F390522

General Info

Members Datasets Scaffolds Average Seq Length
291 201 582 124

Family's Representative Sequence

Representative Sequence 3300046500|Ga0495596_0096488|Ga0495596_0096488_110_559
Length 149
Sequence MRSTVAAGRSGVCAMPHAGGRFPRMKPRLDHVGLDVSDYDVSRSFYEKALAPLGMRLMMEPVAEVGGFGDDFPFFWIARRERGPDSGVHVAIRTEARETVDAFHAAALAAGGTDNGGPGVREIYHPHYYGAFVLDPDGNNVEAVCHTPQ

Samples

Sample ID Description Type Environment
1 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
71 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
85 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
104 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
105 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
106 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
199 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
200 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
201 2851153111 Caulobacter radicis 736 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.69
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.84
Nodule 0
Rhizoplane 12.03
Rhizosphere 77.32
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495596_0096488 3300046500 Bacteria 1148
2 JGI25406J46586_10033766 3300003203 Bacteria 1885
3 rootH1_10022723 3300003323 Bacteria 2434
4 Ga0070683_100003014 3300005329 Bacteria 13523
5 Ga0070680_101087602 3300005336 Bacteria 691
6 Ga0070667_101138521 3300005367 Bacteria 730
7 Ga0070710_10068263 3300005437 Bacteria 2042
8 Ga0070710_10285872 3300005437 Bacteria 1072
9 Ga0070663_100764759 3300005455 Bacteria 826
10 Ga0070678_100456071 3300005456 Bacteria 1120
11 Ga0070662_100795211 3300005457 Bacteria 804
12 Ga0070681_10198186 3300005458 Bacteria 1926
13 Ga0070679_100113248 3300005530 Bacteria 2698
14 Ga0070684_100054191 3300005535 Bacteria 3494
15 Ga0070684_101134094 3300005535 Bacteria 735
16 Ga0070665_100093872 3300005548 Bacteria 3005
17 Ga0070665_100396919 3300005548 Bacteria 1387
18 Ga0068863_100123861 3300005841 Bacteria 2466
19 Ga0068858_100016645 3300005842 Bacteria 6905
20 Ga0068858_100018441 3300005842 Bacteria 6534
21 Ga0068858_100538818 3300005842 Bacteria 1130
22 Ga0068858_101291070 3300005842 Bacteria 718
23 Ga0081455_10560426 3300005937 Bacteria 753
24 Ga0081538_10001765 3300005981 Bacteria 21875
25 Ga0081538_10052063 3300005981 Bacteria 2450
26 Ga0081539_10001657 3300005985 Bacteria 36110
27 Ga0075365_10097115 3300006038 Bacteria 2013
28 Ga0075365_10185024 3300006038 Bacteria 1457
29 Ga0075363_100316260 3300006048 Bacteria 908
30 Ga0075364_10374852 3300006051 Bacteria 971
31 Ga0075428_100169977 3300006844 Bacteria 2363
32 Ga0075428_100447511 3300006844 Bacteria 1384
33 Ga0075428_101585578 3300006844 Bacteria 685
34 Ga0075430_100037997 3300006846 Bacteria 4080
35 Ga0075430_100149895 3300006846 Bacteria 1942
36 Ga0075430_100565547 3300006846 Bacteria 938
