F390580
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 192 | 291 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0189375|Ga0501034_0189375_666_1052 |
| Length | 114 |
| Sequence | MSPELKYLLFSVLLTFVQVLIAAAAANQVVGLTTLAGNRDDIPTYTGFAGRAKRAHLNMLENLVLFAALALGAMIFFWARLVYAVVYLLGIPWLRTLVWFVSVIGMIMVAIPLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 65 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 76 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 77 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 127 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 130 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 135 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 136 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 149 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 150 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 151 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 152 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 153 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 154 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 155 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 176 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 178 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 180 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 184 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 185 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 186 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 187 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 188 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 190 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 191 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 192 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.59 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 78.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10047758 | 3300005328 | Bacteria | 2501 |
| 2 | Ga0070683_100054819 | 3300005329 | Bacteria | 3697 |
| 3 | Ga0070690_100193084 | 3300005330 | Bacteria | 1413 |
| 4 | Ga0070670_100676331 | 3300005331 | Bacteria | 927 |
| 5 | Ga0070670_100784358 | 3300005331 | Bacteria | 860 |
| 6 | Ga0068869_101274616 | 3300005334 | Bacteria | 648 |
| 7 | Ga0068869_101628968 | 3300005334 | Bacteria | 575 |
| 8 | Ga0068869_101685193 | 3300005334 | Bacteria | 566 |
| 9 | Ga0070680_100466664 | 3300005336 | Bacteria | 1079 |
| 10 | Ga0070660_100237818 | 3300005339 | Bacteria | 1483 |
| 11 | Ga0070660_100519264 | 3300005339 | Bacteria | 992 |
| 12 | Ga0070689_100124083 | 3300005340 | Bacteria | 2065 |
| 13 | Ga0070691_10005525 | 3300005341 | Bacteria | 5754 |
| 14 | Ga0070661_100084578 | 3300005344 | Bacteria | 2344 |
| 15 | Ga0070668_100307984 | 3300005347 | Bacteria | 1330 |
| 16 | Ga0070675_100301946 | 3300005354 | Bacteria | 1411 |
| 17 | Ga0070675_101596123 | 3300005354 | Bacteria | 602 |
| 18 | Ga0070675_101802304 | 3300005354 | Bacteria | 565 |
| 19 | Ga0070674_100131425 | 3300005356 | Bacteria | 1867 |
| 20 | Ga0070709_10795058 | 3300005434 | Bacteria | 742 |
| 21 | Ga0070713_100014330 | 3300005436 | Bacteria | 5883 |
| 22 | Ga0070713_100674311 | 3300005436 | Bacteria | 986 |
| 23 | Ga0070710_10130490 | 3300005437 | Bacteria | 1532 |
| 24 | Ga0070700_100081853 | 3300005441 | Bacteria | 2087 |
| 25 | Ga0070708_100015005 | 3300005445 | Bacteria | 6389 |
| 26 | Ga0070708_100368624 | 3300005445 | Bacteria | 1354 |
| 27 | Ga0070663_100794962 | 3300005455 | Bacteria | 811 |
| 28 | Ga0070663_101066618 | 3300005455 | Bacteria | 705 |
| 29 | Ga0070681_10555644 | 3300005458 | Bacteria | 1062 |
| 30 | Ga0070706_100087707 | 3300005467 | Bacteria | 2884 |
| 31 | Ga0070706_100538865 | 3300005467 | Bacteria | 1086 |
| 32 | Ga0070698_100001894 | 3300005471 | Bacteria | 23305 |
| 33 | Ga0070699_100039020 | 3300005518 | Bacteria | 4111 |
| 34 | Ga0070699_100638296 | 3300005518 | Bacteria | 972 |
| 35 | Ga0070679_100195382 | 3300005530 | Bacteria | 1991 |
| 36 | Ga0070684_100059203 | 3300005535 | Bacteria | 3348 |
| 37 | Ga0070697_100040877 | 3300005536 | Bacteria | 3752 |
| 38 | Ga0068853_100439525 | 3300005539 | Bacteria | 1226 |
| 39 | Ga0070672_100276773 | 3300005543 | Bacteria | 1418 |
| 40 | Ga0070665_100099278 | 3300005548 | Bacteria | 2915 |
| 41 | Ga0070665_100313182 | 3300005548 | Bacteria | 1573 |
| 42 | Ga0070665_101232440 | 3300005548 | Bacteria | 759 |
| 43 | Ga0070665_101775183 | 3300005548 | Bacteria | 624 |
| 44 | Ga0068855_100450524 | 3300005563 | Bacteria | 1404 |
| 45 | Ga0068857_100068776 | 3300005577 | Bacteria | 3152 |
| 46 | Ga0068854_100518245 | 3300005578 | Bacteria | 1007 |
| 47 | Ga0068856_100007916 | 3300005614 | Bacteria | 10381 |
| 48 | Ga0068856_101675703 | 3300005614 | Bacteria | 648 |
| 49 | Ga0068852_100016405 | 3300005616 | Bacteria | 5775 |
| 50 | Ga0068852_102464209 | 3300005616 | Bacteria | 541 |
| 51 | Ga0068861_101168054 | 3300005719 | Bacteria | 743 |
| 52 | Ga0068858_100313343 | 3300005842 | Bacteria | 1499 |
| 53 | Ga0068858_100425722 | 3300005842 | Bacteria | 1277 |
| 54 | Ga0068858_102306666 | 3300005842 | Bacteria | 532 |
| 55 | Ga0068862_100814533 | 3300005844 | Bacteria | 913 |
| 56 | Ga0068862_100933679 | 3300005844 | Bacteria | 855 |
