F390580

General Info

Members Datasets Scaffolds Average Seq Length
291 192 291 128

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0189375|Ga0501034_0189375_666_1052
Length 114
Sequence MSPELKYLLFSVLLTFVQVLIAAAAANQVVGLTTLAGNRDDIPTYTGFAGRAKRAHLNMLENLVLFAALALGAMIFFWARLVYAVVYLLGIPWLRTLVWFVSVIGMIMVAIPLF

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
65 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
188 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
191 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
192 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.59
Nodule 0
Rhizoplane 0.34
Rhizosphere 78.35
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10047758 3300005328 Bacteria 2501
2 Ga0070683_100054819 3300005329 Bacteria 3697
3 Ga0070690_100193084 3300005330 Bacteria 1413
4 Ga0070670_100676331 3300005331 Bacteria 927
5 Ga0070670_100784358 3300005331 Bacteria 860
6 Ga0068869_101274616 3300005334 Bacteria 648
7 Ga0068869_101628968 3300005334 Bacteria 575
8 Ga0068869_101685193 3300005334 Bacteria 566
9 Ga0070680_100466664 3300005336 Bacteria 1079
10 Ga0070660_100237818 3300005339 Bacteria 1483
11 Ga0070660_100519264 3300005339 Bacteria 992
12 Ga0070689_100124083 3300005340 Bacteria 2065
13 Ga0070691_10005525 3300005341 Bacteria 5754
14 Ga0070661_100084578 3300005344 Bacteria 2344
15 Ga0070668_100307984 3300005347 Bacteria 1330
16 Ga0070675_100301946 3300005354 Bacteria 1411
17 Ga0070675_101596123 3300005354 Bacteria 602
18 Ga0070675_101802304 3300005354 Bacteria 565
19 Ga0070674_100131425 3300005356 Bacteria 1867
20 Ga0070709_10795058 3300005434 Bacteria 742
21 Ga0070713_100014330 3300005436 Bacteria 5883
22 Ga0070713_100674311 3300005436 Bacteria 986
23 Ga0070710_10130490 3300005437 Bacteria 1532
24 Ga0070700_100081853 3300005441 Bacteria 2087
25 Ga0070708_100015005 3300005445 Bacteria 6389
26 Ga0070708_100368624 3300005445 Bacteria 1354
27 Ga0070663_100794962 3300005455 Bacteria 811
28 Ga0070663_101066618 3300005455 Bacteria 705
29 Ga0070681_10555644 3300005458 Bacteria 1062
30 Ga0070706_100087707 3300005467 Bacteria 2884
31 Ga0070706_100538865 3300005467 Bacteria 1086
32 Ga0070698_100001894 3300005471 Bacteria 23305
33 Ga0070699_100039020 3300005518 Bacteria 4111
34 Ga0070699_100638296 3300005518 Bacteria 972
35 Ga0070679_100195382 3300005530 Bacteria 1991
36 Ga0070684_100059203 3300005535 Bacteria 3348
37 Ga0070697_100040877 3300005536 Bacteria 3752
38 Ga0068853_100439525 3300005539 Bacteria 1226
39 Ga0070672_100276773 3300005543 Bacteria 1418
40 Ga0070665_100099278 3300005548 Bacteria 2915
41 Ga0070665_100313182 3300005548 Bacteria 1573
42 Ga0070665_101232440 3300005548 Bacteria 759
43 Ga0070665_101775183 3300005548 Bacteria 624
44 Ga0068855_100450524 3300005563 Bacteria 1404
45 Ga0068857_100068776 3300005577 Bacteria 3152
46 Ga0068854_100518245 3300005578 Bacteria 1007
47 Ga0068856_100007916 3300005614 Bacteria 10381
48 Ga0068856_101675703 3300005614 Bacteria 648
49 Ga0068852_100016405 3300005616 Bacteria 5775
50 Ga0068852_102464209 3300005616 Bacteria 541
51 Ga0068861_101168054 3300005719 Bacteria 743
52 Ga0068858_100313343 3300005842 Bacteria 1499
53 Ga0068858_100425722 3300005842 Bacteria 1277
54 Ga0068858_102306666 3300005842 Bacteria 532
55 Ga0068862_100814533 3300005844 Bacteria 913
56 Ga0068862_100933679 3300005844 Bacteria 855
57 Ga0081455_10000370 3300005937 Bacteria 59432
58 Ga0081455_10048684 3300005937 Bacteria 3660
59 Ga0081455_10737712 3300005937 Bacteria 624
60 Ga0081539_10001490 3300005985 Bacteria 39594
61 Ga0081539_10010310 3300005985 Bacteria 7614
62 Ga0075365_10095142 3300006038 Bacteria 2034
63 Ga0075365_10311465 3300006038 Bacteria 1108
64 Ga0075365_10989778 3300006038 Bacteria 593
65 Ga0075368_10304813 3300006042 Bacteria 688
66 Ga0075364_10133572 3300006051 Bacteria 1667
67 Ga0075364_10362908 3300006051 Bacteria 988
68 Ga0070715_10088287 3300006163 Unclassified 1421
69 Ga0070716_100625938 3300006173 Bacteria 813
70 Ga0070712_100801783 3300006175 Bacteria 808
71 Ga0075362_10009303 3300006177 Bacteria 3795
72 Ga0075362_10075910 3300006177 Archaea 1542
73 Ga0075362_10104260 3300006177 Bacteria 1329
74 Ga0075362_10271696 3300006177 Bacteria 837
75 Ga0075362_10386412 3300006177 Bacteria 704
76 Ga0075367_10010911 3300006178 Bacteria 4788
77 Ga0075367_10102262 3300006178 Bacteria 1753
78 Ga0075367_10342660 3300006178 Bacteria 943
79 Ga0075367_10426499 3300006178 Bacteria 840
80 Ga0075369_10005323 3300006186 Bacteria 4798
81 Ga0075369_10038653 3300006186 Bacteria 2036
82 Ga0075366_10092549 3300006195 Bacteria 1812
83 Ga0075366_10507569 3300006195 Bacteria 746
84 Ga0075370_10053029 3300006353 Bacteria 2302
85 Ga0075370_10056983 3300006353 Bacteria 2221
86 Ga0068871_100306182 3300006358 Bacteria 1396
87 Ga0068871_101079346 3300006358 Bacteria 750
88 Ga0068871_102199582 3300006358 Bacteria 526
89 Ga0075428_101760389 3300006844 Bacteria 646
90 Ga0099794_10024507 3300007265 Bacteria 2770
91 Ga0099794_10085971 3300007265 Bacteria 1557
92 Ga0105240_10117741 3300009093 Bacteria 3202
93 Ga0105240_10172639 3300009093 Bacteria 2559
94 Ga0111539_11019242 3300009094 Bacteria 962
95 Ga0111539_11019520 3300009094 Bacteria 962
96 Ga0111539_12013273 3300009094 Bacteria 670
97 Ga0105245_11725028 3300009098 Bacteria 679
98 Ga0105247_10526882 3300009101 Bacteria 865
99 Ga0105243_10781603 3300009148 Bacteria 939
100 Ga0105241_11367781 3300009174 Bacteria 677
101 Ga0105241_11820339 3300009174 Bacteria 595
102 Ga0105248_10638210 3300009177 Bacteria 1202
103 Ga0105237_11092011 3300009545 Bacteria 805
104 Ga0105238_10642095 3300009551 Bacteria 1071
105 Ga0105238_10935321 3300009551 Bacteria 886
106 Ga0105249_11197926 3300009553 Bacteria 830
107 Ga0105030_111097 3300009987 Unclassified 778
108 Ga0105035_120051 3300009988 Bacteria 634
109 Ga0105035_123353 3300009988 Bacteria 593
110 Ga0105239_10019175 3300010375 Bacteria 7556
111 Ga0105239_13386324 3300010375 Bacteria 519
112 Ga0157373_10106549 3300013100 Bacteria 1971
113 Ga0157371_10141725 3300013102 Bacteria 1712
114 Ga0157369_10472641 3300013105 Bacteria 1297
115 Ga0163162_10749908 3300013306 Bacteria 1096
116 Ga0157375_10986332 3300013308 Bacteria 983
117 Ga0157515_120493 3300013875 Bacteria 643
118 Ga0163163_11469358 3300014325 Bacteria 743
119 Ga0157376_10134516 3300014969 Bacteria 2211
120 Ga0213872_10430834 3300021361 Bacteria 532
121 Ga0213871_10001616 3300021441 Bacteria 3849
122 Ga0209676_1057353 3300025292 Bacteria 987
123 Ga0209050_1063468 3300025298 Bacteria 861
124 Ga0207426_1006049 3300025302 Bacteria 5346
125 Ga0207426_1055870 3300025302 Bacteria 1154
126 Ga0207692_10216335 3300025898 Bacteria 1134
127 Ga0207680_10680928 3300025903 Bacteria 737
128 Ga0207699_10738844 3300025906 Bacteria 722
129 Ga0207645_10063123 3300025907 Bacteria 2366
130 Ga0207643_10356982 3300025908 Bacteria 918
131 Ga0207684_10082525 3300025910 Bacteria 2738
132 Ga0207707_10022121 3300025912 Bacteria 5558
133 Ga0207707_10966764 3300025912 Bacteria 700
134 Ga0207695_10284512 3300025913 Bacteria 1547
135 Ga0207695_10410901 3300025913 Bacteria 1238
136 Ga0207671_11112162 3300025914 Bacteria 620
137 Ga0207693_10395443 3300025915 Bacteria 1081
138 Ga0207660_11442562 3300025917 Bacteria 557
139 Ga0207660_11675620 3300025917 Bacteria 512
140 Ga0207657_10087753 3300025919 Bacteria 2602
141 Ga0207649_10026891 3300025920 Bacteria 3371
142 Ga0207649_10736532 3300025920 Bacteria 766
143 Ga0207652_10511054 3300025921 Bacteria 1081
144 Ga0207652_10755743 3300025921 Bacteria 865
145 Ga0207681_10077129 3300025923 Bacteria 2342
146 Ga0207694_10449384 3300025924 Bacteria 1076
147 Ga0207650_11612676 3300025925 Bacteria 551
148 Ga0207659_11357595 3300025926 Bacteria 610
149 Ga0207670_10147234 3300025936 Bacteria 1743
150 Ga0207669_10045815 3300025937 Bacteria 2580
151 Ga0207665_10859682 3300025939 Bacteria 718
152 Ga0207665_10986368 3300025939 Bacteria 670
153 Ga0207691_10083208 3300025940 Bacteria 2873
154 Ga0207691_10392907 3300025940 Bacteria 1183
155 Ga0207691_10700999 3300025940 Bacteria 854
156 Ga0207691_11653561 3300025940 Unclassified 519
157 Ga0207711_11298628 3300025941 Bacteria 670
158 Ga0207689_10582555 3300025942 Bacteria 941
159 Ga0207661_10054953 3300025944 Bacteria 3191
160 Ga0207679_10321353 3300025945 Bacteria 1340
161 Ga0207667_10107430 3300025949 Bacteria 2879
162 Ga0207667_11009149 3300025949 Bacteria 819
163 Ga0207640_10307593 3300025981 Bacteria 1257
164 Ga0207658_12039516 3300025986 Unclassified 522
165 Ga0207677_10339206 3300026023 Bacteria 1255
166 Ga0207703_10094542 3300026035 Bacteria 2520
167 Ga0207703_11074308 3300026035 Bacteria 773
168 Ga0207703_11432918 3300026035 Bacteria 664
169 Ga0207678_10298440 3300026067 Bacteria 1384
170 Ga0207678_10531236 3300026067 Bacteria 1027
171 Ga0207708_10159293 3300026075 Bacteria 1782
172 Ga0207702_10010788 3300026078 Bacteria 7625
173 Ga0207702_10239346 3300026078 Bacteria 1700
174 Ga0207648_10640913 3300026089 Bacteria 981
175 Ga0207676_11178047 3300026095 Bacteria 759
176 Ga0207674_10177820 3300026116 Bacteria 2080
177 Ga0207674_10732444 3300026116 Bacteria 954
178 Ga0207675_100502413 3300026118 Bacteria 1207
179 Ga0207698_10030133 3300026142 Bacteria 3897
180 Ga0209588_1144303 3300027671 Bacteria 756
181 Ga0209813_10463767 3300027866 Bacteria 520
182 Ga0268266_10191908 3300028379 Bacteria 1865
183 Ga0268266_10315252 3300028379 Bacteria 1462
184 Ga0268266_10976678 3300028379 Bacteria 819
185 Ga0268265_10574124 3300028380 Bacteria 1074
186 Ga0268265_10766257 3300028380 Bacteria 938
187 Ga0265334_10005454 3300028573 Bacteria 5558
188 Ga0307517_10000601 3300028786 Bacteria 61315
189 Ga0265332_10417321 3300031238 Bacteria 554
190 Ga0265340_10076407 3300031247 Bacteria 1582
191 Ga0307513_10012672 3300031456 Bacteria 10386
192 Ga0307416_100276946 3300032002 Bacteria 1652
193 Ga0373930_0201259 3300034816 Bacteria 518
194 Ga0373948_0045206 3300034817 Bacteria 933
195 Ga0373934_0110037 3300035086 Bacteria 1117
196 Ga0373934_0183056 3300035086 Bacteria 861
197 Ga0373932_0048304 3300035112 Bacteria 1254
198 Ga0373936_0484981 3300035113 Bacteria 574
199 Ga0373939_0354510 3300035114 Bacteria 598
200 Ga0373941_0179194 3300035115 Bacteria 794
201 Ga0373945_0256320 3300035116 Bacteria 740
202 Ga0373931_0422939 3300035691 Bacteria 847
203 Ga0373933_0839889 3300035724 Bacteria 605
204 Ga0373947_0754762 3300035725 Bacteria 664
205 Ga0373937_0218966 3300036401 Bacteria 1792
206 Ga0373925_0959760 3300037068 Bacteria 704
207 Ga0395899_0001159 3300037312 Bacteria 23305
208 Ga0395899_0011006 3300037312 Bacteria 6929
209 Ga0395899_0092039 3300037312 Bacteria 2196
210 Ga0395899_0184654 3300037312 Bacteria 1462
211 Ga0395900_0004870 3300037418 Bacteria 14149
212 Ga0395900_0007092 3300037418 Bacteria 11611
213 Ga0395900_0007882 3300037418 Bacteria 10969
214 Ga0395898_0002205 3300037466 Bacteria 23788
215 Ga0395898_0002340 3300037466 Bacteria 22604
216 Ga0395905_1317611 3300037471 Bacteria 626
217 Ga0436364_0745629 3300037853 Bacteria 1190
218 Ga0395901_0001255 3300038443 Bacteria 26957
219 Ga0395901_0002098 3300038443 Bacteria 20468
220 Ga0395901_0004054 3300038443 Bacteria 14749
221 Ga0395901_0017180 3300038443 Bacteria 7380
222 Ga0436365_0307354 3300039437 Bacteria 1398
223 Ga0436360_0237038 3300039438 Bacteria 9324
224 Ga0436360_0252721 3300039438 Bacteria 2766
225 Ga0436360_0406036 3300039438 Bacteria 1323
226 Ga0436361_0636899 3300039447 Bacteria 7700
227 Ga0436362_0454534 3300039453 Bacteria 653
228 Ga0436362_0719199 3300039453 Bacteria 560
229 Ga0439465_0207042 3300041413 Bacteria 716
230 Ga0439442_025710 3300042002 Bacteria 1225
231 Ga0439448_0153673 3300042005 Bacteria 799
232 Ga0466966_0705789 3300044684 Bacteria 608
233 Ga0466963_0007691 3300044694 Bacteria 6436
234 Ga0466964_0595821 3300044706 Bacteria 606
235 Ga0466967_0031665 3300045976 Bacteria 4455
236 Ga0495603_0359556 3300046455 Bacteria 835
237 Ga0495668_0522327 3300046616 Bacteria 655
238 Ga0495674_1378124 3300047319 Bacteria 526
239 Ga0496104_1805022 3300048907 Bacteria 514
240 Ga0496126_0035078 3300048929 Bacteria 4704
241 Ga0501032_0406135 3300049569 Bacteria 875
242 Ga0501033_0239388 3300049570 Bacteria 1288
243 Ga0501033_0413160 3300049570 Bacteria 940
244 Ga0501034_0004953 3300049571 Bacteria 14656
245 Ga0501034_0008566 3300049571 Bacteria 10796
246 Ga0501034_0189375 3300049571 Bacteria 2020
247 Ga0501034_1234925 3300049571 Bacteria 625
248 Ga0501036_0134376 3300049572 Bacteria 2088
249 Ga0501037_0594414 3300049573 Bacteria 744
250 Ga0501042_0501185 3300049578 Bacteria 882
251 Ga0501068_0008913 3300049584 Bacteria 5599
252 Ga0501070_0103425 3300049586 Bacteria 2355
253 Ga0501070_0517929 3300049586 Bacteria 957