37 Ga0075431_100009364 3300006847 Bacteria 9831
38 Ga0075431_100437564 3300006847 Bacteria 1305
39 Ga0075429_100010944 3300006880 Bacteria 7849
40 Ga0075429_101431446 3300006880 Bacteria 602
41 Ga0111539_10010446 3300009094 Bacteria 11685
42 Ga0111539_10809506 3300009094 Bacteria 1090
43 Ga0111539_11662719 3300009094 Bacteria 740
44 Ga0105245_11337677 3300009098 Bacteria 766
45 Ga0105247_10008162 3300009101 Bacteria 6394
46 Ga0105247_10414230 3300009101 Bacteria 963
47 Ga0114129_10044167 3300009147 Bacteria 6269
48 Ga0114129_10068671 3300009147 Bacteria 4941
49 Ga0114129_10164506 3300009147 Bacteria 3029
50 Ga0114129_12327225 3300009147 Bacteria 643
51 Ga0105243_10809799 3300009148 Bacteria 924
52 Ga0105243_11107674 3300009148 Bacteria 800
53 Ga0105243_12719516 3300009148 Bacteria 535
54 Ga0105248_10196370 3300009177 Bacteria 2274
55 Ga0105248_11530556 3300009177 Bacteria 755
56 Ga0105238_10207885 3300009551 Bacteria 1933
57 Ga0105249_11123900 3300009553 Bacteria 856
58 Ga0105239_10844285 3300010375 Bacteria 1050
59 Ga0105246_10472777 3300011119 Bacteria 1058
60 Ga0105246_11275134 3300011119 Bacteria 680
61 Ga0157369_10795607 3300013105 Bacteria 972
62 Ga0163162_10350300 3300013306 Bacteria 1609
63 Ga0157372_11154318 3300013307 Bacteria 896
64 Ga0157375_11402245 3300013308 Bacteria 823
65 Ga0163163_10013861 3300014325 Bacteria 7393
66 Ga0163163_10576888 3300014325 Bacteria 1188
67 Ga0163163_10838794 3300014325 Bacteria 982
68 Ga0157379_10139442 3300014968 Bacteria 2185
69 Ga0206354_10450254 3300020081 Bacteria 3988
70 Ga0206353_11136636 3300020082 Bacteria 4942
71 Ga0209130_1041495 3300025284 Bacteria 885
72 Ga0209256_1014557 3300025299 Bacteria 2821
73 Ga0207707_11202598 3300025912 Bacteria 613
74 Ga0207663_10153380 3300025916 Bacteria 1618
75 Ga0207660_10707403 3300025917 Bacteria 822
76 Ga0207652_10086115 3300025921 Bacteria 2755
77 Ga0207659_11864324 3300025926 Bacteria 510
78 Ga0207687_10719193 3300025927 Bacteria 848
79 Ga0207664_11952360 3300025929 Bacteria 510
80 Ga0207709_10129693 3300025935 Bacteria 1716
81 Ga0207704_11283327 3300025938 Bacteria 626
82 Ga0207711_10203637 3300025941 Bacteria 1807
83 Ga0207661_10452664 3300025944 Unclassified 1169
84 Ga0207712_11005310 3300025961 Bacteria 740
85 Ga0207668_10357019 3300025972 Bacteria 1224
86 Ga0207668_11793655 3300025972 Bacteria 554
87 Ga0207658_11386081 3300025986 Bacteria 643
88 Ga0207677_11127225 3300026023 Bacteria 716
89 Ga0207703_10025851 3300026035 Bacteria 4620
90 Ga0207703_10291450 3300026035 Bacteria 1485
91 Ga0207678_10697486 3300026067 Bacteria 893
92 Ga0207641_10251944 3300026088 Bacteria 1649
93 Ga0207641_10825195 3300026088 Bacteria 918
94 Ga0207641_11767766 3300026088 Bacteria 620
95 Ga0207683_10421631 3300026121 Bacteria 1229
96 Ga0268266_10109945 3300028379 Bacteria 2441
97 Ga0268266_10387623 3300028379 Bacteria 1319