| 57 | Ga0081455_10000370 | 3300005937 | Bacteria | 59432 |
| 58 | Ga0081455_10048684 | 3300005937 | Bacteria | 3660 |
| 59 | Ga0081455_10737712 | 3300005937 | Bacteria | 624 |
| 60 | Ga0081539_10001490 | 3300005985 | Bacteria | 39594 |
| 61 | Ga0081539_10010310 | 3300005985 | Bacteria | 7614 |
| 62 | Ga0075365_10095142 | 3300006038 | Bacteria | 2034 |
| 63 | Ga0075365_10311465 | 3300006038 | Bacteria | 1108 |
| 64 | Ga0075365_10989778 | 3300006038 | Bacteria | 593 |
| 65 | Ga0075368_10304813 | 3300006042 | Bacteria | 688 |
| 66 | Ga0075364_10133572 | 3300006051 | Bacteria | 1667 |
| 67 | Ga0075364_10362908 | 3300006051 | Bacteria | 988 |
| 68 | Ga0070715_10088287 | 3300006163 | Unclassified | 1421 |
| 69 | Ga0070716_100625938 | 3300006173 | Bacteria | 813 |
| 70 | Ga0070712_100801783 | 3300006175 | Bacteria | 808 |
| 71 | Ga0075362_10009303 | 3300006177 | Bacteria | 3795 |
| 72 | Ga0075362_10075910 | 3300006177 | Archaea | 1542 |
| 73 | Ga0075362_10104260 | 3300006177 | Bacteria | 1329 |
| 74 | Ga0075362_10271696 | 3300006177 | Bacteria | 837 |
| 75 | Ga0075362_10386412 | 3300006177 | Bacteria | 704 |
| 76 | Ga0075367_10010911 | 3300006178 | Bacteria | 4788 |
| 77 | Ga0075367_10102262 | 3300006178 | Bacteria | 1753 |
| 78 | Ga0075367_10342660 | 3300006178 | Bacteria | 943 |
| 79 | Ga0075367_10426499 | 3300006178 | Bacteria | 840 |
| 80 | Ga0075369_10005323 | 3300006186 | Bacteria | 4798 |
| 81 | Ga0075369_10038653 | 3300006186 | Bacteria | 2036 |
| 82 | Ga0075366_10092549 | 3300006195 | Bacteria | 1812 |
| 83 | Ga0075366_10507569 | 3300006195 | Bacteria | 746 |
| 84 | Ga0075370_10053029 | 3300006353 | Bacteria | 2302 |
| 85 | Ga0075370_10056983 | 3300006353 | Bacteria | 2221 |
| 86 | Ga0068871_100306182 | 3300006358 | Bacteria | 1396 |
| 87 | Ga0068871_101079346 | 3300006358 | Bacteria | 750 |
| 88 | Ga0068871_102199582 | 3300006358 | Bacteria | 526 |
| 89 | Ga0075428_101760389 | 3300006844 | Bacteria | 646 |
| 90 | Ga0099794_10024507 | 3300007265 | Bacteria | 2770 |
| 91 | Ga0099794_10085971 | 3300007265 | Bacteria | 1557 |
| 92 | Ga0105240_10117741 | 3300009093 | Bacteria | 3202 |
| 93 | Ga0105240_10172639 | 3300009093 | Bacteria | 2559 |
| 94 | Ga0111539_11019242 | 3300009094 | Bacteria | 962 |
| 95 | Ga0111539_11019520 | 3300009094 | Bacteria | 962 |
| 96 | Ga0111539_12013273 | 3300009094 | Bacteria | 670 |
| 97 | Ga0105245_11725028 | 3300009098 | Bacteria | 679 |
| 98 | Ga0105247_10526882 | 3300009101 | Bacteria | 865 |
| 99 | Ga0105243_10781603 | 3300009148 | Bacteria | 939 |
| 100 | Ga0105241_11367781 | 3300009174 | Bacteria | 677 |
| 101 | Ga0105241_11820339 | 3300009174 | Bacteria | 595 |
| 102 | Ga0105248_10638210 | 3300009177 | Bacteria | 1202 |
| 103 | Ga0105237_11092011 | 3300009545 | Bacteria | 805 |
| 104 | Ga0105238_10642095 | 3300009551 | Bacteria | 1071 |
| 105 | Ga0105238_10935321 | 3300009551 | Bacteria | 886 |
| 106 | Ga0105249_11197926 | 3300009553 | Bacteria | 830 |
| 107 | Ga0105030_111097 | 3300009987 | Unclassified | 778 |
| 108 | Ga0105035_120051 | 3300009988 | Bacteria | 634 |
| 109 | Ga0105035_123353 | 3300009988 | Bacteria | 593 |
| 110 | Ga0105239_10019175 | 3300010375 | Bacteria | 7556 |
| 111 | Ga0105239_13386324 | 3300010375 | Bacteria | 519 |
| 112 | Ga0157373_10106549 | 3300013100 | Bacteria | 1971 |
| 113 | Ga0157371_10141725 | 3300013102 | Bacteria | 1712 |
| 114 | Ga0157369_10472641 | 3300013105 | Bacteria | 1297 |
| 115 | Ga0163162_10749908 | 3300013306 | Bacteria | 1096 |
| 116 | Ga0157375_10986332 | 3300013308 | Bacteria | 983 |
| 117 | Ga0157515_120493 | 3300013875 | Bacteria | 643 |
| 118 | Ga0163163_11469358 | 3300014325 | Bacteria | 743 |
| 119 | Ga0157376_10134516 | 3300014969 | Bacteria | 2211 |
| 120 | Ga0213872_10430834 | 3300021361 | Bacteria | 532 |
| 121 | Ga0213871_10001616 | 3300021441 | Bacteria | 3849 |
| 122 | Ga0209676_1057353 | 3300025292 | Bacteria | 987 |
| 123 | Ga0209050_1063468 | 3300025298 | Bacteria | 861 |
| 124 | Ga0207426_1006049 | 3300025302 | Bacteria | 5346 |
| 125 | Ga0207426_1055870 | 3300025302 | Bacteria | 1154 |
| 126 | Ga0207692_10216335 | 3300025898 | Bacteria | 1134 |
| 127 | Ga0207680_10680928 | 3300025903 | Bacteria | 737 |
| 128 | Ga0207699_10738844 | 3300025906 | Bacteria | 722 |
| 129 | Ga0207645_10063123 | 3300025907 | Bacteria | 2366 |
| 130 | Ga0207643_10356982 | 3300025908 | Bacteria | 918 |
| 131 | Ga0207684_10082525 | 3300025910 | Bacteria | 2738 |
| 132 | Ga0207707_10022121 | 3300025912 | Bacteria | 5558 |
| 133 | Ga0207707_10966764 | 3300025912 | Bacteria | 700 |
| 134 | Ga0207695_10284512 | 3300025913 | Bacteria | 1547 |
| 135 | Ga0207695_10410901 | 3300025913 | Bacteria | 1238 |
| 136 | Ga0207671_11112162 | 3300025914 | Bacteria | 620 |
| 137 | Ga0207693_10395443 | 3300025915 | Bacteria | 1081 |
| 138 | Ga0207660_11442562 | 3300025917 | Bacteria | 557 |
| 139 | Ga0207660_11675620 | 3300025917 | Bacteria | 512 |
| 140 | Ga0207657_10087753 | 3300025919 | Bacteria | 2602 |
| 141 | Ga0207649_10026891 | 3300025920 | Bacteria | 3371 |
| 142 | Ga0207649_10736532 | 3300025920 | Bacteria | 766 |
| 143 | Ga0207652_10511054 | 3300025921 | Bacteria | 1081 |
| 144 | Ga0207652_10755743 | 3300025921 | Bacteria | 865 |
| 145 | Ga0207681_10077129 | 3300025923 | Bacteria | 2342 |
| 146 | Ga0207694_10449384 | 3300025924 | Bacteria | 1076 |
| 147 | Ga0207650_11612676 | 3300025925 | Bacteria | 551 |
| 148 | Ga0207659_11357595 | 3300025926 | Bacteria | 610 |
| 149 | Ga0207670_10147234 | 3300025936 | Bacteria | 1743 |
| 150 | Ga0207669_10045815 | 3300025937 | Bacteria | 2580 |
| 151 | Ga0207665_10859682 | 3300025939 | Bacteria | 718 |
| 152 | Ga0207665_10986368 | 3300025939 | Bacteria | 670 |
| 153 | Ga0207691_10083208 | 3300025940 | Bacteria | 2873 |
| 154 | Ga0207691_10392907 | 3300025940 | Bacteria | 1183 |
| 155 | Ga0207691_10700999 | 3300025940 | Bacteria | 854 |
| 156 | Ga0207691_11653561 | 3300025940 | Unclassified | 519 |
| 157 | Ga0207711_11298628 | 3300025941 | Bacteria | 670 |
| 158 | Ga0207689_10582555 | 3300025942 | Bacteria | 941 |
| 159 | Ga0207661_10054953 | 3300025944 | Bacteria | 3191 |
| 160 | Ga0207679_10321353 | 3300025945 | Bacteria | 1340 |
| 161 | Ga0207667_10107430 | 3300025949 | Bacteria | 2879 |
| 162 | Ga0207667_11009149 | 3300025949 | Bacteria | 819 |
| 163 | Ga0207640_10307593 | 3300025981 | Bacteria | 1257 |
| 164 | Ga0207658_12039516 | 3300025986 | Unclassified | 522 |
| 165 | Ga0207677_10339206 | 3300026023 | Bacteria | 1255 |
| 166 | Ga0207703_10094542 | 3300026035 | Bacteria | 2520 |
| 167 | Ga0207703_11074308 | 3300026035 | Bacteria | 773 |
| 168 | Ga0207703_11432918 | 3300026035 | Bacteria | 664 |
| 169 | Ga0207678_10298440 | 3300026067 | Bacteria | 1384 |
| 170 | Ga0207678_10531236 | 3300026067 | Bacteria | 1027 |
| 171 | Ga0207708_10159293 | 3300026075 | Bacteria | 1782 |
| 172 | Ga0207702_10010788 | 3300026078 | Bacteria | 7625 |
| 173 | Ga0207702_10239346 | 3300026078 | Bacteria | 1700 |
| 174 | Ga0207648_10640913 | 3300026089 | Bacteria | 981 |
| 175 | Ga0207676_11178047 | 3300026095 | Bacteria | 759 |
| 176 | Ga0207674_10177820 | 3300026116 | Bacteria | 2080 |
| 177 | Ga0207674_10732444 | 3300026116 | Bacteria | 954 |
| 178 | Ga0207675_100502413 | 3300026118 | Bacteria | 1207 |
| 179 | Ga0207698_10030133 | 3300026142 | Bacteria | 3897 |
| 180 | Ga0209588_1144303 | 3300027671 | Bacteria | 756 |
| 181 | Ga0209813_10463767 | 3300027866 | Bacteria | 520 |
| 182 | Ga0268266_10191908 | 3300028379 | Bacteria | 1865 |
| 183 | Ga0268266_10315252 | 3300028379 | Bacteria | 1462 |
| 184 | Ga0268266_10976678 | 3300028379 | Bacteria | 819 |
| 185 | Ga0268265_10574124 | 3300028380 | Bacteria | 1074 |
| 186 | Ga0268265_10766257 | 3300028380 | Bacteria | 938 |
| 187 | Ga0265334_10005454 | 3300028573 | Bacteria | 5558 |
| 188 | Ga0307517_10000601 | 3300028786 | Bacteria | 61315 |
| 189 | Ga0265332_10417321 | 3300031238 | Bacteria | 554 |
| 190 | Ga0265340_10076407 | 3300031247 | Bacteria | 1582 |
| 191 | Ga0307513_10012672 | 3300031456 | Bacteria | 10386 |
| 192 | Ga0307416_100276946 | 3300032002 | Bacteria | 1652 |
| 193 | Ga0373930_0201259 | 3300034816 | Bacteria | 518 |
| 194 | Ga0373948_0045206 | 3300034817 | Bacteria | 933 |
| 195 | Ga0373934_0110037 | 3300035086 | Bacteria | 1117 |
| 196 | Ga0373934_0183056 | 3300035086 | Bacteria | 861 |
| 197 | Ga0373932_0048304 | 3300035112 | Bacteria | 1254 |
| 198 | Ga0373936_0484981 | 3300035113 | Bacteria | 574 |
| 199 | Ga0373939_0354510 | 3300035114 | Bacteria | 598 |
| 200 | Ga0373941_0179194 | 3300035115 | Bacteria | 794 |
| 201 | Ga0373945_0256320 | 3300035116 | Bacteria | 740 |
| 202 | Ga0373931_0422939 | 3300035691 | Bacteria | 847 |
| 203 | Ga0373933_0839889 | 3300035724 | Bacteria | 605 |
| 204 | Ga0373947_0754762 | 3300035725 | Bacteria | 664 |
| 205 | Ga0373937_0218966 | 3300036401 | Bacteria | 1792 |
| 206 | Ga0373925_0959760 | 3300037068 | Bacteria | 704 |
| 207 | Ga0395899_0001159 | 3300037312 | Bacteria | 23305 |
| 208 | Ga0395899_0011006 | 3300037312 | Bacteria | 6929 |
| 209 | Ga0395899_0092039 | 3300037312 | Bacteria | 2196 |
| 210 | Ga0395899_0184654 | 3300037312 | Bacteria | 1462 |
| 211 | Ga0395900_0004870 | 3300037418 | Bacteria | 14149 |
| 212 | Ga0395900_0007092 | 3300037418 | Bacteria | 11611 |
| 213 | Ga0395900_0007882 | 3300037418 | Bacteria | 10969 |
| 214 | Ga0395898_0002205 | 3300037466 | Bacteria | 23788 |
| 215 | Ga0395898_0002340 | 3300037466 | Bacteria | 22604 |
| 216 | Ga0395905_1317611 | 3300037471 | Bacteria | 626 |
| 217 | Ga0436364_0745629 | 3300037853 | Bacteria | 1190 |
| 218 | Ga0395901_0001255 | 3300038443 | Bacteria | 26957 |
| 219 | Ga0395901_0002098 | 3300038443 | Bacteria | 20468 |
| 220 | Ga0395901_0004054 | 3300038443 | Bacteria | 14749 |
| 221 | Ga0395901_0017180 | 3300038443 | Bacteria | 7380 |
| 222 | Ga0436365_0307354 | 3300039437 | Bacteria | 1398 |
| 223 | Ga0436360_0237038 | 3300039438 | Bacteria | 9324 |
| 224 | Ga0436360_0252721 | 3300039438 | Bacteria | 2766 |
| 225 | Ga0436360_0406036 | 3300039438 | Bacteria | 1323 |
| 226 | Ga0436361_0636899 | 3300039447 | Bacteria | 7700 |
| 227 | Ga0436362_0454534 | 3300039453 | Bacteria | 653 |
| 228 | Ga0436362_0719199 | 3300039453 | Bacteria | 560 |
| 229 | Ga0439465_0207042 | 3300041413 | Bacteria | 716 |
| 230 | Ga0439442_025710 | 3300042002 | Bacteria | 1225 |
| 231 | Ga0439448_0153673 | 3300042005 | Bacteria | 799 |
| 232 | Ga0466966_0705789 | 3300044684 | Bacteria | 608 |
| 233 | Ga0466963_0007691 | 3300044694 | Bacteria | 6436 |
| 234 | Ga0466964_0595821 | 3300044706 | Bacteria | 606 |
| 235 | Ga0466967_0031665 | 3300045976 | Bacteria | 4455 |
| 236 | Ga0495603_0359556 | 3300046455 | Bacteria | 835 |
| 237 | Ga0495668_0522327 | 3300046616 | Bacteria | 655 |
| 238 | Ga0495674_1378124 | 3300047319 | Bacteria | 526 |
| 239 | Ga0496104_1805022 | 3300048907 | Bacteria | 514 |
| 240 | Ga0496126_0035078 | 3300048929 | Bacteria | 4704 |
| 241 | Ga0501032_0406135 | 3300049569 | Bacteria | 875 |
| 242 | Ga0501033_0239388 | 3300049570 | Bacteria | 1288 |
| 243 | Ga0501033_0413160 | 3300049570 | Bacteria | 940 |
| 244 | Ga0501034_0004953 | 3300049571 | Bacteria | 14656 |
| 245 | Ga0501034_0008566 | 3300049571 | Bacteria | 10796 |
| 246 | Ga0501034_0189375 | 3300049571 | Bacteria | 2020 |
| 247 | Ga0501034_1234925 | 3300049571 | Bacteria | 625 |
| 248 | Ga0501036_0134376 | 3300049572 | Bacteria | 2088 |
| 249 | Ga0501037_0594414 | 3300049573 | Bacteria | 744 |
| 250 | Ga0501042_0501185 | 3300049578 | Bacteria | 882 |
| 251 | Ga0501068_0008913 | 3300049584 | Bacteria | 5599 |
| 252 | Ga0501070_0103425 | 3300049586 | Bacteria | 2355 |
| 253 | Ga0501070_0517929 | 3300049586 | Bacteria | 957 |
| 254 | Ga0501080_0939558 | 3300049742 | Bacteria | 752 |
| 255 | Ga0501044_0089596 | 3300049823 | Bacteria | 3105 |
| 256 | Ga0501044_0954440 | 3300049823 | Bacteria | 730 |
| 257 | nmdc:mga03683_162415_c1 | 3300050489 | Bacteria | 1012 |
| 258 | nmdc:mga03683_2387_c1 | 3300050489 | Bacteria | 4040 |
| 259 | nmdc:mga03683_463399_c1 | 3300050489 | Bacteria | 611 |
| 260 | nmdc:mga03683_86957_c1 | 3300050489 | Bacteria | 1358 |
| 261 | nmdc:mga03n38_433290_c1 | 3300050490 | Bacteria | 729 |
| 262 | nmdc:mga0yw44_35725_c1 | 3300050492 | Bacteria | 2923 |
| 263 | nmdc:mga0yw44_471641_c1 | 3300050492 | Bacteria | 851 |
| 264 | nmdc:mga0yw44_697398_c1 | 3300050492 | Bacteria | 690 |
| 265 | nmdc:mga0k408_135362_c1 | 3300050493 | Bacteria | 1464 |
| 266 | nmdc:mga0k408_414482_c1 | 3300050493 | Bacteria | 801 |
| 267 | nmdc:mga0k408_789448_c1 | 3300050493 | Bacteria | 554 |
| 268 | nmdc:mga06z11_40602_c1 | 3300050494 | Bacteria | 2323 |
| 269 | nmdc:mga06z11_413076_c1 | 3300050494 | Bacteria | 813 |
| 270 | nmdc:mga06z11_417315_c1 | 3300050494 | Bacteria | 809 |
| 271 | nmdc:mga04h51_430845_c1 | 3300050495 | Bacteria | 556 |
| 272 | nmdc:mga04h51_488141_c1 | 3300050495 | Bacteria | 525 |
| 273 | nmdc:mga07m45_49433_c1 | 3300050496 | Bacteria | 2367 |
| 274 | nmdc:mga07m45_61549_c1 | 3300050496 | Bacteria | 2126 |
| 275 | nmdc:mga08y16_1555986_c1 | 3300050511 | Bacteria | 620 |
| 276 | nmdc:mga08y16_333484_c1 | 3300050511 | Bacteria | 1560 |
| 277 | nmdc:mga08y16_748742_c1 | 3300050511 | Bacteria | 973 |
| 278 | nmdc:mga0sz30_140823_c1 | 3300050516 | Bacteria | 1065 |
| 279 | nmdc:mga0sz30_151_c1 | 3300050516 | Bacteria | 25783 |
| 280 | nmdc:mga0sz30_174485_c1 | 3300050516 | Bacteria | 953 |
| 281 | nmdc:mga0sz30_23802_c1 | 3300050516 | Bacteria | 2495 |
| 282 | Ga0500578_0769687 | 3300053086 | Unclassified | 512 |
| 283 | Ga0500644_0109310 | 3300053088 | Bacteria | 1063 |
| 284 | Ga0500651_0383345 | 3300053093 | Bacteria | 792 |
| 285 | Ga0500641_0002113 | 3300053096 | Bacteria | 7042 |
| 286 | Ga0500614_034093 | 3300053123 | Bacteria | 1262 |
| 287 | Ga0500658_0561900 | 3300053134 | Bacteria | 513 |
| 288 | Ga0500616_0000404 | 3300053153 | Bacteria | 59183 |
| 289 | Ga0500620_060701 | 3300053155 | Bacteria | 1286 |
| 290 | Ga0500552_000284 | 3300053733 | Bacteria | 4613 |
| 291 | Ga0587114_101437 | 3300059655 | Unclassified | 561 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_0719199 | Ga0436362_0719199_204_539 | 94 |
| 2 | 3300049586 | Ga0501070_0103425 | Ga0501070_0103425_2010_2345 | 100 |
| 3 | 3300013100 | Ga0157373_10106549 | Ga0157373_101065492 | 101 |
| 4 | 3300006358 | Ga0068871_101079346 | Ga0068871_1010793462 | 104 |
| 5 | 3300013306 | Ga0163162_10749908 | Ga0163162_107499082 | 104 |
| 6 | 3300049571 | Ga0501034_0189375 | Ga0501034_0189375_666_1052 | 104 |
| 7 | 3300050516 | nmdc:mga0sz30_174485_c1 | nmdc:mga0sz30_174485_c1_470_835 | 108 |
| 8 | 3300005334 | Ga0068869_101274616 | Ga0068869_1012746162 | 110 |
| 9 | 3300009098 | Ga0105245_11725028 | Ga0105245_117250281 | 111 |
| 10 | 3300025942 | Ga0207689_10582555 | Ga0207689_105825552 | 111 |
| 11 | 3300035113 | Ga0373936_0484981 | Ga0373936_0484981_88_483 | 111 |
| 12 | 3300050493 | nmdc:mga0k408_414482_c1 | nmdc:mga0k408_414482_c1_178_573 | 111 |
| 13 | 3300031238 | Ga0265332_10417321 | Ga0265332_104173212 | 113 |
| 14 | 3300053088 | Ga0500644_0109310 | Ga0500644_0109310_502_897 | 113 |
| 15 | 3300034816 | Ga0373930_0201259 | Ga0373930_0201259_69_449 | 116 |
| 16 | 3300035086 | Ga0373934_0183056 | Ga0373934_0183056_454_834 | 116 |
| 17 | 3300035725 | Ga0373947_0754762 | Ga0373947_0754762_86_466 | 116 |
| 18 | 3300036401 | Ga0373937_0218966 | Ga0373937_0218966_330_710 | 116 |
| 19 | 3300005347 | Ga0070668_100307984 | Ga0070668_1003079844 | 117 |
| 20 | 3300005328 | Ga0070676_10047758 | Ga0070676_100477583 | 118 |
| 21 | 3300005329 | Ga0070683_100054819 | Ga0070683_1000548193 | 118 |
| 22 | 3300005330 | Ga0070690_100193084 | Ga0070690_1001930842 | 118 |
| 23 | 3300005331 | Ga0070670_100676331 | Ga0070670_1006763312 | 118 |
| 24 | 3300005331 | Ga0070670_100784358 | Ga0070670_1007843582 | 118 |
| 25 | 3300005334 | Ga0068869_101628968 | Ga0068869_1016289682 | 118 |
| 26 | 3300005334 | Ga0068869_101685193 | Ga0068869_1016851931 | 118 |
| 27 | 3300005336 | Ga0070680_100466664 | Ga0070680_1004666642 | 118 |
| 28 | 3300005339 | Ga0070660_100237818 | Ga0070660_1002378183 | 118 |
| 29 | 3300005339 | Ga0070660_100519264 | Ga0070660_1005192641 | 118 |
| 30 | 3300005340 | Ga0070689_100124083 | Ga0070689_1001240831 | 118 |
| 31 | 3300005341 | Ga0070691_10005525 | Ga0070691_100055252 | 118 |
| 32 | 3300005344 | Ga0070661_100084578 | Ga0070661_1000845783 | 118 |
| 33 | 3300005354 | Ga0070675_100301946 | Ga0070675_1003019463 | 118 |
| 34 | 3300005354 | Ga0070675_101596123 | Ga0070675_1015961231 | 118 |
| 35 | 3300005354 | Ga0070675_101802304 | Ga0070675_1018023042 | 118 |
| 36 | 3300005356 | Ga0070674_100131425 | Ga0070674_1001314253 | 118 |
| 37 | 3300005434 | Ga0070709_10795058 | Ga0070709_107950582 | 118 |
| 38 | 3300005436 | Ga0070713_100014330 | Ga0070713_1000143309 | 118 |
| 39 | 3300005436 | Ga0070713_100674311 | Ga0070713_1006743111 | 118 |
| 40 | 3300005437 | Ga0070710_10130490 | Ga0070710_101304902 | 118 |
| 41 | 3300005441 | Ga0070700_100081853 | Ga0070700_1000818533 | 118 |
| 42 | 3300005445 | Ga0070708_100015005 | Ga0070708_1000150057 | 118 |
| 43 | 3300005445 | Ga0070708_100368624 | Ga0070708_1003686242 | 118 |
| 44 | 3300005455 | Ga0070663_100794962 | Ga0070663_1007949622 | 118 |
| 45 | 3300005455 | Ga0070663_101066618 | Ga0070663_1010666182 | 118 |
| 46 | 3300005458 | Ga0070681_10555644 | Ga0070681_105556442 | 118 |
| 47 | 3300005467 | Ga0070706_100087707 | Ga0070706_1000877074 | 118 |
| 48 | 3300005467 | Ga0070706_100538865 | Ga0070706_1005388652 | 118 |
| 49 | 3300005471 | Ga0070698_100001894 | Ga0070698_10000189411 | 118 |
| 50 | 3300005518 | Ga0070699_100039020 | Ga0070699_1000390204 | 118 |
| 51 | 3300005518 | Ga0070699_100638296 | Ga0070699_1006382962 | 118 |
| 52 | 3300005530 | Ga0070679_100195382 | Ga0070679_1001953823 | 118 |
| 53 | 3300005535 | Ga0070684_100059203 | Ga0070684_1000592034 | 118 |
| 54 | 3300005536 | Ga0070697_100040877 | Ga0070697_1000408774 | 118 |
| 55 | 3300005539 | Ga0068853_100439525 | Ga0068853_1004395251 | 118 |
| 56 | 3300005543 | Ga0070672_100276773 | Ga0070672_1002767732 | 118 |
| 57 | 3300005548 | Ga0070665_100099278 | Ga0070665_1000992782 | 118 |
| 58 | 3300005548 | Ga0070665_100313182 | Ga0070665_1003131822 | 118 |
| 59 | 3300005548 | Ga0070665_101232440 | Ga0070665_1012324401 | 118 |
| 60 | 3300005548 | Ga0070665_101775183 | Ga0070665_1017751832 | 118 |
| 61 | 3300005563 | Ga0068855_100450524 | Ga0068855_1004505242 | 118 |
| 62 | 3300005577 | Ga0068857_100068776 | Ga0068857_1000687763 | 118 |
| 63 | 3300005578 | Ga0068854_100518245 | Ga0068854_1005182451 | 118 |
| 64 | 3300005614 | Ga0068856_100007916 | Ga0068856_1000079167 | 118 |
| 65 | 3300005614 | Ga0068856_101675703 | Ga0068856_1016757032 | 118 |
| 66 | 3300005616 | Ga0068852_100016405 | Ga0068852_1000164053 | 118 |
| 67 | 3300005616 | Ga0068852_102464209 | Ga0068852_1024642092 | 118 |
| 68 | 3300005719 | Ga0068861_101168054 | Ga0068861_1011680542 | 118 |
| 69 | 3300005842 | Ga0068858_100313343 | Ga0068858_1003133432 | 118 |
| 70 | 3300005842 | Ga0068858_100425722 | Ga0068858_1004257222 | 118 |
| 71 | 3300005842 | Ga0068858_102306666 | Ga0068858_1023066661 | 118 |
| 72 | 3300005844 | Ga0068862_100814533 | Ga0068862_1008145332 | 118 |
| 73 | 3300005844 | Ga0068862_100933679 | Ga0068862_1009336791 | 118 |
| 74 | 3300005937 | Ga0081455_10000370 | Ga0081455_1000037034 | 118 |
| 75 | 3300005937 | Ga0081455_10048684 | Ga0081455_100486843 | 118 |
| 76 | 3300005937 | Ga0081455_10737712 | Ga0081455_107377121 | 118 |
| 77 | 3300005985 | Ga0081539_10001490 | Ga0081539_1000149031 | 118 |
| 78 | 3300005985 | Ga0081539_10010310 | Ga0081539_100103107 | 118 |
| 79 | 3300006038 | Ga0075365_10095142 | Ga0075365_100951423 | 118 |
| 80 | 3300006038 | Ga0075365_10311465 | Ga0075365_103114652 | 118 |
| 81 | 3300006038 | Ga0075365_10989778 | Ga0075365_109897782 | 118 |
| 82 | 3300006042 | Ga0075368_10304813 | Ga0075368_103048131 | 118 |
| 83 | 3300006051 | Ga0075364_10133572 | Ga0075364_101335722 | 118 |
| 84 | 3300006051 | Ga0075364_10362908 | Ga0075364_103629082 | 118 |
| 85 | 3300006163 | Ga0070715_10088287 | Ga0070715_100882872 | 118 |
| 86 | 3300006173 | Ga0070716_100625938 | Ga0070716_1006259382 | 118 |
| 87 | 3300006175 | Ga0070712_100801783 | Ga0070712_1008017832 | 118 |
| 88 | 3300006177 | Ga0075362_10009303 | Ga0075362_100093034 | 118 |
| 89 | 3300006177 | Ga0075362_10075910 | Ga0075362_100759102 | 118 |
| 90 | 3300006177 | Ga0075362_10104260 | Ga0075362_101042603 | 118 |
| 91 | 3300006177 | Ga0075362_10271696 | Ga0075362_102716961 | 118 |
| 92 | 3300006177 | Ga0075362_10386412 | Ga0075362_103864121 | 118 |
| 93 | 3300006178 | Ga0075367_10010911 | Ga0075367_100109115 | 118 |
| 94 | 3300006178 | Ga0075367_10102262 | Ga0075367_101022622 | 118 |
| 95 | 3300006178 | Ga0075367_10342660 | Ga0075367_103426602 | 118 |
| 96 | 3300006178 | Ga0075367_10426499 | Ga0075367_104264991 | 118 |
| 97 | 3300006186 | Ga0075369_10005323 | Ga0075369_100053234 | 118 |
| 98 | 3300006186 | Ga0075369_10038653 | Ga0075369_100386532 | 118 |
| 99 | 3300006195 | Ga0075366_10092549 | Ga0075366_100925493 | 118 |
| 100 | 3300006195 | Ga0075366_10507569 | Ga0075366_105075692 | 118 |
| 101 | 3300006353 | Ga0075370_10053029 | Ga0075370_100530293 | 118 |
| 102 | 3300006353 | Ga0075370_10056983 | Ga0075370_100569834 | 118 |
| 103 | 3300006358 | Ga0068871_100306182 | Ga0068871_1003061822 | 118 |
| 104 | 3300006358 | Ga0068871_102199582 | Ga0068871_1021995821 | 118 |
| 105 | 3300006844 | Ga0075428_101760389 | Ga0075428_1017603892 | 118 |
| 106 | 3300007265 | Ga0099794_10024507 | Ga0099794_100245073 | 118 |
| 107 | 3300007265 | Ga0099794_10085971 | Ga0099794_100859712 | 118 |
| 108 | 3300009093 | Ga0105240_10117741 | Ga0105240_101177411 | 118 |
| 109 | 3300009093 | Ga0105240_10172639 | Ga0105240_101726393 | 118 |
| 110 | 3300009094 | Ga0111539_11019242 | Ga0111539_110192421 | 118 |
| 111 | 3300009094 | Ga0111539_11019520 | Ga0111539_110195201 | 118 |
| 112 | 3300009094 | Ga0111539_12013273 | Ga0111539_120132732 | 118 |
| 113 | 3300009101 | Ga0105247_10526882 | Ga0105247_105268822 | 118 |
| 114 | 3300009148 | Ga0105243_10781603 | Ga0105243_107816032 | 118 |
| 115 | 3300009174 | Ga0105241_11367781 | Ga0105241_113677812 | 118 |
| 116 | 3300009174 | Ga0105241_11820339 | Ga0105241_118203392 | 118 |
| 117 | 3300009177 | Ga0105248_10638210 | Ga0105248_106382102 | 118 |
| 118 | 3300009545 | Ga0105237_11092011 | Ga0105237_110920112 | 118 |
| 119 | 3300009551 | Ga0105238_10642095 | Ga0105238_106420952 | 118 |
| 120 | 3300009551 | Ga0105238_10935321 | Ga0105238_109353211 | 118 |
| 121 | 3300009553 | Ga0105249_11197926 | Ga0105249_111979262 | 118 |
| 122 | 3300009987 | Ga0105030_111097 | Ga0105030_1110972 | 118 |
| 123 | 3300009988 | Ga0105035_120051 | Ga0105035_1200511 | 118 |
| 124 | 3300009988 | Ga0105035_123353 | Ga0105035_1233531 | 118 |
| 125 | 3300010375 | Ga0105239_10019175 | Ga0105239_100191756 | 118 |
| 126 | 3300010375 | Ga0105239_13386324 | Ga0105239_133863241 | 118 |
| 127 | 3300013102 | Ga0157371_10141725 | Ga0157371_101417252 | 118 |
| 128 | 3300013105 | Ga0157369_10472641 | Ga0157369_104726412 | 118 |
| 129 | 3300013308 | Ga0157375_10986332 | Ga0157375_109863322 | 118 |
| 130 | 3300013875 | Ga0157515_120493 | Ga0157515_1204932 | 118 |
| 131 | 3300014325 | Ga0163163_11469358 | Ga0163163_114693581 | 118 |
| 132 | 3300014969 | Ga0157376_10134516 | Ga0157376_101345162 | 118 |
| 133 | 3300021361 | Ga0213872_10430834 | Ga0213872_104308342 | 118 |
| 134 | 3300021441 | Ga0213871_10001616 | Ga0213871_100016162 | 118 |
| 135 | 3300025292 | Ga0209676_1057353 | Ga0209676_10573532 | 118 |
| 136 | 3300025298 | Ga0209050_1063468 | Ga0209050_10634682 | 118 |
| 137 | 3300025302 | Ga0207426_1006049 | Ga0207426_10060494 | 118 |
| 138 | 3300025302 | Ga0207426_1055870 | Ga0207426_10558702 | 118 |
| 139 | 3300025898 | Ga0207692_10216335 | Ga0207692_102163352 | 118 |
| 140 | 3300025903 | Ga0207680_10680928 | Ga0207680_106809282 | 118 |
| 141 | 3300025906 | Ga0207699_10738844 | Ga0207699_107388442 | 118 |
| 142 | 3300025907 | Ga0207645_10063123 | Ga0207645_100631233 | 118 |
| 143 | 3300025908 | Ga0207643_10356982 | Ga0207643_103569822 | 118 |
| 144 | 3300025910 | Ga0207684_10082525 | Ga0207684_100825253 | 118 |
| 145 | 3300025912 | Ga0207707_10022121 | Ga0207707_100221213 | 118 |
| 146 | 3300025912 | Ga0207707_10966764 | Ga0207707_109667642 | 118 |
| 147 | 3300025913 | Ga0207695_10284512 | Ga0207695_102845123 | 118 |
| 148 | 3300025913 | Ga0207695_10410901 | Ga0207695_104109012 | 118 |
| 149 | 3300025914 | Ga0207671_11112162 | Ga0207671_111121622 | 118 |
| 150 | 3300025915 | Ga0207693_10395443 | Ga0207693_103954432 | 118 |
| 151 | 3300025917 | Ga0207660_11442562 | Ga0207660_114425621 | 118 |
| 152 | 3300025917 | Ga0207660_11675620 | Ga0207660_116756201 | 118 |
| 153 | 3300025919 | Ga0207657_10087753 | Ga0207657_100877533 | 118 |
| 154 | 3300025920 | Ga0207649_10026891 | Ga0207649_100268912 | 118 |
| 155 | 3300025920 | Ga0207649_10736532 | Ga0207649_107365321 | 118 |
| 156 | 3300025921 | Ga0207652_10511054 | Ga0207652_105110541 | 118 |
| 157 | 3300025921 | Ga0207652_10755743 | Ga0207652_107557432 | 118 |
| 158 | 3300025923 | Ga0207681_10077129 | Ga0207681_100771292 | 118 |
| 159 | 3300025924 | Ga0207694_10449384 | Ga0207694_104493842 | 118 |
| 160 | 3300025925 | Ga0207650_11612676 | Ga0207650_116126761 | 118 |
| 161 | 3300025926 | Ga0207659_11357595 | Ga0207659_113575951 | 118 |
| 162 | 3300025936 | Ga0207670_10147234 | Ga0207670_101472341 | 118 |
| 163 | 3300025937 | Ga0207669_10045815 | Ga0207669_100458152 | 118 |
| 164 | 3300025939 | Ga0207665_10859682 | Ga0207665_108596822 | 118 |
| 165 | 3300025939 | Ga0207665_10986368 | Ga0207665_109863682 | 118 |
| 166 | 3300025940 | Ga0207691_10083208 | Ga0207691_100832082 | 118 |
| 167 | 3300025940 | Ga0207691_10392907 | Ga0207691_103929072 | 118 |
| 168 | 3300025940 | Ga0207691_10700999 | Ga0207691_107009991 | 118 |
| 169 | 3300025940 | Ga0207691_11653561 | Ga0207691_116535611 | 118 |
| 170 | 3300025941 | Ga0207711_11298628 | Ga0207711_112986281 | 118 |
| 171 | 3300025944 | Ga0207661_10054953 | Ga0207661_100549533 | 118 |
| 172 | 3300025945 | Ga0207679_10321353 | Ga0207679_103213532 | 118 |
| 173 | 3300025949 | Ga0207667_10107430 | Ga0207667_101074302 | 118 |
| 174 | 3300025949 | Ga0207667_11009149 | Ga0207667_110091492 | 118 |
| 175 | 3300025981 | Ga0207640_10307593 | Ga0207640_103075932 | 118 |