254 Ga0501080_0939558 3300049742 Bacteria 752
255 Ga0501044_0089596 3300049823 Bacteria 3105
256 Ga0501044_0954440 3300049823 Bacteria 730
257 nmdc:mga03683_162415_c1 3300050489 Bacteria 1012
258 nmdc:mga03683_2387_c1 3300050489 Bacteria 4040
259 nmdc:mga03683_463399_c1 3300050489 Bacteria 611
260 nmdc:mga03683_86957_c1 3300050489 Bacteria 1358
261 nmdc:mga03n38_433290_c1 3300050490 Bacteria 729
262 nmdc:mga0yw44_35725_c1 3300050492 Bacteria 2923
263 nmdc:mga0yw44_471641_c1 3300050492 Bacteria 851
264 nmdc:mga0yw44_697398_c1 3300050492 Bacteria 690
265 nmdc:mga0k408_135362_c1 3300050493 Bacteria 1464
266 nmdc:mga0k408_414482_c1 3300050493 Bacteria 801
267 nmdc:mga0k408_789448_c1 3300050493 Bacteria 554
268 nmdc:mga06z11_40602_c1 3300050494 Bacteria 2323
269 nmdc:mga06z11_413076_c1 3300050494 Bacteria 813
270 nmdc:mga06z11_417315_c1 3300050494 Bacteria 809
271 nmdc:mga04h51_430845_c1 3300050495 Bacteria 556
272 nmdc:mga04h51_488141_c1 3300050495 Bacteria 525
273 nmdc:mga07m45_49433_c1 3300050496 Bacteria 2367
274 nmdc:mga07m45_61549_c1 3300050496 Bacteria 2126
275 nmdc:mga08y16_1555986_c1 3300050511 Bacteria 620
276 nmdc:mga08y16_333484_c1 3300050511 Bacteria 1560
277 nmdc:mga08y16_748742_c1 3300050511 Bacteria 973
278 nmdc:mga0sz30_140823_c1 3300050516 Bacteria 1065
279 nmdc:mga0sz30_151_c1 3300050516 Bacteria 25783
280 nmdc:mga0sz30_174485_c1 3300050516 Bacteria 953
281 nmdc:mga0sz30_23802_c1 3300050516 Bacteria 2495
282 Ga0500578_0769687 3300053086 Unclassified 512
283 Ga0500644_0109310 3300053088 Bacteria 1063
284 Ga0500651_0383345 3300053093 Bacteria 792
285 Ga0500641_0002113 3300053096 Bacteria 7042
286 Ga0500614_034093 3300053123 Bacteria 1262
287 Ga0500658_0561900 3300053134 Bacteria 513
288 Ga0500616_0000404 3300053153 Bacteria 59183
289 Ga0500620_060701 3300053155 Bacteria 1286
290 Ga0500552_000284 3300053733 Bacteria 4613
291 Ga0587114_101437 3300059655 Unclassified 561

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0719199 Ga0436362_0719199_204_539 94
2 3300049586 Ga0501070_0103425 Ga0501070_0103425_2010_2345 100
3 3300013100 Ga0157373_10106549 Ga0157373_101065492 101
4 3300006358 Ga0068871_101079346 Ga0068871_1010793462 104
5 3300013306 Ga0163162_10749908 Ga0163162_107499082 104
6 3300049571 Ga0501034_0189375 Ga0501034_0189375_666_1052 104
7 3300050516 nmdc:mga0sz30_174485_c1 nmdc:mga0sz30_174485_c1_470_835 108
8 3300005334 Ga0068869_101274616 Ga0068869_1012746162 110
9 3300009098 Ga0105245_11725028 Ga0105245_117250281 111
10 3300025942 Ga0207689_10582555 Ga0207689_105825552 111
11 3300035113 Ga0373936_0484981 Ga0373936_0484981_88_483 111
12 3300050493 nmdc:mga0k408_414482_c1 nmdc:mga0k408_414482_c1_178_573 111
13 3300031238 Ga0265332_10417321 Ga0265332_104173212 113
14 3300053088 Ga0500644_0109310 Ga0500644_0109310_502_897 113
15 3300034816 Ga0373930_0201259 Ga0373930_0201259_69_449 116
16 3300035086 Ga0373934_0183056 Ga0373934_0183056_454_834 116
17 3300035725 Ga0373947_0754762 Ga0373947_0754762_86_466 116
18 3300036401 Ga0373937_0218966 Ga0373937_0218966_330_710 116
19 3300005347 Ga0070668_100307984 Ga0070668_1003079844 117
20 3300005328 Ga0070676_10047758 Ga0070676_100477583 118
21 3300005329 Ga0070683_100054819 Ga0070683_1000548193 118
22 3300005330 Ga0070690_100193084 Ga0070690_1001930842 118
23 3300005331 Ga0070670_100676331 Ga0070670_1006763312 118
24 3300005331 Ga0070670_100784358 Ga0070670_1007843582 118
25 3300005334 Ga0068869_101628968 Ga0068869_1016289682 118
26 3300005334 Ga0068869_101685193 Ga0068869_1016851931 118
27 3300005336 Ga0070680_100466664 Ga0070680_1004666642 118
28 3300005339 Ga0070660_100237818 Ga0070660_1002378183 118
29 3300005339 Ga0070660_100519264 Ga0070660_1005192641 118
30 3300005340 Ga0070689_100124083 Ga0070689_1001240831 118
31 3300005341 Ga0070691_10005525 Ga0070691_100055252 118
32 3300005344 Ga0070661_100084578 Ga0070661_1000845783 118
33 3300005354 Ga0070675_100301946 Ga0070675_1003019463 118
34 3300005354 Ga0070675_101596123 Ga0070675_1015961231 118
35 3300005354 Ga0070675_101802304 Ga0070675_1018023042 118
36 3300005356 Ga0070674_100131425 Ga0070674_1001314253 118
37 3300005434 Ga0070709_10795058 Ga0070709_107950582 118
38 3300005436 Ga0070713_100014330 Ga0070713_1000143309 118
39 3300005436 Ga0070713_100674311 Ga0070713_1006743111 118
40 3300005437 Ga0070710_10130490 Ga0070710_101304902 118
41 3300005441 Ga0070700_100081853 Ga0070700_1000818533 118
42 3300005445 Ga0070708_100015005 Ga0070708_1000150057 118
43 3300005445 Ga0070708_100368624 Ga0070708_1003686242 118
44 3300005455 Ga0070663_100794962 Ga0070663_1007949622 118
45 3300005455 Ga0070663_101066618 Ga0070663_1010666182 118
46 3300005458 Ga0070681_10555644 Ga0070681_105556442 118
47 3300005467 Ga0070706_100087707 Ga0070706_1000877074 118
48 3300005467 Ga0070706_100538865 Ga0070706_1005388652 118
49 3300005471 Ga0070698_100001894 Ga0070698_10000189411 118
50 3300005518 Ga0070699_100039020 Ga0070699_1000390204 118
51 3300005518 Ga0070699_100638296 Ga0070699_1006382962 118
52 3300005530 Ga0070679_100195382 Ga0070679_1001953823 118
53 3300005535 Ga0070684_100059203 Ga0070684_1000592034 118
54 3300005536 Ga0070697_100040877 Ga0070697_1000408774 118
55 3300005539 Ga0068853_100439525 Ga0068853_1004395251 118
56 3300005543 Ga0070672_100276773 Ga0070672_1002767732 118
57 3300005548 Ga0070665_100099278 Ga0070665_1000992782 118
58 3300005548 Ga0070665_100313182 Ga0070665_1003131822 118
59 3300005548 Ga0070665_101232440 Ga0070665_1012324401 118
60 3300005548 Ga0070665_101775183 Ga0070665_1017751832 118
61 3300005563 Ga0068855_100450524 Ga0068855_1004505242 118
62 3300005577 Ga0068857_100068776 Ga0068857_1000687763 118
63 3300005578 Ga0068854_100518245 Ga0068854_1005182451 118
64 3300005614 Ga0068856_100007916 Ga0068856_1000079167 118
65 3300005614 Ga0068856_101675703 Ga0068856_1016757032 118
66 3300005616 Ga0068852_100016405 Ga0068852_1000164053 118
67 3300005616 Ga0068852_102464209 Ga0068852_1024642092 118
68 3300005719 Ga0068861_101168054 Ga0068861_1011680542 118
69 3300005842 Ga0068858_100313343 Ga0068858_1003133432 118
70 3300005842 Ga0068858_100425722 Ga0068858_1004257222 118
71 3300005842 Ga0068858_102306666 Ga0068858_1023066661 118
72 3300005844 Ga0068862_100814533 Ga0068862_1008145332 118
73 3300005844 Ga0068862_100933679 Ga0068862_1009336791 118
74 3300005937 Ga0081455_10000370 Ga0081455_1000037034 118
75 3300005937 Ga0081455_10048684 Ga0081455_100486843 118
76 3300005937 Ga0081455_10737712 Ga0081455_107377121 118
77 3300005985 Ga0081539_10001490 Ga0081539_1000149031 118
78 3300005985 Ga0081539_10010310 Ga0081539_100103107 118
79 3300006038 Ga0075365_10095142 Ga0075365_100951423 118
80 3300006038 Ga0075365_10311465 Ga0075365_103114652 118
81 3300006038 Ga0075365_10989778 Ga0075365_109897782 118
82 3300006042 Ga0075368_10304813 Ga0075368_103048131 118
83 3300006051 Ga0075364_10133572 Ga0075364_101335722 118
84 3300006051 Ga0075364_10362908 Ga0075364_103629082 118
85 3300006163 Ga0070715_10088287 Ga0070715_100882872 118
86 3300006173 Ga0070716_100625938 Ga0070716_1006259382 118
87 3300006175 Ga0070712_100801783 Ga0070712_1008017832 118
88 3300006177 Ga0075362_10009303 Ga0075362_100093034 118
89 3300006177 Ga0075362_10075910 Ga0075362_100759102 118
90 3300006177 Ga0075362_10104260 Ga0075362_101042603 118
91 3300006177 Ga0075362_10271696 Ga0075362_102716961 118
92 3300006177 Ga0075362_10386412 Ga0075362_103864121 118
93 3300006178 Ga0075367_10010911 Ga0075367_100109115 118
94 3300006178 Ga0075367_10102262 Ga0075367_101022622 118
95 3300006178 Ga0075367_10342660 Ga0075367_103426602 118
96 3300006178 Ga0075367_10426499 Ga0075367_104264991 118
97 3300006186 Ga0075369_10005323 Ga0075369_100053234 118
98 3300006186 Ga0075369_10038653 Ga0075369_100386532 118
99 3300006195 Ga0075366_10092549 Ga0075366_100925493 118
100 3300006195 Ga0075366_10507569 Ga0075366_105075692 118
101 3300006353 Ga0075370_10053029 Ga0075370_100530293 118
102 3300006353 Ga0075370_10056983 Ga0075370_100569834 118
103 3300006358 Ga0068871_100306182 Ga0068871_1003061822 118
104 3300006358 Ga0068871_102199582 Ga0068871_1021995821 118
105 3300006844 Ga0075428_101760389 Ga0075428_1017603892 118
106 3300007265 Ga0099794_10024507 Ga0099794_100245073 118
107 3300007265 Ga0099794_10085971 Ga0099794_100859712 118
108 3300009093 Ga0105240_10117741 Ga0105240_101177411 118
109 3300009093 Ga0105240_10172639 Ga0105240_101726393 118
110 3300009094 Ga0111539_11019242 Ga0111539_110192421 118
111 3300009094 Ga0111539_11019520 Ga0111539_110195201 118
112 3300009094 Ga0111539_12013273 Ga0111539_120132732 118
113 3300009101 Ga0105247_10526882 Ga0105247_105268822 118
114 3300009148 Ga0105243_10781603 Ga0105243_107816032 118
115 3300009174 Ga0105241_11367781 Ga0105241_113677812 118
116 3300009174 Ga0105241_11820339 Ga0105241_118203392 118
117 3300009177 Ga0105248_10638210 Ga0105248_106382102 118
118 3300009545 Ga0105237_11092011 Ga0105237_110920112 118
119 3300009551 Ga0105238_10642095 Ga0105238_106420952 118
120 3300009551 Ga0105238_10935321 Ga0105238_109353211 118
121 3300009553 Ga0105249_11197926 Ga0105249_111979262 118
122 3300009987 Ga0105030_111097 Ga0105030_1110972 118
123 3300009988 Ga0105035_120051 Ga0105035_1200511 118
124 3300009988 Ga0105035_123353 Ga0105035_1233531 118
125 3300010375 Ga0105239_10019175 Ga0105239_100191756 118
126 3300010375 Ga0105239_13386324 Ga0105239_133863241 118
127 3300013102 Ga0157371_10141725 Ga0157371_101417252 118
128 3300013105 Ga0157369_10472641 Ga0157369_104726412 118
129 3300013308 Ga0157375_10986332 Ga0157375_109863322 118
130 3300013875 Ga0157515_120493 Ga0157515_1204932 118
131 3300014325 Ga0163163_11469358 Ga0163163_114693581 118
132 3300014969 Ga0157376_10134516 Ga0157376_101345162 118
133 3300021361 Ga0213872_10430834 Ga0213872_104308342 118
134 3300021441 Ga0213871_10001616 Ga0213871_100016162 118
135 3300025292 Ga0209676_1057353 Ga0209676_10573532 118
136 3300025298 Ga0209050_1063468 Ga0209050_10634682 118
137 3300025302 Ga0207426_1006049 Ga0207426_10060494 118
138 3300025302 Ga0207426_1055870 Ga0207426_10558702 118
139 3300025898 Ga0207692_10216335 Ga0207692_102163352 118
140 3300025903 Ga0207680_10680928 Ga0207680_106809282 118
141 3300025906 Ga0207699_10738844 Ga0207699_107388442 118
142 3300025907 Ga0207645_10063123 Ga0207645_100631233 118
143 3300025908 Ga0207643_10356982 Ga0207643_103569822 118
144 3300025910 Ga0207684_10082525 Ga0207684_100825253 118
145 3300025912 Ga0207707_10022121 Ga0207707_100221213 118
146 3300025912 Ga0207707_10966764 Ga0207707_109667642 118
147 3300025913 Ga0207695_10284512 Ga0207695_102845123 118
148 3300025913 Ga0207695_10410901 Ga0207695_104109012 118
149 3300025914 Ga0207671_11112162 Ga0207671_111121622 118
150 3300025915 Ga0207693_10395443 Ga0207693_103954432 118
151 3300025917 Ga0207660_11442562 Ga0207660_114425621 118
152 3300025917 Ga0207660_11675620 Ga0207660_116756201 118
153 3300025919 Ga0207657_10087753 Ga0207657_100877533 118
154 3300025920 Ga0207649_10026891 Ga0207649_100268912 118
155 3300025920 Ga0207649_10736532 Ga0207649_107365321 118
156 3300025921 Ga0207652_10511054 Ga0207652_105110541 118
157 3300025921 Ga0207652_10755743 Ga0207652_107557432 118
158 3300025923 Ga0207681_10077129 Ga0207681_100771292 118
159 3300025924 Ga0207694_10449384 Ga0207694_104493842 118
160 3300025925 Ga0207650_11612676 Ga0207650_116126761 118
161 3300025926 Ga0207659_11357595 Ga0207659_113575951 118
162 3300025936 Ga0207670_10147234 Ga0207670_101472341 118
163 3300025937 Ga0207669_10045815 Ga0207669_100458152 118
164 3300025939 Ga0207665_10859682 Ga0207665_108596822 118
165 3300025939 Ga0207665_10986368 Ga0207665_109863682 118
166 3300025940 Ga0207691_10083208 Ga0207691_100832082 118
167 3300025940 Ga0207691_10392907 Ga0207691_103929072 118
168 3300025940 Ga0207691_10700999 Ga0207691_107009991 118
169 3300025940 Ga0207691_11653561 Ga0207691_116535611 118
170 3300025941 Ga0207711_11298628 Ga0207711_112986281 118
171 3300025944 Ga0207661_10054953 Ga0207661_100549533 118
172 3300025945 Ga0207679_10321353 Ga0207679_103213532 118
173 3300025949 Ga0207667_10107430 Ga0207667_101074302 118
174 3300025949 Ga0207667_11009149 Ga0207667_110091492 118
175 3300025981 Ga0207640_10307593 Ga0207640_103075932 118
176 3300025986 Ga0207658_12039516 Ga0207658_120395161 118
177 3300026023 Ga0207677_10339206 Ga0207677_103392061 118
178 3300026035 Ga0207703_10094542 Ga0207703_100945423 118
179 3300026035 Ga0207703_11074308 Ga0207703_110743081 118
180 3300026035 Ga0207703_11432918 Ga0207703_114329181 118
181 3300026067 Ga0207678_10298440 Ga0207678_102984402 118
182 3300026067 Ga0207678_10531236 Ga0207678_105312361 118
183 3300026075 Ga0207708_10159293 Ga0207708_101592932 118
184 3300026078 Ga0207702_10010788 Ga0207702_100107883 118
185 3300026078 Ga0207702_10239346 Ga0207702_102393462 118
186 3300026089 Ga0207648_10640913 Ga0207648_106409132 118
187 3300026095 Ga0207676_11178047 Ga0207676_111780472 118
188 3300026116 Ga0207674_10177820 Ga0207674_101778201 118
189 3300026116 Ga0207674_10732444 Ga0207674_107324442 118
190 3300026118 Ga0207675_100502413 Ga0207675_1005024132 118
191 3300026142 Ga0207698_10030133 Ga0207698_100301332 118
192 3300027671 Ga0209588_1144303 Ga0209588_11443032 118
193 3300027866 Ga0209813_10463767 Ga0209813_104637671 118
194 3300028379 Ga0268266_10191908 Ga0268266_101919083 118
195 3300028379 Ga0268266_10315252 Ga0268266_103152523 118
196 3300028379 Ga0268266_10976678 Ga0268266_109766782 118
197 3300028380 Ga0268265_10574124 Ga0268265_105741242 118
198 3300028380 Ga0268265_10766257 Ga0268265_107662571 118
199 3300028573 Ga0265334_10005454 Ga0265334_1000545410 118
200 3300028786 Ga0307517_10000601 Ga0307517_1000060149 118
201 3300031247 Ga0265340_10076407 Ga0265340_100764073 118
202 3300031456 Ga0307513_10012672 Ga0307513_100126723 118
203 3300032002 Ga0307416_100276946 Ga0307416_1002769462 118
204 3300034817 Ga0373948_0045206 Ga0373948_0045206_385_780 118
205 3300035086 Ga0373934_0110037 Ga0373934_0110037_108_494 118
206 3300035112 Ga0373932_0048304 Ga0373932_0048304_489_884 118
207 3300035114 Ga0373939_0354510 Ga0373939_0354510_99_488 118
208 3300035115 Ga0373941_0179194 Ga0373941_0179194_187_576 118
209 3300035116 Ga0373945_0256320 Ga0373945_0256320_273_668 118
210 3300035691 Ga0373931_0422939 Ga0373931_0422939_190_585 118
211 3300035724 Ga0373933_0839889 Ga0373933_0839889_148_543 118
212 3300037068 Ga0373925_0959760 Ga0373925_0959760_172_558 118
213 3300037312 Ga0395899_0001159 Ga0395899_0001159_15923_16309 118
214 3300037312 Ga0395899_0011006 Ga0395899_0011006_5134_5520 118
215 3300037312 Ga0395899_0092039 Ga0395899_0092039_826_1212 118
216 3300037312 Ga0395899_0184654 Ga0395899_0184654_309_695 118
217 3300037418 Ga0395900_0004870 Ga0395900_0004870_10032_10418 118
218 3300037418 Ga0395900_0007092 Ga0395900_0007092_7062_7448 118
219 3300037418 Ga0395900_0007882 Ga0395900_0007882_10091_10477 118
220 3300037466 Ga0395898_0002205 Ga0395898_0002205_10630_11016 118
221 3300037466 Ga0395898_0002340 Ga0395898_0002340_14061_14447 118
222 3300037471 Ga0395905_1317611 Ga0395905_1317611_86_472 118
223 3300037853 Ga0436364_0745629 Ga0436364_0745629_752_1138 118
224 3300038443 Ga0395901_0001255 Ga0395901_0001255_12037_12423 118
225 3300038443 Ga0395901_0002098 Ga0395901_0002098_16179_16565 118
226 3300038443 Ga0395901_0004054 Ga0395901_0004054_7308_7694 118
227 3300038443 Ga0395901_0017180 Ga0395901_0017180_1499_1885 118
228 3300039437 Ga0436365_0307354 Ga0436365_0307354_178_564 118
229 3300039438 Ga0436360_0237038 Ga0436360_0237038_7079_7465 118
230 3300039438 Ga0436360_0252721 Ga0436360_0252721_1868_2254 118
231 3300039438 Ga0436360_0406036 Ga0436360_0406036_229_705 118
232 3300039447 Ga0436361_0636899 Ga0436361_0636899_5098_5484 118
233 3300039453 Ga0436362_0454534 Ga0436362_0454534_164_550 118
234 3300041413 Ga0439465_0207042 Ga0439465_0207042_142_537 118
235 3300042002 Ga0439442_025710 Ga0439442_025710_126_515 118
236 3300042005 Ga0439448_0153673 Ga0439448_0153673_86_472 118
237 3300044684 Ga0466966_0705789 Ga0466966_0705789_114_500 118
238 3300044694 Ga0466963_0007691 Ga0466963_0007691_1995_2381 118
239 3300044706 Ga0466964_0595821 Ga0466964_0595821_116_502 118
240 3300045976 Ga0466967_0031665 Ga0466967_0031665_188_574 118
241 3300046455 Ga0495603_0359556 Ga0495603_0359556_378_773 118
242 3300046616 Ga0495668_0522327 Ga0495668_0522327_14_409 118
243 3300047319 Ga0495674_1378124 Ga0495674_1378124_65_460 118
244 3300048907 Ga0496104_1805022 Ga0496104_1805022_91_477 118
245 3300048929 Ga0496126_0035078 Ga0496126_0035078_4159_4566 118
246 3300049569 Ga0501032_0406135 Ga0501032_0406135_459_854 118
247 3300049570 Ga0501033_0239388 Ga0501033_0239388_75_461 118
248 3300049570 Ga0501033_0413160 Ga0501033_0413160_285_674 118
249 3300049571 Ga0501034_0004953 Ga0501034_0004953_2110_2499 118
250 3300049571 Ga0501034_0008566 Ga0501034_0008566_2437_2826 118
251 3300049571 Ga0501034_1234925 Ga0501034_1234925_31_417 118