98 Ga0268266_11323978 3300028379 Bacteria 696
99 Ga0268266_11583585 3300028379 Bacteria 631
100 Ga0265337_1002550 3300028556 Bacteria 8293
101 Ga0265319_1004346 3300028563 Bacteria 7032
102 Ga0265334_10022455 3300028573 Bacteria 2570
103 Ga0265318_10002255 3300028577 Bacteria 10383
104 Ga0265323_10011434 3300028653 Bacteria 3582
105 Ga0265336_10000343 3300028666 Bacteria 30744
106 Ga0265338_10000280 3300028800 Bacteria 91942
107 Ga0265324_10004997 3300029957 Bacteria 5825
108 Ga0265331_10048262 3300031250 Bacteria 2048
109 Ga0307405_10053413 3300031731 Bacteria 2517
110 Ga0307405_10800132 3300031731 Bacteria 790
111 Ga0307413_10228019 3300031824 Bacteria 1366
112 Ga0307410_11037544 3300031852 Bacteria 708
113 Ga0307406_10028709 3300031901 Bacteria 3363
114 Ga0307406_11532835 3300031901 Bacteria 587
115 Ga0307407_10957276 3300031903 Bacteria 659
116 Ga0307409_100259338 3300031995 Bacteria 1594
117 Ga0307416_100215578 3300032002 Bacteria 1836
118 Ga0307415_100030886 3300032126 Bacteria 3445
119 Ga0307415_100076833 3300032126 Bacteria 2369
120 Ga0373930_0097480 3300034816 Bacteria 696
121 Ga0373959_0043762 3300034820 Bacteria 948
122 Ga0373923_0664762 3300035111 Bacteria 516
123 Ga0373955_0616136 3300035172 Bacteria 665
124 Ga0316574_0018020 3300035398 Bacteria 4143
125 Ga0373931_0319373 3300035691 Bacteria 964
126 Ga0373927_0037590 3300035695 Bacteria 3145
127 Ga0395899_0247443 3300037312 Unclassified 1225
128 Ga0395900_0039925 3300037418 Bacteria 4837
129 Ga0395900_1380131 3300037418 Bacteria 618
130 Ga0395898_0042060 3300037466 Bacteria 4510
131 Ga0395898_0549296 3300037466 Bacteria 1097
132 Ga0395905_0065255 3300037471 Bacteria 3408
133 Ga0395905_0301424 3300037471 Bacteria 1490
134 Ga0395905_0451855 3300037471 Bacteria 1183
135 Ga0395905_1079793 3300037471 Bacteria 706
136 Ga0395905_1282522 3300037471 Bacteria 636
137 Ga0395901_0017667 3300038443 Bacteria 7281
138 Ga0395901_0381059 3300038443 Bacteria 1451
139 Ga0395901_0589847 3300038443 Bacteria 1122
140 Ga0395901_0629238 3300038443 Bacteria 1079
141 Ga0395901_0884139 3300038443 Bacteria 876
142 Ga0436365_0359514 3300039437 Bacteria 564
143 Ga0436363_0634646 3300039450 Bacteria 1313
144 Ga0451791_0807405 3300041451 Bacteria 1153
145 Ga0451795_1619205 3300041456 Unclassified 631
146 Ga0451802_0878511 3300041460 Bacteria 570
147 Ga0451802_1632557 3300041460 Unclassified 555
148 Ga0451804_0700716 3300041463 Bacteria 1231
149 Ga0451833_0305220 3300041491 Bacteria 797
150 Ga0451835_0477490 3300041492 Unclassified 588
151 Ga0451837_1010278 3300041494 Bacteria 581
152 Ga0451839_0166311 3300041496 Bacteria 1641
153 Ga0451847_0546949 3300041503 Unclassified 655
154 Ga0451849_0648223 3300041505 Bacteria 1138
155 Ga0451853_2336006 3300041512 Bacteria 2857
156 Ga0466963_0016591 3300044694 Bacteria 4582
157 Ga0466963_0633562 3300044694 Bacteria 755
158 Ga0466964_0080119 3300044706 Bacteria 1400
159 Ga0466968_0016483 3300044735 Bacteria 2943
160 Ga0466968_0092259 3300044735 Bacteria 1344
161 Ga0466958_0039850 3300045836 Bacteria 2823
162 Ga0466967_0018055 3300045976 Bacteria 5626
163 Ga0495653_0331923 3300046463 Bacteria 983
164 Ga0495605_0262602 3300046474 Bacteria 737
165 Ga0495616_0240065 3300046513 Bacteria 782
166 Ga0495618_0666735 3300046514 Bacteria 614
167 Ga0495637_0179423 3300046520 Bacteria 786
168 Ga0495643_0089236 3300046522 Bacteria 1592
169 Ga0495663_0354783 3300046525 Bacteria 535
170 Ga0495597_0119515 3300046542 Bacteria 1099
171 Ga0495656_0050535 3300046615 Bacteria 1776
172 Ga0495625_0294960 3300046660 Bacteria 1039
173 Ga0495670_0278346 3300046691 Bacteria 895
174 Ga0495581_0177315 3300047315 Bacteria 1246
175 Ga0495687_040495 3300047443 Bacteria 2052
176 Ga0495677_0156439 3300047445 Bacteria 879
177 Ga0495602_0592217 3300048088 Bacteria 764
178 Ga0495626_0127589 3300048091 Bacteria 1089
179 Ga0496100_0167586 3300048903 Bacteria 1579
180 Ga0496102_0032035 3300048905 Bacteria 4721
181 Ga0496102_0054725 3300048905 Bacteria 3639
182 Ga0496103_0127048 3300048906 Bacteria 1626
183 Ga0496104_0011723 3300048907 Bacteria 7863
184 Ga0496105_0066785 3300048908 Bacteria 2970
185 Ga0496105_0075875 3300048908 Bacteria 2776
186 Ga0496106_0185263 3300048909 Bacteria 1654
187 Ga0496107_0411763 3300048910 Bacteria 1005
188 Ga0496108_0008669 3300048911 Bacteria 8246
189 Ga0496108_1160282 3300048911 Bacteria 654
190 Ga0496108_1251769 3300048911 Bacteria 626
191 Ga0496109_0013922 3300048912 Bacteria 6994
192 Ga0496109_0157008 3300048912 Bacteria 2131
193 Ga0496109_0323234 3300048912 Bacteria 1456
194 Ga0496109_1778143 3300048912 Bacteria 550
195 Ga0496110_0039013 3300048913 Bacteria 4134
196 Ga0496110_0581437 3300048913 Bacteria 1017
197 Ga0496110_1237687 3300048913 Bacteria 655
198 Ga0496111_0050126 3300048914 Bacteria 3010
199 Ga0496111_0422624 3300048914 Bacteria 984
200 Ga0496112_0019280 3300048915 Bacteria 6435
201 Ga0496112_0771302 3300048915 Bacteria 887
202 Ga0496112_1598456 3300048915 Bacteria 565
203 Ga0496112_1621784 3300048915 Bacteria 560
204 Ga0496113_0018920 3300048916 Bacteria 4808
205 Ga0496114_0016410 3300048917 Bacteria 5967
206 Ga0496114_0412913 3300048917 Bacteria 1195
207 Ga0496115_0047185 3300048918 Bacteria 3444
208 Ga0496115_0070618 3300048918 Bacteria 2831
209 Ga0496119_0421148 3300048922 Bacteria 634
210 Ga0496120_0266296 3300048923 Bacteria 798
211 Ga0501031_0001116 3300049568 Bacteria 16344
212 Ga0501032_0010449 3300049569 Bacteria 6696
213 Ga0501033_0012842 3300049570 Bacteria 6387
214 Ga0501033_0459595 3300049570 Bacteria 883
215 Ga0501034_0011829 3300049571 Bacteria 9033
216 Ga0501034_0121751 3300049571 Bacteria 2595
217 Ga0501034_0154282 3300049571 Bacteria 2271
218 Ga0501036_0066653 3300049572 Bacteria 3046
219 Ga0501036_0351591 3300049572 Bacteria 1231
220 Ga0501036_0372752 3300049572 Bacteria 1191
221 Ga0501037_0002457 3300049573 Bacteria 13397
222 Ga0501038_0008146 3300049574 Bacteria 9645
223 Ga0501039_0008068 3300049575 Bacteria 8022
224 Ga0501040_0281385 3300049576 Bacteria 1188
225 Ga0501040_1034241 3300049576 Bacteria 595
226 Ga0501041_0021010 3300049577 Bacteria 3909
227 Ga0501042_0025629 3300049578 Bacteria 4143
228 Ga0501042_1372481 3300049578 Bacteria 515
229 Ga0501043_0188543 3300049579 Bacteria 1604
230 Ga0501046_0096696 3300049580 Bacteria 2268
231 Ga0501046_0570545 3300049580 Bacteria 805
232 Ga0501047_1353084 3300049581 Bacteria 527
233 Ga0501047_1368772 3300049581 Bacteria 522
234 Ga0501048_0004982 3300049582 Bacteria 10136
235 Ga0501068_0005363 3300049584 Bacteria 7009
236 Ga0501068_0007081 3300049584 Bacteria 6209
237 Ga0501069_0000588 3300049585 Bacteria 16841
238 Ga0501069_0677604 3300049585 Bacteria 621
239 Ga0501069_0785712 3300049585 Bacteria 576
240 Ga0501070_0008776 3300049586 Bacteria 8547
241 Ga0501071_0089874 3300049587 Bacteria 2254
242 Ga0501072_0486217 3300049588 Bacteria 976
243 Ga0501072_1386904 3300049588 Bacteria 544
244 Ga0501073_0585833 3300049589 Bacteria 770
245 Ga0501074_0001178 3300049590 Bacteria 17155
246 Ga0501074_0030032 3300049590 Bacteria 3939
247 Ga0501075_0150590 3300049591 Bacteria 1773
248 Ga0501076_0111097 3300049592 Bacteria 2215
249 Ga0501076_0158604 3300049592 Bacteria 1842
250 Ga0501077_0020529 3300049593 Bacteria 4181
251 Ga0501079_0181482 3300049741 Bacteria 1642
252 Ga0501080_0031128 3300049742 Bacteria 4971
253 Ga0501081_1169623 3300049743 Bacteria 582
254 Ga0501083_0011151 3300049744 Bacteria 6308
255 Ga0501083_0249757 3300049744 Bacteria 1155
256 Ga0501035_0136135 3300049822 Bacteria 2138
257 Ga0501044_0070082 3300049823 Bacteria 3568
258 Ga0501045_0034598 3300049824 Bacteria 3667
259 nmdc:mga03683_42059_c1 3300050489 Bacteria 1879
260 nmdc:mga03n38_256905_c1 3300050490 Bacteria 925
261 nmdc:mga03n38_732464_c1 3300050490 Bacteria 572
262 nmdc:mga00v17_161625_c1 3300050491 Bacteria 1442
263 nmdc:mga0yw44_176906_c1 3300050492 Bacteria 1403
264 nmdc:mga0yw44_283037_c1 3300050492 Bacteria 1108
265 nmdc:mga0yw44_66764_c1 3300050492 Bacteria 2221
266 nmdc:mga04h51_104232_c1 3300050495 Bacteria 1037
267 nmdc:mga07m45_765318_c1 3300050496 Bacteria 554
268 nmdc:mga05p37_107107_c1 3300050507 Bacteria 3439
269 nmdc:mga05p37_530290_c1 3300050507 Bacteria 1345
270 nmdc:mga09592_1129867_c1 3300050508 Bacteria 650
271 nmdc:mga09592_50133_c1 3300050508 Bacteria 3521
272 nmdc:mga0qj67_49014_c1 3300050509 Bacteria 3338
273 nmdc:mga0qj67_686008_c1 3300050509 Bacteria 816
274 nmdc:mga06r32_1450702_c1 3300050510 Bacteria 627
275 nmdc:mga06r32_17534_c1 3300050510 Bacteria 6537