| 176 | 3300025986 | Ga0207658_12039516 | Ga0207658_120395161 | 118 |
| 177 | 3300026023 | Ga0207677_10339206 | Ga0207677_103392061 | 118 |
| 178 | 3300026035 | Ga0207703_10094542 | Ga0207703_100945423 | 118 |
| 179 | 3300026035 | Ga0207703_11074308 | Ga0207703_110743081 | 118 |
| 180 | 3300026035 | Ga0207703_11432918 | Ga0207703_114329181 | 118 |
| 181 | 3300026067 | Ga0207678_10298440 | Ga0207678_102984402 | 118 |
| 182 | 3300026067 | Ga0207678_10531236 | Ga0207678_105312361 | 118 |
| 183 | 3300026075 | Ga0207708_10159293 | Ga0207708_101592932 | 118 |
| 184 | 3300026078 | Ga0207702_10010788 | Ga0207702_100107883 | 118 |
| 185 | 3300026078 | Ga0207702_10239346 | Ga0207702_102393462 | 118 |
| 186 | 3300026089 | Ga0207648_10640913 | Ga0207648_106409132 | 118 |
| 187 | 3300026095 | Ga0207676_11178047 | Ga0207676_111780472 | 118 |
| 188 | 3300026116 | Ga0207674_10177820 | Ga0207674_101778201 | 118 |
| 189 | 3300026116 | Ga0207674_10732444 | Ga0207674_107324442 | 118 |
| 190 | 3300026118 | Ga0207675_100502413 | Ga0207675_1005024132 | 118 |
| 191 | 3300026142 | Ga0207698_10030133 | Ga0207698_100301332 | 118 |
| 192 | 3300027671 | Ga0209588_1144303 | Ga0209588_11443032 | 118 |
| 193 | 3300027866 | Ga0209813_10463767 | Ga0209813_104637671 | 118 |
| 194 | 3300028379 | Ga0268266_10191908 | Ga0268266_101919083 | 118 |
| 195 | 3300028379 | Ga0268266_10315252 | Ga0268266_103152523 | 118 |
| 196 | 3300028379 | Ga0268266_10976678 | Ga0268266_109766782 | 118 |
| 197 | 3300028380 | Ga0268265_10574124 | Ga0268265_105741242 | 118 |
| 198 | 3300028380 | Ga0268265_10766257 | Ga0268265_107662571 | 118 |
| 199 | 3300028573 | Ga0265334_10005454 | Ga0265334_1000545410 | 118 |
| 200 | 3300028786 | Ga0307517_10000601 | Ga0307517_1000060149 | 118 |
| 201 | 3300031247 | Ga0265340_10076407 | Ga0265340_100764073 | 118 |
| 202 | 3300031456 | Ga0307513_10012672 | Ga0307513_100126723 | 118 |
| 203 | 3300032002 | Ga0307416_100276946 | Ga0307416_1002769462 | 118 |
| 204 | 3300034817 | Ga0373948_0045206 | Ga0373948_0045206_385_780 | 118 |
| 205 | 3300035086 | Ga0373934_0110037 | Ga0373934_0110037_108_494 | 118 |
| 206 | 3300035112 | Ga0373932_0048304 | Ga0373932_0048304_489_884 | 118 |
| 207 | 3300035114 | Ga0373939_0354510 | Ga0373939_0354510_99_488 | 118 |
| 208 | 3300035115 | Ga0373941_0179194 | Ga0373941_0179194_187_576 | 118 |
| 209 | 3300035116 | Ga0373945_0256320 | Ga0373945_0256320_273_668 | 118 |
| 210 | 3300035691 | Ga0373931_0422939 | Ga0373931_0422939_190_585 | 118 |
| 211 | 3300035724 | Ga0373933_0839889 | Ga0373933_0839889_148_543 | 118 |
| 212 | 3300037068 | Ga0373925_0959760 | Ga0373925_0959760_172_558 | 118 |
| 213 | 3300037312 | Ga0395899_0001159 | Ga0395899_0001159_15923_16309 | 118 |
| 214 | 3300037312 | Ga0395899_0011006 | Ga0395899_0011006_5134_5520 | 118 |
| 215 | 3300037312 | Ga0395899_0092039 | Ga0395899_0092039_826_1212 | 118 |
| 216 | 3300037312 | Ga0395899_0184654 | Ga0395899_0184654_309_695 | 118 |
| 217 | 3300037418 | Ga0395900_0004870 | Ga0395900_0004870_10032_10418 | 118 |
| 218 | 3300037418 | Ga0395900_0007092 | Ga0395900_0007092_7062_7448 | 118 |
| 219 | 3300037418 | Ga0395900_0007882 | Ga0395900_0007882_10091_10477 | 118 |
| 220 | 3300037466 | Ga0395898_0002205 | Ga0395898_0002205_10630_11016 | 118 |
| 221 | 3300037466 | Ga0395898_0002340 | Ga0395898_0002340_14061_14447 | 118 |
| 222 | 3300037471 | Ga0395905_1317611 | Ga0395905_1317611_86_472 | 118 |
| 223 | 3300037853 | Ga0436364_0745629 | Ga0436364_0745629_752_1138 | 118 |
| 224 | 3300038443 | Ga0395901_0001255 | Ga0395901_0001255_12037_12423 | 118 |
| 225 | 3300038443 | Ga0395901_0002098 | Ga0395901_0002098_16179_16565 | 118 |
| 226 | 3300038443 | Ga0395901_0004054 | Ga0395901_0004054_7308_7694 | 118 |
| 227 | 3300038443 | Ga0395901_0017180 | Ga0395901_0017180_1499_1885 | 118 |
| 228 | 3300039437 | Ga0436365_0307354 | Ga0436365_0307354_178_564 | 118 |
| 229 | 3300039438 | Ga0436360_0237038 | Ga0436360_0237038_7079_7465 | 118 |
| 230 | 3300039438 | Ga0436360_0252721 | Ga0436360_0252721_1868_2254 | 118 |
| 231 | 3300039438 | Ga0436360_0406036 | Ga0436360_0406036_229_705 | 118 |
| 232 | 3300039447 | Ga0436361_0636899 | Ga0436361_0636899_5098_5484 | 118 |
| 233 | 3300039453 | Ga0436362_0454534 | Ga0436362_0454534_164_550 | 118 |
| 234 | 3300041413 | Ga0439465_0207042 | Ga0439465_0207042_142_537 | 118 |
| 235 | 3300042002 | Ga0439442_025710 | Ga0439442_025710_126_515 | 118 |
| 236 | 3300042005 | Ga0439448_0153673 | Ga0439448_0153673_86_472 | 118 |
| 237 | 3300044684 | Ga0466966_0705789 | Ga0466966_0705789_114_500 | 118 |
| 238 | 3300044694 | Ga0466963_0007691 | Ga0466963_0007691_1995_2381 | 118 |
| 239 | 3300044706 | Ga0466964_0595821 | Ga0466964_0595821_116_502 | 118 |
| 240 | 3300045976 | Ga0466967_0031665 | Ga0466967_0031665_188_574 | 118 |
| 241 | 3300046455 | Ga0495603_0359556 | Ga0495603_0359556_378_773 | 118 |
| 242 | 3300046616 | Ga0495668_0522327 | Ga0495668_0522327_14_409 | 118 |
| 243 | 3300047319 | Ga0495674_1378124 | Ga0495674_1378124_65_460 | 118 |
| 244 | 3300048907 | Ga0496104_1805022 | Ga0496104_1805022_91_477 | 118 |
| 245 | 3300048929 | Ga0496126_0035078 | Ga0496126_0035078_4159_4566 | 118 |
| 246 | 3300049569 | Ga0501032_0406135 | Ga0501032_0406135_459_854 | 118 |