252 3300049572 Ga0501036_0134376 Ga0501036_0134376_75_461 118
253 3300049573 Ga0501037_0594414 Ga0501037_0594414_295_681 118
254 3300049578 Ga0501042_0501185 Ga0501042_0501185_359_754 118
255 3300049584 Ga0501068_0008913 Ga0501068_0008913_2031_2420 118
256 3300049586 Ga0501070_0517929 Ga0501070_0517929_427_813 118
257 3300049742 Ga0501080_0939558 Ga0501080_0939558_314_700 118
258 3300049823 Ga0501044_0089596 Ga0501044_0089596_2136_2525 118
259 3300049823 Ga0501044_0954440 Ga0501044_0954440_167_553 118
260 3300050489 nmdc:mga03683_162415_c1 nmdc:mga03683_162415_c1_363_758 118
261 3300050489 nmdc:mga03683_2387_c1 nmdc:mga03683_2387_c1_768_1163 118
262 3300050489 nmdc:mga03683_463399_c1 nmdc:mga03683_463399_c1_177_563 118
263 3300050489 nmdc:mga03683_86957_c1 nmdc:mga03683_86957_c1_205_600 118
264 3300050490 nmdc:mga03n38_433290_c1 nmdc:mga03n38_433290_c1_124_519 118
265 3300050492 nmdc:mga0yw44_35725_c1 nmdc:mga0yw44_35725_c1_1129_1524 118
266 3300050492 nmdc:mga0yw44_471641_c1 nmdc:mga0yw44_471641_c1_338_733 118
267 3300050492 nmdc:mga0yw44_697398_c1 nmdc:mga0yw44_697398_c1_87_482 118
268 3300050493 nmdc:mga0k408_135362_c1 nmdc:mga0k408_135362_c1_1036_1431 118
269 3300050493 nmdc:mga0k408_789448_c1 nmdc:mga0k408_789448_c1_77_463 118
270 3300050494 nmdc:mga06z11_40602_c1 nmdc:mga06z11_40602_c1_1072_1467 118
271 3300050494 nmdc:mga06z11_413076_c1 nmdc:mga06z11_413076_c1_133_528 118
272 3300050494 nmdc:mga06z11_417315_c1 nmdc:mga06z11_417315_c1_394_789 118
273 3300050495 nmdc:mga04h51_430845_c1 nmdc:mga04h51_430845_c1_30_425 118
274 3300050495 nmdc:mga04h51_488141_c1 nmdc:mga04h51_488141_c1_82_468 118
275 3300050496 nmdc:mga07m45_49433_c1 nmdc:mga07m45_49433_c1_1581_1976 118
276 3300050496 nmdc:mga07m45_61549_c1 nmdc:mga07m45_61549_c1_229_624 118
277 3300050511 nmdc:mga08y16_1555986_c1 nmdc:mga08y16_1555986_c1_16_405 118
278 3300050511 nmdc:mga08y16_333484_c1 nmdc:mga08y16_333484_c1_1144_1539 118
279 3300050511 nmdc:mga08y16_748742_c1 nmdc:mga08y16_748742_c1_464_853 118
280 3300050516 nmdc:mga0sz30_140823_c1 nmdc:mga0sz30_140823_c1_463_858 118
281 3300050516 nmdc:mga0sz30_151_c1 nmdc:mga0sz30_151_c1_3266_3661 118
282 3300050516 nmdc:mga0sz30_23802_c1 nmdc:mga0sz30_23802_c1_400_795 118
283 3300053086 Ga0500578_0769687 Ga0500578_0769687_80_475 118
284 3300053093 Ga0500651_0383345 Ga0500651_0383345_93_488 118
285 3300053096 Ga0500641_0002113 Ga0500641_0002113_3669_4064 118
286 3300053123 Ga0500614_034093 Ga0500614_034093_643_1038 118
287 3300053134 Ga0500658_0561900 Ga0500658_0561900_38_424 118
288 3300053153 Ga0500616_0000404 Ga0500616_0000404_20214_20609 118
289 3300053155 Ga0500620_060701 Ga0500620_060701_367_762 118
290 3300053733 Ga0500552_000284 Ga0500552_000284_1747_2142 118
291 3300059655 Ga0587114_101437 Ga0587114_101437_56_442 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

6

114

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.7634 2 104
4jrz-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7441 2 102
3hkk-assembly1.cif.gz_A structure of human leukotriene c4 synthase in complex with glutathione sulfonate 0.7396 2 104
6r7d-assembly3.cif.gz_H crystal structure of ltc4s in complex with az13690257 0.7336 2 102
4j7t-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.7121 2 104
ID Description Score Start End Superfamily
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8112 3 106 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.797 3 106 1.20.120.550
af_Q54GA9_9_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7513 1 101 1.20.120.550
4jrzA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7441 2 102 1.20.120.550
af_Q86B54_20_166_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7408 1 106 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A6A7MCA7-F1-model_v4 MAPEG family protein 0.9569 1 111 GO:0016020
AF-A8TT19-F1-model_v4 Glycine dehydrogenase (EC 1.4.4.2) 0.9567 1 101 GO:0004375
GO:0016020
AF-A0A7Y8SY30-F1-model_v4 MAPEG family protein 0.954 1 106 GO:0016020
AF-A0A1G2X547-F1-model_v4 deleted 0.948 1 106
AF-A0A7C2R8R0-F1-model_v4 MAPEG family protein 0.9453 1 110 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.5 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map