276 nmdc:mga06r32_337736_c1 3300050510 Bacteria 1491
277 nmdc:mga08y16_79502_c1 3300050511 Bacteria 3418
278 Ga0495601_0939637 3300053077 Bacteria 545
279 Ga0495655_0028746 3300053083 Bacteria 1331
280 Ga0495595_0375201 3300053084 Bacteria 719
281 Ga0500616_0141169 3300053153 Bacteria 1126
282 Ga0500634_0120465 3300053161 Bacteria 1278
283 Ga0501084_0129206 3300054114 Bacteria 2126
284 Ga0501082_0018145 3300060353 Bacteria 6058
285 Ga0501082_0111352 3300060353 Bacteria 2369
286 Ga0530510_0171167 3300061734 Bacteria 1608
287 Ga0530510_1106698 3300061734 Bacteria 607
288 2585266190 2582581306 Bacteria 6450535
289 2585387192 2582581865 Bacteria 6644329
290 2849574129 2849573788 Bacteria 5421256
291 2851157808 2851153111 Bacteria 5542585
292 Ga0495596_0096488
293 JGI25406J46586_10033766
294 rootH1_10022723
295 Ga0070683_100003014
296 Ga0070680_101087602
297 Ga0070667_101138521
298 Ga0070710_10068263
299 Ga0070710_10285872
300 Ga0070663_100764759
301 Ga0070678_100456071
302 Ga0070662_100795211
303 Ga0070681_10198186
304 Ga0070679_100113248
305 Ga0070684_100054191
306 Ga0070684_101134094
307 Ga0070665_100093872
308 Ga0070665_100396919
309 Ga0068863_100123861
310 Ga0068858_100016645
311 Ga0068858_100018441
312 Ga0068858_100538818
313 Ga0068858_101291070
314 Ga0081455_10560426
315 Ga0081538_10001765
316 Ga0081538_10052063
317 Ga0081539_10001657
318 Ga0075365_10097115
319 Ga0075365_10185024
320 Ga0075363_100316260
321 Ga0075364_10374852
322 Ga0075428_100169977
323 Ga0075428_100447511
324 Ga0075428_101585578
325 Ga0075430_100037997
326 Ga0075430_100149895
327 Ga0075430_100565547
328 Ga0075431_100009364
329 Ga0075431_100437564
330 Ga0075429_100010944
331 Ga0075429_101431446
332 Ga0111539_10010446
333 Ga0111539_10809506
334 Ga0111539_11662719
335 Ga0105245_11337677
336 Ga0105247_10008162
337 Ga0105247_10414230
338 Ga0114129_10044167
339 Ga0114129_10068671
340 Ga0114129_10164506
341 Ga0114129_12327225
342 Ga0105243_10809799
343 Ga0105243_11107674
344 Ga0105243_12719516
345 Ga0105248_10196370
346 Ga0105248_11530556
347 Ga0105238_10207885
348 Ga0105249_11123900
349 Ga0105239_10844285
350 Ga0105246_10472777
351 Ga0105246_11275134
352 Ga0157369_10795607
353 Ga0163162_10350300
354 Ga0157372_11154318
355 Ga0157375_11402245
356 Ga0163163_10013861
357 Ga0163163_10576888
358 Ga0163163_10838794
359 Ga0157379_10139442
360 Ga0206354_10450254
361 Ga0206353_11136636
362 Ga0209130_1041495
363 Ga0209256_1014557
364 Ga0207707_11202598
365 Ga0207663_10153380
366 Ga0207660_10707403
367 Ga0207652_10086115
368 Ga0207659_11864324
369 Ga0207687_10719193
370 Ga0207664_11952360
371 Ga0207709_10129693
372 Ga0207704_11283327
373 Ga0207711_10203637
374 Ga0207661_10452664
375 Ga0207712_11005310
376 Ga0207668_10357019
377 Ga0207668_11793655
378 Ga0207658_11386081
379 Ga0207677_11127225
380 Ga0207703_10025851
381 Ga0207703_10291450
382 Ga0207678_10697486
383 Ga0207641_10251944
384 Ga0207641_10825195
385 Ga0207641_11767766
386 Ga0207683_10421631
387 Ga0268266_10109945
388 Ga0268266_10387623
389 Ga0268266_11323978
390 Ga0268266_11583585
391 Ga0265337_1002550
392 Ga0265319_1004346
393 Ga0265334_10022455
394 Ga0265318_10002255
395 Ga0265323_10011434
396 Ga0265336_10000343
397 Ga0265338_10000280
398 Ga0265324_10004997
399 Ga0265331_10048262
400 Ga0307405_10053413
401 Ga0307405_10800132
402 Ga0307413_10228019
403 Ga0307410_11037544
404 Ga0307406_10028709
405 Ga0307406_11532835
406 Ga0307407_10957276
407 Ga0307409_100259338
408 Ga0307416_100215578
409 Ga0307415_100030886
410 Ga0307415_100076833
411 Ga0373930_0097480
412 Ga0373959_0043762
413 Ga0373923_0664762
414 Ga0373955_0616136
415 Ga0316574_0018020
416 Ga0373931_0319373
417 Ga0373927_0037590
418 Ga0395899_0247443
419 Ga0395900_0039925
420 Ga0395900_1380131
421 Ga0395898_0042060
422 Ga0395898_0549296
423 Ga0395905_0065255
424 Ga0395905_0301424
425 Ga0395905_0451855
426 Ga0395905_1079793
427 Ga0395905_1282522
428 Ga0395901_0017667
429 Ga0395901_0381059
430 Ga0395901_0589847
431 Ga0395901_0629238
432 Ga0395901_0884139
433 Ga0436365_0359514
434 Ga0436363_0634646
435 Ga0451791_0807405
436 Ga0451795_1619205
437 Ga0451802_0878511
438 Ga0451802_1632557
439 Ga0451804_0700716
440 Ga0451833_0305220
441 Ga0451835_0477490
442 Ga0451837_1010278
443 Ga0451839_0166311
444 Ga0451847_0546949
445 Ga0451849_0648223
446 Ga0451853_2336006
447 Ga0466963_0016591
448 Ga0466963_0633562
449 Ga0466964_0080119
450 Ga0466968_0016483
451 Ga0466968_0092259
452 Ga0466958_0039850
453 Ga0466967_0018055
454 Ga0495653_0331923
455 Ga0495605_0262602
456 Ga0495616_0240065
457 Ga0495618_0666735
458 Ga0495637_0179423
459 Ga0495643_0089236
460 Ga0495663_0354783
461 Ga0495597_0119515
462 Ga0495656_0050535
463 Ga0495625_0294960
464 Ga0495670_0278346
465 Ga0495581_0177315
466 Ga0495687_040495
467 Ga0495677_0156439
468 Ga0495602_0592217
469 Ga0495626_0127589
470 Ga0496100_0167586
471 Ga0496102_0032035
472 Ga0496102_0054725
473 Ga0496103_0127048
474 Ga0496104_0011723
475 Ga0496105_0066785
476 Ga0496105_0075875
477 Ga0496106_0185263
478 Ga0496107_0411763
479 Ga0496108_0008669
480 Ga0496108_1160282
481 Ga0496108_1251769
482 Ga0496109_0013922
483 Ga0496109_0157008
484 Ga0496109_0323234
485 Ga0496109_1778143
486 Ga0496110_0039013
487 Ga0496110_0581437
488 Ga0496110_1237687
489 Ga0496111_0050126
490 Ga0496111_0422624
491 Ga0496112_0019280
492 Ga0496112_0771302
493 Ga0496112_1598456
494 Ga0496112_1621784
495 Ga0496113_0018920
496 Ga0496114_0016410
497 Ga0496114_0412913
498 Ga0496115_0047185
499 Ga0496115_0070618
500 Ga0496119_0421148
501 Ga0496120_0266296
502 Ga0501031_0001116
503 Ga0501032_0010449
504 Ga0501033_0012842
505 Ga0501033_0459595
506 Ga0501034_0011829
507 Ga0501034_0121751
508 Ga0501034_0154282
509 Ga0501036_0066653
510 Ga0501036_0351591
511 Ga0501036_0372752
512 Ga0501037_0002457
513 Ga0501038_0008146
514 Ga0501039_0008068
515 Ga0501040_0281385
516 Ga0501040_1034241
517 Ga0501041_0021010
518 Ga0501042_0025629
519 Ga0501042_1372481
520 Ga0501043_0188543
521 Ga0501046_0096696
522 Ga0501046_0570545
523 Ga0501047_1353084
524 Ga0501047_1368772
525 Ga0501048_0004982
526 Ga0501068_0005363
527 Ga0501068_0007081
528 Ga0501069_0000588
529 Ga0501069_0677604
530 Ga0501069_0785712
531 Ga0501070_0008776
532 Ga0501071_0089874
533 Ga0501072_0486217
534 Ga0501072_1386904
535 Ga0501073_0585833
536 Ga0501074_0001178
537 Ga0501074_0030032
538 Ga0501075_0150590
539 Ga0501076_0111097
540 Ga0501076_0158604
541 Ga0501077_0020529
542 Ga0501079_0181482
543 Ga0501080_0031128
544 Ga0501081_1169623
545 Ga0501083_0011151
546 Ga0501083_0249757
547 Ga0501035_0136135
548 Ga0501044_0070082
549 Ga0501045_0034598
550 nmdc:mga03683_42059_c1
551 nmdc:mga03n38_256905_c1
552 nmdc:mga03n38_732464_c1
553 nmdc:mga00v17_161625_c1
554 nmdc:mga0yw44_176906_c1
555 nmdc:mga0yw44_283037_c1
556 nmdc:mga0yw44_66764_c1
557 nmdc:mga04h51_104232_c1
558 nmdc:mga07m45_765318_c1
559 nmdc:mga05p37_107107_c1
560 nmdc:mga05p37_530290_c1
561 nmdc:mga09592_1129867_c1
562 nmdc:mga09592_50133_c1
563 nmdc:mga0qj67_49014_c1
564 nmdc:mga0qj67_686008_c1
565 nmdc:mga06r32_1450702_c1
566 nmdc:mga06r32_17534_c1
567 nmdc:mga06r32_337736_c1
568 nmdc:mga08y16_79502_c1
569 Ga0495601_0939637
570 Ga0495655_0028746
571 Ga0495595_0375201
572 Ga0500616_0141169
573 Ga0500634_0120465
574 Ga0501084_0129206
575 Ga0501082_0018145
576 Ga0501082_0111352
577 Ga0530510_0171167
578 Ga0530510_1106698
579 2585266190
580 2585387192
581 2849574129
582 2851157808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

143

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9408 1 127
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9261 1 127
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8119 1 125
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8079 6 123
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.7994 1 125
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9408 1 127 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9261 1 127 3.10.180.10
af_Q8IK86_519_679_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8993 64 89 3.40.50.300
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8337 64 125 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8214 64 125 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A529M3X4-F1-model_v4 VOC family protein 1.004 1 56
AF-M5CMF1-F1-model_v4 deleted 0.995 66 127
AF-A0A0E1X199-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9903 66 127 GO:0051213
AF-A0A2V6CZ06-F1-model_v4 VOC family protein 0.9897 59 126
AF-A0A7Y2FQG5-F1-model_v4 VOC family protein 0.9872 66 125

Map