| 247 | 3300049570 | Ga0501033_0239388 | Ga0501033_0239388_75_461 | 118 |
| 248 | 3300049570 | Ga0501033_0413160 | Ga0501033_0413160_285_674 | 118 |
| 249 | 3300049571 | Ga0501034_0004953 | Ga0501034_0004953_2110_2499 | 118 |
| 250 | 3300049571 | Ga0501034_0008566 | Ga0501034_0008566_2437_2826 | 118 |
| 251 | 3300049571 | Ga0501034_1234925 | Ga0501034_1234925_31_417 | 118 |
| 252 | 3300049572 | Ga0501036_0134376 | Ga0501036_0134376_75_461 | 118 |
| 253 | 3300049573 | Ga0501037_0594414 | Ga0501037_0594414_295_681 | 118 |
| 254 | 3300049578 | Ga0501042_0501185 | Ga0501042_0501185_359_754 | 118 |
| 255 | 3300049584 | Ga0501068_0008913 | Ga0501068_0008913_2031_2420 | 118 |
| 256 | 3300049586 | Ga0501070_0517929 | Ga0501070_0517929_427_813 | 118 |
| 257 | 3300049742 | Ga0501080_0939558 | Ga0501080_0939558_314_700 | 118 |
| 258 | 3300049823 | Ga0501044_0089596 | Ga0501044_0089596_2136_2525 | 118 |
| 259 | 3300049823 | Ga0501044_0954440 | Ga0501044_0954440_167_553 | 118 |
| 260 | 3300050489 | nmdc:mga03683_162415_c1 | nmdc:mga03683_162415_c1_363_758 | 118 |
| 261 | 3300050489 | nmdc:mga03683_2387_c1 | nmdc:mga03683_2387_c1_768_1163 | 118 |
| 262 | 3300050489 | nmdc:mga03683_463399_c1 | nmdc:mga03683_463399_c1_177_563 | 118 |
| 263 | 3300050489 | nmdc:mga03683_86957_c1 | nmdc:mga03683_86957_c1_205_600 | 118 |
| 264 | 3300050490 | nmdc:mga03n38_433290_c1 | nmdc:mga03n38_433290_c1_124_519 | 118 |
| 265 | 3300050492 | nmdc:mga0yw44_35725_c1 | nmdc:mga0yw44_35725_c1_1129_1524 | 118 |
| 266 | 3300050492 | nmdc:mga0yw44_471641_c1 | nmdc:mga0yw44_471641_c1_338_733 | 118 |
| 267 | 3300050492 | nmdc:mga0yw44_697398_c1 | nmdc:mga0yw44_697398_c1_87_482 | 118 |
| 268 | 3300050493 | nmdc:mga0k408_135362_c1 | nmdc:mga0k408_135362_c1_1036_1431 | 118 |
| 269 | 3300050493 | nmdc:mga0k408_789448_c1 | nmdc:mga0k408_789448_c1_77_463 | 118 |
| 270 | 3300050494 | nmdc:mga06z11_40602_c1 | nmdc:mga06z11_40602_c1_1072_1467 | 118 |
| 271 | 3300050494 | nmdc:mga06z11_413076_c1 | nmdc:mga06z11_413076_c1_133_528 | 118 |
| 272 | 3300050494 | nmdc:mga06z11_417315_c1 | nmdc:mga06z11_417315_c1_394_789 | 118 |
| 273 | 3300050495 | nmdc:mga04h51_430845_c1 | nmdc:mga04h51_430845_c1_30_425 | 118 |
| 274 | 3300050495 | nmdc:mga04h51_488141_c1 | nmdc:mga04h51_488141_c1_82_468 | 118 |
| 275 | 3300050496 | nmdc:mga07m45_49433_c1 | nmdc:mga07m45_49433_c1_1581_1976 | 118 |
| 276 | 3300050496 | nmdc:mga07m45_61549_c1 | nmdc:mga07m45_61549_c1_229_624 | 118 |
| 277 | 3300050511 | nmdc:mga08y16_1555986_c1 | nmdc:mga08y16_1555986_c1_16_405 | 118 |
| 278 | 3300050511 | nmdc:mga08y16_333484_c1 | nmdc:mga08y16_333484_c1_1144_1539 | 118 |
| 279 | 3300050511 | nmdc:mga08y16_748742_c1 | nmdc:mga08y16_748742_c1_464_853 | 118 |
| 280 | 3300050516 | nmdc:mga0sz30_140823_c1 | nmdc:mga0sz30_140823_c1_463_858 | 118 |
| 281 | 3300050516 | nmdc:mga0sz30_151_c1 | nmdc:mga0sz30_151_c1_3266_3661 | 118 |
| 282 | 3300050516 | nmdc:mga0sz30_23802_c1 | nmdc:mga0sz30_23802_c1_400_795 | 118 |
| 283 | 3300053086 | Ga0500578_0769687 | Ga0500578_0769687_80_475 | 118 |
| 284 | 3300053093 | Ga0500651_0383345 | Ga0500651_0383345_93_488 | 118 |
| 285 | 3300053096 | Ga0500641_0002113 | Ga0500641_0002113_3669_4064 | 118 |
| 286 | 3300053123 | Ga0500614_034093 | Ga0500614_034093_643_1038 | 118 |
| 287 | 3300053134 | Ga0500658_0561900 | Ga0500658_0561900_38_424 | 118 |
| 288 | 3300053153 | Ga0500616_0000404 | Ga0500616_0000404_20214_20609 | 118 |
| 289 | 3300053155 | Ga0500620_060701 | Ga0500620_060701_367_762 | 118 |
| 290 | 3300053733 | Ga0500552_000284 | Ga0500552_000284_1747_2142 | 118 |
| 291 | 3300059655 | Ga0587114_101437 | Ga0587114_101437_56_442 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ntb-assembly1.cif.gz_A | mus musculus ltc4 synthase in gsh complex form | 0.7634 | 2 | 104 |
| 4jrz-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7441 | 2 | 102 |
| 3hkk-assembly1.cif.gz_A | structure of human leukotriene c4 synthase in complex with glutathione sulfonate | 0.7396 | 2 | 104 |
| 6r7d-assembly3.cif.gz_H | crystal structure of ltc4s in complex with az13690257 | 0.7336 | 2 | 102 |
| 4j7t-assembly1.cif.gz_A | human ltc4 synthase in complex with product analogs - implications for enzyme catalysis | 0.7121 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P10620_2_155_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8112 | 3 | 106 | 1.20.120.550 |
| af_B0R1E9_1_152_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.797 | 3 | 106 | 1.20.120.550 |
| af_Q54GA9_9_148_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7513 | 1 | 101 | 1.20.120.550 |
| 4jrzA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7441 | 2 | 102 | 1.20.120.550 |
| af_Q86B54_20_166_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7408 | 1 | 106 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A7MCA7-F1-model_v4 | MAPEG family protein | 0.9569 | 1 | 111 |
GO:0016020
|
| AF-A8TT19-F1-model_v4 | Glycine dehydrogenase (EC 1.4.4.2) | 0.9567 | 1 | 101 |
GO:0004375
GO:0016020 |
| AF-A0A7Y8SY30-F1-model_v4 | MAPEG family protein | 0.954 | 1 | 106 |
GO:0016020
|
| AF-A0A1G2X547-F1-model_v4 | deleted | 0.948 | 1 | 106 |
|
| AF-A0A7C2R8R0-F1-model_v4 | MAPEG family protein | 0.9453 | 1 | 110 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar