6838_7362 | 172 |
| 276 | 3300050491 | nmdc:mga00v17_1024_c1 | nmdc:mga00v17_1024_c1_11872_12411 | 172 |
| 277 | 3300050493 | nmdc:mga0k408_20763_c1 | nmdc:mga0k408_20763_c1_1840_2358 | 172 |
| 278 | 3300050493 | nmdc:mga0k408_45_c1 | nmdc:mga0k408_45_c1_13710_14234 | 172 |
| 279 | 3300050496 | nmdc:mga07m45_39_c1 | nmdc:mga07m45_39_c1_14961_15485 | 172 |
| 280 | 3300050496 | nmdc:mga07m45_53336_c1 | nmdc:mga07m45_53336_c1_738_1256 | 172 |
| 281 | 3300050511 | nmdc:mga08y16_613782_c1 | nmdc:mga08y16_613782_c1_441_965 | 172 |
| 282 | 3300050516 | nmdc:mga0sz30_1903_c1 | nmdc:mga0sz30_1903_c1_2389_2913 | 172 |
| 283 | 3300050516 | nmdc:mga0sz30_9867_c2 | nmdc:mga0sz30_9867_c2_454_993 | 172 |
| 284 | 3300053087 | Ga0500643_022000 | Ga0500643_022000_350_868 | 172 |
| 285 | 3300053119 | Ga0500595_027915 | Ga0500595_027915_119_637 | 172 |
| 286 | 3300053121 | Ga0500607_002571 | Ga0500607_002571_12407_12931 | 172 |
| 287 | 3300053138 | Ga0500564_221918 | Ga0500564_221918_69_626 | 172 |
| 288 | 3300053148 | Ga0500590_022976 | Ga0500590_022976_1388_1945 | 172 |
| 289 | 3300053156 | Ga0500622_0001392 | Ga0500622_0001392_4589_5107 | 172 |
| 290 | 3300053730 | Ga0500645_008444 | Ga0500645_008444_1106_1630 | 172 |
| 291 | 3300053730 | Ga0500645_089585 | Ga0500645_089585_186_704 | 172 |
| 292 | 3300053735 | Ga0500596_015312 | Ga0500596_015312_139_696 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9624 | 5 | 164 |
| 6b7d-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine | 0.9607 | 5 | 164 |
| 3l93-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from yersinia pestis. | 0.9593 | 5 | 162 |
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.9532 | 5 | 163 |
| 6qmi-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. | 0.9509 | 6 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9508 | 6 | 163 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9422 | 5 | 162 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9415 | 5 | 163 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9321 | 6 | 163 | 3.40.50.620 |
| 3nd7D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9233 | 5 | 158 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G6VR98-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9764 | 2 | 172 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A0K8N6A8-F1-model_v4 | deleted | 0.9734 | 3 | 164 |
|
| AF-A5V280-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9709 | 6 | 170 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-X5MHH6-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9708 | 5 | 166 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A660VY32-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9699 | 6 | 166 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar