F390455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 193 | 282 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0034044|Ga0373927_0034044_350_1327 |
| Length | 325 |
| Sequence | VRRHLLCFGLGYTARALARILGPDWSITGTSRDEEPRASSRGANFRWLRFDRDHPLEPVVFAGVTHVLVSVPPDEAGDPVLDRHRDDMAAISGLAWLGYLSTTGVYGNRDGGWVDEHSESSPSGARGRRRAAAEAAWLDLSRDRGLPVHVFRLAGIYGPGRSPFDALRAGTAKRIDKPGQVFSRIHVDDIANVLMASIARPRPGAIYNVCDDEPAASAEVIAHAAGLLGVAPPPLLPFETAGLSTMARSFYDDSKRVSNALIKSELGVSLRYPTYRDGLAAILAVESIRSRAGLEACPAPRHPASSAPAGGRGAASATDPAKEER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 2 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 3 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 4 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 5 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 6 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 67 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 68 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 105 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 108 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 116 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 117 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 118 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 121 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 124 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 125 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 126 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 127 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 128 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 131 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 132 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 133 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 134 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 135 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 146 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 147 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 148 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 149 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 150 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 151 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 152 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 153 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 154 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 186 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 187 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 188 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 191 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 192 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 193 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.91 |
| Metatranscriptomes | 0 |
| Isolates | 3.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.12 |
| Nodule | 1.37 |
| Rhizoplane | 3.44 |
| Rhizosphere | 78.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000124 | 3300003187 | Bacteria | 105038 |
| 2 | rootH1_10044830 | 3300003316 | Bacteria | 4196 |
| 3 | JGI25160J50197_1004916 | 3300003354 | Bacteria | 5688 |
| 4 | Ga0070670_100051453 | 3300005331 | Unclassified | 3537 |
| 5 | Ga0070680_100002988 | 3300005336 | Bacteria | 12555 |
| 6 | Ga0070668_100033205 | 3300005347 | Bacteria | 3928 |
| 7 | Ga0070674_100334416 | 3300005356 | Unclassified | 1218 |
| 8 | Ga0070667_100024144 | 3300005367 | Bacteria | 5049 |
| 9 | Ga0070667_100032838 | 3300005367 | Unclassified | 4331 |
| 10 | Ga0070714_100143407 | 3300005435 | Bacteria | 2146 |
| 11 | Ga0070713_100020989 | 3300005436 | Bacteria | 5015 |
| 12 | Ga0070713_100039676 | 3300005436 | Bacteria | 3823 |
| 13 | Ga0070713_100213251 | 3300005436 | Bacteria | 1749 |
| 14 | Ga0070713_100425108 | 3300005436 | Bacteria | 1244 |
| 15 | Ga0070711_100106817 | 3300005439 | Bacteria | 2047 |
| 16 | Ga0070663_100025295 | 3300005455 | Bacteria | 4006 |
| 17 | Ga0070678_100045780 | 3300005456 | Bacteria | 3132 |
| 18 | Ga0070681_10000987 | 3300005458 | Bacteria | 24071 |
| 19 | Ga0070706_100481726 | 3300005467 | Bacteria | 1154 |
| 20 | Ga0070707_100003690 | 3300005468 | Bacteria | 14447 |
| 21 | Ga0070698_100627886 | 3300005471 | Bacteria | 1015 |
| 22 | Ga0070679_100007116 | 3300005530 | Bacteria | 10442 |
| 23 | Ga0068853_100258435 | 3300005539 | Bacteria | 1600 |
| 24 | Ga0070695_100013985 | 3300005545 | Bacteria | 4832 |
| 25 | Ga0068854_100022782 | 3300005578 | Bacteria | 4273 |
| 26 | Ga0068854_100397096 | 3300005578 | Bacteria | 1140 |
| 27 | Ga0068856_100011378 | 3300005614 | Bacteria | 8632 |
| 28 | Ga0068859_100296307 | 3300005617 | Bacteria | 1711 |
| 29 | Ga0068864_100384283 | 3300005618 | Bacteria | 1331 |
| 30 | Ga0068861_100026768 | 3300005719 | Bacteria | 4196 |
| 31 | Ga0068861_100464774 | 3300005719 | Bacteria | 1136 |
| 32 | Ga0068870_10133557 | 3300005840 | Bacteria | 1444 |
| 33 | Ga0068863_100001132 | 3300005841 | Bacteria | 26633 |
| 34 | Ga0068858_100000928 | 3300005842 | Bacteria | 30413 |
| 35 | Ga0068860_100001736 | 3300005843 | Bacteria | 23228 |
| 36 | Ga0068860_100020344 | 3300005843 | Bacteria | 6428 |
| 37 | Ga0068862_100011369 | 3300005844 | Bacteria | 7350 |
| 38 | Ga0070717_10056682 | 3300006028 | Bacteria | 3238 |
| 39 | Ga0075362_10000932 | 3300006177 | Bacteria | 8914 |
| 40 | Ga0075362_10047528 | 3300006177 | Bacteria | 1912 |
| 41 | Ga0075428_100445497 | 3300006844 | Bacteria | 1387 |
| 42 | Ga0075430_100034707 | 3300006846 | Bacteria | 4282 |
| 43 | Ga0075430_100093945 | 3300006846 | Bacteria | 2507 |
| 44 | Ga0075431_100018281 | 3300006847 | Bacteria | 7132 |
| 45 | Ga0075431_100084383 | 3300006847 | Bacteria | 3279 |
| 46 | Ga0075431_100224968 | 3300006847 | Bacteria | 1913 |
| 47 | Ga0075431_100286268 | 3300006847 | Bacteria | 1668 |
| 48 | Ga0068865_100064148 | 3300006881 | Bacteria | 2584 |
| 49 | Ga0068865_100281456 | 3300006881 | Bacteria | 1324 |
| 50 | Ga0075436_100005588 | 3300006914 | Bacteria | 8630 |
| 51 | Ga0075435_100045372 | 3300007076 | Bacteria | 3523 |
| 52 | Ga0099795_10088711 | 3300007788 | Bacteria | 1196 |
| 53 | Ga0105240_10038880 | 3300009093 | Bacteria | 6099 |
| 54 | Ga0105240_10050366 | 3300009093 | Bacteria | 5251 |
| 55 | Ga0111539_10258457 | 3300009094 | Bacteria | 2027 |
| 56 | Ga0105245_10194591 | 3300009098 | Bacteria | 1944 |
| 57 | Ga0105247_10004946 | 3300009101 | Bacteria | 8468 |
| 58 | Ga0114129_10255584 | 3300009147 | Bacteria | 2350 |
| 59 | Ga0105243_10668926 | 3300009148 | Bacteria | 1008 |
| 60 | Ga0105237_10146561 | 3300009545 | Bacteria | 2356 |
| 61 | Ga0105237_10218231 | 3300009545 | Unclassified | 1907 |
| 62 | Ga0105237_10223610 | 3300009545 | Bacteria | 1883 |
| 63 | Ga0105238_10047304 | 3300009551 | Bacteria | 4339 |
| 64 | Ga0105238_10151857 | 3300009551 | Bacteria | 2291 |
| 65 | Ga0105249_10006995 | 3300009553 | Bacteria | 9844 |
| 66 | Ga0105249_10019520 | 3300009553 | Bacteria | 6049 |
| 67 | Ga0099796_10003373 | 3300010159 | Bacteria | 3696 |
| 68 | Ga0099796_10008581 | 3300010159 | Bacteria | 2729 |
| 69 | Ga0105239_10911876 | 3300010375 | Bacteria | 1009 |
| 70 | Ga0157370_10003504 | 3300013104 | Bacteria | 18396 |
| 71 | Ga0157378_10253467 | 3300013297 | Bacteria | 1686 |
| 72 | Ga0163162_10288140 | 3300013306 | Bacteria | 1774 |
| 73 | Ga0163162_10462466 | 3300013306 | Bacteria | 1400 |
| 74 | Ga0163162_10483776 | 3300013306 | Bacteria | 1369 |
| 75 | Ga0163162_10629093 | 3300013306 | Bacteria | 1198 |
| 76 | Ga0163162_10720544 | 3300013306 | Bacteria | 1118 |
| 77 | Ga0157380_10091465 | 3300014326 | Bacteria | 2512 |
| 78 | Ga0157380_10763611 | 3300014326 | Bacteria | 980 |
| 79 | Ga0182008_10025893 | 3300014497 | Bacteria | 2977 |
| 80 | Ga0157379_10052090 | 3300014968 | Bacteria | 3655 |
| 81 | Ga0157379_10236346 | 3300014968 | Bacteria | 1657 |
| 82 | Ga0157376_10170890 | 3300014969 | Bacteria | 1979 |
| 83 | Ga0163161_10009753 | 3300017792 | Bacteria | 6653 |
| 84 | Ga0163161_10177171 | 3300017792 | Bacteria | 1633 |
| 85 | Ga0213872_10009803 | 3300021361 | Bacteria | 4578 |
| 86 | Ga0213875_10002240 | 3300021388 | Bacteria | 11732 |
| 87 | Ga0213871_10048881 | 3300021441 | Unclassified | 1154 |
| 88 | Ga0209130_1000270 | 3300025284 | Bacteria | 65057 |
| 89 | Ga0209025_1000705 | 3300025294 | Bacteria | 56926 |
| 90 | Ga0209758_1004689 | 3300025297 | Bacteria | 11165 |
| 91 | Ga0207426_1000443 | 3300025302 | Bacteria | 66593 |
| 92 | Ga0207710_10010896 | 3300025900 | Bacteria | 3829 |
| 93 | Ga0207680_10088069 | 3300025903 | Unclassified | 1967 |
| 94 | Ga0207699_10019305 | 3300025906 | Bacteria | 3632 |
| 95 | Ga0207707_10004835 | 3300025912 | Bacteria | 11814 |
| 96 | Ga0207707_10175327 | 3300025912 | Bacteria | 1873 |
| 97 | Ga0207695_10240011 | 3300025913 | Bacteria | 1714 |
| 98 | Ga0207671_10034651 | 3300025914 | Bacteria | 3750 |
| 99 | Ga0207693_10002515 | 3300025915 | Bacteria | 15940 |
| 100 | Ga0207663_10021382 | 3300025916 | Bacteria | 3682 |
| 101 | Ga0207663_10129641 | 3300025916 | Bacteria | 1741 |
| 102 | Ga0207660_10011410 | 3300025917 | Bacteria | 5780 |
| 103 | Ga0207652_10003311 | 3300025921 | Bacteria | 13341 |
| 104 | Ga0207646_10013143 | 3300025922 | Bacteria | 7924 |
| 105 | Ga0207694_10086832 | 3300025924 | Bacteria | 2463 |
| 106 | Ga0207694_10126003 | 3300025924 | Bacteria | 2049 |
| 107 | Ga0207700_10009550 | 3300025928 | Bacteria | 6070 |
| 108 | Ga0207664_10024289 | 3300025929 | Bacteria | 4553 |
| 109 | Ga0207709_10217354 | 3300025935 | Bacteria | 1376 |
| 110 | Ga0207704_10046965 | 3300025938 | Bacteria | 2578 |
| 111 | Ga0207661_10104548 | 3300025944 | Unclassified | 2385 |
| 112 | Ga0207712_10087588 | 3300025961 | Unclassified | 2284 |
| 113 | Ga0207668_10023580 | 3300025972 | Bacteria | 3958 |
| 114 | Ga0207640_10016713 | 3300025981 | Bacteria | 4276 |
| 115 | Ga0207658_10263637 | 3300025986 | Unclassified | 1469 |
| 116 | Ga0207703_10000617 | 3300026035 | Bacteria | 35947 |
| 117 | Ga0207702_10414777 | 3300026078 | Unclassified | 1301 |
| 118 | Ga0207641_10000289 | 3300026088 | Bacteria | 62844 |
| 119 | Ga0207648_10182859 | 3300026089 | Bacteria | 1856 |
| 120 | Ga0207676_10203492 | 3300026095 | Bacteria | 1751 |
| 121 | Ga0207675_100011404 | 3300026118 | Bacteria | 8318 |
| 122 | Ga0268266_10004656 | 3300028379 | Bacteria | 13072 |
| 123 | Ga0268266_10096280 | 3300028379 | Unclassified | 2601 |
| 124 | Ga0268265_10003022 | 3300028380 | Bacteria | 12274 |
| 125 | Ga0265324_10003964 | 3300029957 | Bacteria | 6844 |
| 126 | Ga0265328_10008671 | 3300031239 | Bacteria | 4177 |
| 127 | Ga0265320_10002022 | 3300031240 | Bacteria | 14313 |
| 128 | Ga0265340_10111377 | 3300031247 | Bacteria | 1265 |
| 129 | Ga0265331_10000644 | 3300031250 | Bacteria | 30205 |
| 130 | Ga0265331_10000805 | 3300031250 | Bacteria | 25935 |
| 131 | Ga0265327_10000460 | 3300031251 | Bacteria | 73013 |
| 132 | Ga0307408_100024537 | 3300031548 | Bacteria | 4119 |
| 133 | Ga0265313_10000529 | 3300031595 | Bacteria | 39938 |
| 134 | Ga0265313_10000622 | 3300031595 | Bacteria | 36655 |
| 135 | Ga0265314_10007116 | 3300031711 | Bacteria | 9753 |
| 136 | Ga0265314_10050412 | 3300031711 | Bacteria | 2908 |
| 137 | Ga0265342_10011322 | 3300031712 | Bacteria | 6115 |
| 138 | Ga0316576_10010503 | 3300031727 | Bacteria | 6020 |
| 139 | Ga0316576_10041546 | 3300031727 | Bacteria | 3311 |
| 140 | Ga0316576_10129441 | 3300031727 | Bacteria | 1899 |
| 141 | Ga0307510_10000010 | 3300033180 | Bacteria | 377457 |
| 142 | Ga0307510_10011156 | 3300033180 | Bacteria | 10685 |
| 143 | Ga0307510_10127981 | 3300033180 | Bacteria | 2222 |
| 144 | Ga0373932_0012655 | 3300035112 | Bacteria | 2082 |
| 145 | Ga0373932_0073460 | 3300035112 | Bacteria | 1066 |
| 146 | Ga0373936_0003546 | 3300035113 | Bacteria | 5871 |
| 147 | Ga0373936_0016128 | 3300035113 | Bacteria | 2871 |
| 148 | Ga0373939_0012820 | 3300035114 | Bacteria | 2145 |
| 149 | Ga0316574_0000057 | 3300035398 | Bacteria | 29135 |
| 150 | Ga0373927_0034044 | 3300035695 | Bacteria | 3315 |
| 151 | Ga0373947_0270634 | 3300035725 | Bacteria | 1128 |
| 152 | Ga0373937_0017944 | 3300036401 | Bacteria | 6313 |
| 153 | Ga0316582_0079099 | 3300036647 | Bacteria | 2143 |
| 154 | Ga0316584_0060525 | 3300036712 | Bacteria | 2836 |
| 155 | Ga0316584_0287472 | 3300036712 | Bacteria | 1193 |
| 156 | Ga0373925_0105218 | 3300037068 | Bacteria | 2174 |
| 157 | Ga0373925_0279443 | 3300037068 | Bacteria | 1344 |
| 158 | Ga0436364_0048878 | 3300037853 | Bacteria | 2441 |
| 159 | Ga0436364_0519232 | 3300037853 | Bacteria | 78366 |
| 160 | Ga0400485_18958 | 3300038735 | Bacteria | 2189 |
| 161 | Ga0400483_013353 | 3300039062 | Bacteria | 2968 |
| 162 | Ga0400483_050342 | 3300039062 | Bacteria | 2427 |
| 163 | Ga0400483_249811 | 3300039062 | Bacteria | 3970 |
| 164 | Ga0400487_14027 | 3300039110 | Bacteria | 3449 |
| 165 | Ga0436365_0892608 | 3300039437 | Bacteria | 3891 |
| 166 | Ga0436365_1934223 | 3300039437 | Bacteria | 2760 |
| 167 | Ga0436360_0030258 | 3300039438 | Bacteria | 4242 |
| 168 | Ga0436360_0411737 | 3300039438 | Bacteria | 1799 |
| 169 | Ga0436361_0277890 | 3300039447 | Bacteria | 6008 |
| 170 | Ga0436361_0282068 | 3300039447 | Bacteria | 1172 |
| 171 | Ga0436361_0499976 | 3300039447 | Bacteria | 1047 |
| 172 | Ga0436361_0830018 | 3300039447 | Bacteria | 1537 |
| 173 | Ga0436363_0048675 | 3300039450 | Bacteria | 1024 |
| 174 | Ga0436363_1120322 | 3300039450 | Bacteria | 1116 |
| 175 | Ga0436362_0293991 | 3300039453 | Bacteria | 1339 |
| 176 | Ga0436362_0332318 | 3300039453 | Bacteria | 1808 |
| 177 | Ga0436362_0958195 | 3300039453 | Bacteria | 7517 |
| 178 | Ga0453683_0018547 | 3300044673 | Bacteria | 4467 |
| 179 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 180 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 181 | Ga0453684_0009064 | 3300044712 | Bacteria | 17558 |
| 182 | Ga0453684_0130120 | 3300044712 | Bacteria | 3021 |
| 183 | Ga0453684_0162142 | 3300044712 | Bacteria | 2643 |
| 184 | Ga0451576_0001922 | 3300045051 | Bacteria | 33279 |
| 185 | Ga0451576_0198803 | 3300045051 | Bacteria | 2094 |
| 186 | Ga0451576_0206403 | 3300045051 | Bacteria | 2052 |
| 187 | Ga0495610_0009610 | 3300046512 | Bacteria | 6097 |
| 188 | Ga0496101_0004187 | 3300048904 | Bacteria | 9040 |
| 189 | Ga0496104_0096698 | 3300048907 | Bacteria | 2825 |
| 190 | Ga0496106_0346860 | 3300048909 | Bacteria | 1192 |
| 191 | Ga0496107_0000431 | 3300048910 | Bacteria | 22701 |
| 192 | Ga0496108_0253276 | 3300048911 | Bacteria | 1532 |
| 193 | Ga0496112_0152752 | 3300048915 | Bacteria | 2276 |
| 194 | Ga0496113_0010689 | 3300048916 | Bacteria | 6080 |
| 195 | Ga0496114_0003041 | 3300048917 | Bacteria | 12849 |
| 196 | Ga0496115_0075047 | 3300048918 | Bacteria | 2746 |
| 197 | Ga0496115_0205501 | 3300048918 | Bacteria | 1627 |
| 198 | Ga0496116_0082773 | 3300048919 | Bacteria | 1984 |
| 199 | Ga0496117_0000152 | 3300048920 | Bacteria | 147897 |
| 200 | Ga0496118_0000052 | 3300048921 | Bacteria | 237465 |
| 201 | Ga0496119_0000151 | 3300048922 | Bacteria | 96860 |
| 202 | Ga0496119_0012647 | 3300048922 | Bacteria | 6829 |
| 203 | Ga0496120_0000286 | 3300048923 | Bacteria | 84869 |
| 204 | Ga0496120_0011408 | 3300048923 | Bacteria | 6112 |
| 205 | Ga0496120_0029688 | 3300048923 | Bacteria | 3334 |
| 206 | Ga0496121_0085661 | 3300048924 | Bacteria | 2479 |
| 207 | Ga0496121_0103556 | 3300048924 | Bacteria | 2189 |
| 208 | Ga0496121_0271808 | 3300048924 | Unclassified | 1164 |
| 209 | Ga0496124_0020815 | 3300048927 | Bacteria | 6053 |
| 210 | Ga0496125_0001409 | 3300048928 | Bacteria | 35088 |
| 211 | Ga0496125_0047616 | 3300048928 | Bacteria | 3582 |
| 212 | Ga0496126_0011622 | 3300048929 | Bacteria | 9087 |
| 213 | Ga0496126_0024812 | 3300048929 | Bacteria | 5781 |
| 214 | Ga0496126_0219991 | 3300048929 | Unclassified | 1595 |
| 215 | Ga0501031_0100760 | 3300049568 | Bacteria | 1884 |
| 216 | Ga0501033_0071271 | 3300049570 | Bacteria | 2553 |
| 217 | Ga0501036_0037503 | 3300049572 | Bacteria | 4100 |
| 218 | Ga0501036_0040247 | 3300049572 | Bacteria | 3953 |
| 219 | Ga0501036_0085709 | 3300049572 | Bacteria | 2663 |
| 220 | Ga0501038_0074949 | 3300049574 | Bacteria | 2861 |
| 221 | Ga0501039_0015437 | 3300049575 | Bacteria | 5846 |
| 222 | Ga0501039_0064394 | 3300049575 | Bacteria | 2842 |
| 223 | Ga0501039_0073384 | 3300049575 | Bacteria | 2659 |
| 224 | Ga0501040_0016470 | 3300049576 | Bacteria | 4894 |
| 225 | Ga0501040_0100555 | 3300049576 | Bacteria | 2016 |
| 226 | Ga0501040_0159156 | 3300049576 | Bacteria | 1596 |
| 227 | Ga0501041_0155560 | 3300049577 | Bacteria | 1428 |
| 228 | Ga0501041_0166772 | 3300049577 | Bacteria | 1378 |
| 229 | Ga0501041_0197376 | 3300049577 | Bacteria | 1261 |
| 230 | Ga0501042_0008458 | 3300049578 | Bacteria | 6795 |
| 231 | Ga0501042_0096954 | 3300049578 | Bacteria | 2119 |
| 232 | Ga0501042_0147920 | 3300049578 | Bacteria | 1693 |
| 233 | Ga0501043_0090255 | 3300049579 | Bacteria | 2409 |
| 234 | Ga0501046_0035669 | 3300049580 | Bacteria | 4007 |
| 235 | Ga0501047_0107519 | 3300049581 | Bacteria | 2671 |
| 236 | Ga0501048_0058777 | 3300049582 | Bacteria | 2725 |
| 237 | Ga0501048_0065480 | 3300049582 | Bacteria | 2569 |
| 238 | Ga0501048_0094320 | 3300049582 | Bacteria | 2111 |
| 239 | Ga0501048_0158024 | 3300049582 | Bacteria | 1604 |
| 240 | Ga0501068_0043110 | 3300049584 | Bacteria | 2714 |
| 241 | Ga0501069_0092932 | 3300049585 | Bacteria | 1707 |
| 242 | Ga0501069_0114636 | 3300049585 | Bacteria | 1537 |
| 243 | Ga0501071_0011454 | 3300049587 | Bacteria | 5975 |
| 244 | Ga0501071_0115039 | 3300049587 | Bacteria | 1990 |
| 245 | Ga0501072_0009672 | 3300049588 | Bacteria | 7332 |
| 246 | Ga0501075_0012245 | 3300049591 | Bacteria | 6089 |
| 247 | Ga0501075_0277091 | 3300049591 | Bacteria | 1278 |
| 248 | Ga0501076_0341607 | 3300049592 | Bacteria | 1229 |
| 249 | Ga0501077_0004078 | 3300049593 | Bacteria | 8819 |
| 250 | Ga0501077_0018145 | 3300049593 | Bacteria | 4449 |
| 251 | Ga0501077_0056962 | 3300049593 | Bacteria | 2482 |
| 252 | Ga0501079_0159854 | 3300049741 | Bacteria | 1756 |
| 253 | Ga0501079_0268450 | 3300049741 | Bacteria | 1334 |
| 254 | Ga0501080_0103724 | 3300049742 | Bacteria | 2637 |
| 255 | Ga0501081_0112307 | 3300049743 | Bacteria | 1934 |
| 256 | Ga0501081_0118037 | 3300049743 | Bacteria | 1887 |
| 257 | Ga0501081_0337621 | 3300049743 | Bacteria | 1109 |
| 258 | Ga0501083_0051330 | 3300049744 | Bacteria | 2774 |
| 259 | Ga0501083_0086512 | 3300049744 | Bacteria | 2073 |
| 260 | Ga0501035_0099152 | 3300049822 | Bacteria | 2558 |
| 261 | Ga0501045_0014577 | 3300049824 | Bacteria | 5572 |
| 262 | Ga0501045_0250336 | 3300049824 | Bacteria | 1319 |
| 263 | Ga0501045_0258162 | 3300049824 | Bacteria | 1297 |
| 264 | nmdc:mga03683_307_c1 | 3300050489 | Bacteria | 14414 |
| 265 | nmdc:mga05p37_205693_c1 | 3300050507 | Bacteria | 2381 |
| 266 | nmdc:mga0qj67_4938_c1 | 3300050509 | Bacteria | 9695 |
| 267 | nmdc:mga0qj67_84114_c1 | 3300050509 | Bacteria | 2551 |
| 268 | nmdc:mga06r32_208476_c1 | 3300050510 | Bacteria | 1942 |
| 269 | nmdc:mga06r32_270596_c1 | 3300050510 | Bacteria | 1686 |
| 270 | nmdc:mga06r32_3543_c1 | 3300050510 | Bacteria | 13937 |
| 271 | nmdc:mga06r32_3841_c1 | 3300050510 | Bacteria | 13443 |
| 272 | nmdc:mga08x19_4200_c1 | 3300050514 | Bacteria | 8533 |
| 273 | nmdc:mga0a205_168384_c1 | 3300050515 | Bacteria | 2086 |
| 274 | Ga0500556_0000281 | 3300053104 | Bacteria | 40052 |
| 275 | Ga0500562_010433 | 3300053108 | Bacteria | 2354 |
| 276 | Ga0500637_0121439 | 3300053178 | Bacteria | 1516 |
| 277 | Ga0501084_0024754 | 3300054114 | Bacteria | 5009 |
| 278 | Ga0501084_0048893 | 3300054114 | Bacteria | 3540 |
| 279 | Ga0501082_0058538 | 3300060353 | Bacteria | 3320 |
| 280 | Ga0501082_0059005 | 3300060353 | Bacteria | 3307 |
| 281 | Ga0501082_0068041 | 3300060353 | Bacteria | 3067 |
| 282 | Ga0530510_0052041 | 3300061734 | Bacteria | 2959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10483776 | Ga0163162_104837762 | 228 |
| 2 | 3300005842 | Ga0068858_100000928 | Ga0068858_10000092821 | 233 |
| 3 | 3300026035 | Ga0207703_10000617 | Ga0207703_1000061716 | 233 |
| 4 | 3300048924 | Ga0496121_0271808 | Ga0496121_0271808_419_1144 | 239 |
| 5 | 3300048929 | Ga0496126_0219991 | Ga0496126_0219991_822_1547 | 239 |
| 6 | 3300009148 | Ga0105243_10668926 | Ga0105243_106689262 | 242 |
| 7 | 3300049585 | Ga0501069_0114636 | Ga0501069_0114636_92_832 | 242 |
| 8 | 3300049582 | Ga0501048_0158024 | Ga0501048_0158024_845_1579 | 244 |
| 9 | 3300049592 | Ga0501076_0341607 | Ga0501076_0341607_21_755 | 244 |
| 10 | 3300039447 | Ga0436361_0499976 | Ga0436361_0499976_158_931 | 248 |
| 11 | 3300028379 | Ga0268266_10096280 | Ga0268266_100962803 | 249 |
| 12 | 3300021361 | Ga0213872_10009803 | Ga0213872_100098034 | 260 |
| 13 | 3300039447 | Ga0436361_0277890 | Ga0436361_0277890_869_1702 | 260 |
| 14 | 3300053178 | Ga0500637_0121439 | Ga0500637_0121439_553_1395 | 260 |
| 15 | 3300049581 | Ga0501047_0107519 | Ga0501047_0107519_1008_1802 | 261 |
| 16 | 3300039450 | Ga0436363_0048675 | Ga0436363_0048675_29_847 | 262 |
| 17 | 3300036401 | Ga0373937_0017944 | Ga0373937_0017944_3660_4505 | 264 |
| 18 | 3300044673 | Ga0453683_0018547 | Ga0453683_0018547_1564_2409 | 264 |
| 19 | 3300045051 | Ga0451576_0001922 | Ga0451576_0001922_23647_24492 | 264 |
| 20 | 3300049744 | Ga0501083_0051330 | Ga0501083_0051330_253_1050 | 265 |
| 21 | 3300053108 | Ga0500562_010433 | Ga0500562_010433_1031_1906 | 266 |
| 22 | 3300005436 | Ga0070713_100425108 | Ga0070713_1004251082 | 267 |
| 23 | 3300031247 | Ga0265340_10111377 | Ga0265340_101113772 | 267 |
| 24 | 3300031250 | Ga0265331_10000805 | Ga0265331_1000080515 | 267 |
| 25 | 3300031595 | Ga0265313_10000622 | Ga0265313_1000062227 | 267 |
| 26 | 3300031711 | Ga0265314_10050412 | Ga0265314_100504122 | 267 |
| 27 | 3300031712 | Ga0265342_10011322 | Ga0265342_100113223 | 267 |
| 28 | 3300045051 | Ga0451576_0198803 | Ga0451576_0198803_314_1171 | 267 |
| 29 | 3300005455 | Ga0070663_100025295 | Ga0070663_1000252952 | 268 |
| 30 | 3300025912 | Ga0207707_10175327 | Ga0207707_101753271 | 268 |
| 31 | 3300049578 | Ga0501042_0096954 | Ga0501042_0096954_14_883 | 268 |
| 32 | 3300035112 | Ga0373932_0073460 | Ga0373932_0073460_82_966 | 270 |
| 33 | 3300060353 | Ga0501082_0059005 | Ga0501082_0059005_1049_1903 | 270 |
| 34 | 3300049576 | Ga0501040_0100555 | Ga0501040_0100555_1047_1928 | 271 |
| 35 | 3300049824 | Ga0501045_0250336 | Ga0501045_0250336_349_1230 | 271 |
| 36 | 3300005367 | Ga0070667_100024144 | Ga0070667_1000241444 | 272 |
| 37 | 3300013306 | Ga0163162_10720544 | Ga0163162_107205441 | 272 |
| 38 | 3300021441 | Ga0213871_10048881 | Ga0213871_100488812 | 272 |
| 39 | 3300039438 | Ga0436360_0030258 | Ga0436360_0030258_708_1550 | 272 |
| 40 | 3300039438 | Ga0436360_0411737 | Ga0436360_0411737_81_989 | 272 |
| 41 | 3300054114 | Ga0501084_0048893 | Ga0501084_0048893_859_1746 | 272 |
| 42 | iso_pu_bacteria | 3003665799 | 3003668911 | 272 |
| 43 | 3300036647 | Ga0316582_0079099 | Ga0316582_0079099_1158_2039 | 273 |
| 44 | 3300039437 | Ga0436365_1934223 | Ga0436365_1934223_1040_1870 | 273 |
| 45 | 3300039450 | Ga0436363_1120322 | Ga0436363_1120322_140_991 | 273 |
| 46 | 3300049572 | Ga0501036_0040247 | Ga0501036_0040247_2397_3284 | 273 |
| 47 | 3300049575 | Ga0501039_0073384 | Ga0501039_0073384_235_1122 | 273 |
| 48 | 3300049587 | Ga0501071_0115039 | Ga0501071_0115039_1079_1966 | 273 |
| 49 | 3300049593 | Ga0501077_0018145 | Ga0501077_0018145_3209_4096 | 273 |
| 50 | 3300049741 | Ga0501079_0268450 | Ga0501079_0268450_81_968 | 273 |
| 51 | 3300031240 | Ga0265320_10002022 | Ga0265320_100020227 | 274 |
| 52 | 3300031711 | Ga0265314_10007116 | Ga0265314_100071166 | 274 |
| 53 | 3300049585 | Ga0501069_0092932 | Ga0501069_0092932_521_1402 | 274 |
| 54 | 3300005336 | Ga0070680_100002988 | Ga0070680_10000298811 | 275 |
| 55 | 3300005458 | Ga0070681_10000987 | Ga0070681_1000098713 | 275 |
| 56 | 3300005530 | Ga0070679_100007116 | Ga0070679_1000071165 | 275 |
| 57 | 3300005578 | Ga0068854_100022782 | Ga0068854_1000227823 | 275 |
| 58 | 3300009093 | Ga0105240_10050366 | Ga0105240_100503663 | 275 |
| 59 | 3300013104 | Ga0157370_10003504 | Ga0157370_100035048 | 275 |
| 60 | 3300021388 | Ga0213875_10002240 | Ga0213875_1000224011 | 275 |
| 61 | 3300025912 | Ga0207707_10004835 | Ga0207707_100048354 | 275 |
| 62 | 3300025917 | Ga0207660_10011410 | Ga0207660_100114103 | 275 |
| 63 | 3300025921 | Ga0207652_10003311 | Ga0207652_100033118 | 275 |
| 64 | 3300025981 | Ga0207640_10016713 | Ga0207640_100167133 | 275 |
| 65 | 3300029957 | Ga0265324_10003964 | Ga0265324_100039647 | 275 |
| 66 | 3300031239 | Ga0265328_10008671 | Ga0265328_100086714 | 275 |
| 67 | 3300031250 | Ga0265331_10000644 | Ga0265331_1000064412 | 275 |
| 68 | 3300044712 | Ga0453684_0162142 | Ga0453684_0162142_1369_2211 | 275 |
| 69 | 3300003316 | rootH1_10044830 | rootH1_100448302 | 276 |
| 70 | 3300005539 | Ga0068853_100258435 | Ga0068853_1002584352 | 276 |
| 71 | 3300009093 | Ga0105240_10038880 | Ga0105240_100388804 | 276 |
| 72 | 3300009551 | Ga0105238_10151857 | Ga0105238_101518572 | 276 |
| 73 | 3300009553 | Ga0105249_10006995 | Ga0105249_100069957 | 276 |
| 74 | 3300025913 | Ga0207695_10240011 | Ga0207695_102400112 | 276 |
| 75 | 3300025924 | Ga0207694_10126003 | Ga0207694_101260032 | 276 |
| 76 | 3300025961 | Ga0207712_10087588 | Ga0207712_100875883 | 276 |
| 77 | 3300028379 | Ga0268266_10004656 | Ga0268266_100046569 | 276 |
| 78 | 3300028380 | Ga0268265_10003022 | Ga0268265_100030224 | 276 |
| 79 | 3300031548 | Ga0307408_100024537 | Ga0307408_1000245372 | 276 |
| 80 | 3300039062 | Ga0400483_249811 | Ga0400483_249811_2422_3258 | 276 |
| 81 | 3300039453 | Ga0436362_0332318 | Ga0436362_0332318_930_1769 | 276 |
| 82 | 3300049577 | Ga0501041_0197376 | Ga0501041_0197376_238_1125 | 276 |
| 83 | 3300060353 | Ga0501082_0058538 | Ga0501082_0058538_999_1886 | 276 |
| 84 | 3300031251 | Ga0265327_10000460 | Ga0265327_1000046013 | 277 |
| 85 | 3300031595 | Ga0265313_10000529 | Ga0265313_1000052933 | 277 |
| 86 | 3300049575 | Ga0501039_0064394 | Ga0501039_0064394_159_1001 | 277 |
| 87 | iso_pu_bacteria | 2545555834 | 2545672826 | 277 |
| 88 | iso_pu_bacteria | 641522639 | 641640542 | 277 |
| 89 | 3300039447 | Ga0436361_0830018 | Ga0436361_0830018_568_1428 | 278 |
| 90 | 3300048909 | Ga0496106_0346860 | Ga0496106_0346860_222_1064 | 278 |
| 91 | 3300048918 | Ga0496115_0205501 | Ga0496115_0205501_562_1404 | 278 |
| 92 | 3300048919 | Ga0496116_0082773 | Ga0496116_0082773_1096_1938 | 278 |
| 93 | 3300048920 | Ga0496117_0000152 | Ga0496117_0000152_98655_99497 | 278 |
| 94 | 3300048921 | Ga0496118_0000052 | Ga0496118_0000052_84312_85154 | 278 |
| 95 | 3300048922 | Ga0496119_0000151 | Ga0496119_0000151_28332_29177 | 278 |
| 96 | 3300048922 | Ga0496119_0012647 | Ga0496119_0012647_3141_3983 | 278 |
| 97 | 3300048923 | Ga0496120_0000286 | Ga0496120_0000286_45198_46043 | 278 |
| 98 | 3300048923 | Ga0496120_0011408 | Ga0496120_0011408_955_1797 | 278 |
| 99 | 3300048923 | Ga0496120_0029688 | Ga0496120_0029688_1564_2406 | 278 |
| 100 | 3300048924 | Ga0496121_0085661 | Ga0496121_0085661_1599_2441 | 278 |
| 101 | 3300048927 | Ga0496124_0020815 | Ga0496124_0020815_3631_4473 | 278 |
| 102 | 3300048928 | Ga0496125_0047616 | Ga0496125_0047616_1887_2729 | 278 |
| 103 | 3300048929 | Ga0496126_0024812 | Ga0496126_0024812_1873_2715 | 278 |
| 104 | iso_pu_bacteria | 643348564 | 643603053 | 278 |
| 105 | 3300031727 | Ga0316576_10010503 | Ga0316576_100105036 | 279 |
| 106 | 3300036712 | Ga0316584_0287472 | Ga0316584_0287472_170_1009 | 279 |
| 107 | 3300037853 | Ga0436364_0519232 | Ga0436364_0519232_2282_3274 | 279 |
| 108 | 3300005331 | Ga0070670_100051453 | Ga0070670_1000514533 | 280 |
| 109 | 3300005367 | Ga0070667_100032838 | Ga0070667_1000328383 | 280 |
| 110 | 3300005617 | Ga0068859_100296307 | Ga0068859_1002963072 | 280 |
| 111 | 3300005841 | Ga0068863_100001132 | Ga0068863_10000113220 | 280 |
| 112 | 3300005843 | Ga0068860_100001736 | Ga0068860_10000173617 | 280 |
| 113 | 3300006177 | Ga0075362_10000932 | Ga0075362_100009327 | 280 |
| 114 | 3300009098 | Ga0105245_10194591 | Ga0105245_101945912 | 280 |
| 115 | 3300009101 | Ga0105247_10004946 | Ga0105247_100049465 | 280 |
| 116 | 3300009545 | Ga0105237_10146561 | Ga0105237_101465613 | 280 |
| 117 | 3300009545 | Ga0105237_10218231 | Ga0105237_102182313 | 280 |
| 118 | 3300009545 | Ga0105237_10223610 | Ga0105237_102236102 | 280 |
| 119 | 3300009551 | Ga0105238_10047304 | Ga0105238_100473043 | 280 |
| 120 | 3300010375 | Ga0105239_10911876 | Ga0105239_109118761 | 280 |
| 121 | 3300013306 | Ga0163162_10288140 | Ga0163162_102881402 | 280 |
| 122 | 3300014968 | Ga0157379_10236346 | Ga0157379_102363462 | 280 |
| 123 | 3300025900 | Ga0207710_10010896 | Ga0207710_100108964 | 280 |
| 124 | 3300025903 | Ga0207680_10088069 | Ga0207680_100880692 | 280 |
| 125 | 3300025914 | Ga0207671_10034651 | Ga0207671_100346513 | 280 |
| 126 | 3300025924 | Ga0207694_10086832 | Ga0207694_100868322 | 280 |
| 127 | 3300025986 | Ga0207658_10263637 | Ga0207658_102636372 | 280 |
| 128 | 3300026078 | Ga0207702_10414777 | Ga0207702_104147772 | 280 |
| 129 | 3300026088 | Ga0207641_10000289 | Ga0207641_1000028923 | 280 |
| 130 | 3300033180 | Ga0307510_10000010 | Ga0307510_10000010217 | 280 |
| 131 | 3300035725 | Ga0373947_0270634 | Ga0373947_0270634_201_1052 | 280 |
| 132 | 3300048911 | Ga0496108_0253276 | Ga0496108_0253276_237_1088 | 280 |
| 133 | 3300048924 | Ga0496121_0103556 | Ga0496121_0103556_531_1391 | 280 |
| 134 | 3300048928 | Ga0496125_0001409 | Ga0496125_0001409_22948_23808 | 280 |
| 135 | 3300048929 | Ga0496126_0011622 | Ga0496126_0011622_4749_5609 | 280 |
| 136 | 3300050515 | nmdc:mga0a205_168384_c1 | nmdc:mga0a205_168384_c1_647_1498 | 280 |
| 137 | iso_pu_bacteria | 2821443989 | 2821447918 | 280 |
| 138 | 3300006846 | Ga0075430_100034707 | Ga0075430_1000347073 | 281 |
| 139 | 3300006847 | Ga0075431_100084383 | Ga0075431_1000843833 | 281 |
| 140 | 3300006847 | Ga0075431_100224968 | Ga0075431_1002249682 | 281 |
| 141 | 3300009147 | Ga0114129_10255584 | Ga0114129_102555842 | 281 |
| 142 | 3300049576 | Ga0501040_0159156 | Ga0501040_0159156_151_1002 | 281 |
| 143 | 3300049577 | Ga0501041_0155560 | Ga0501041_0155560_394_1245 | 281 |
| 144 | 3300049577 | Ga0501041_0166772 | Ga0501041_0166772_41_892 | 281 |
| 145 | 3300049582 | Ga0501048_0094320 | Ga0501048_0094320_458_1309 | 281 |
| 146 | 3300049591 | Ga0501075_0277091 | Ga0501075_0277091_283_1134 | 281 |
| 147 | 3300049743 | Ga0501081_0112307 | Ga0501081_0112307_262_1113 | 281 |
| 148 | 3300049824 | Ga0501045_0258162 | Ga0501045_0258162_40_891 | 281 |
| 149 | 3300050507 | nmdc:mga05p37_205693_c1 | nmdc:mga05p37_205693_c1_778_1629 | 281 |
| 150 | 3300050509 | nmdc:mga0qj67_84114_c1 | nmdc:mga0qj67_84114_c1_1556_2407 | 281 |
| 151 | 3300050510 | nmdc:mga06r32_208476_c1 | nmdc:mga06r32_208476_c1_716_1567 | 281 |
| 152 | 3300050510 | nmdc:mga06r32_3543_c1 | nmdc:mga06r32_3543_c1_1074_1925 | 281 |
| 153 | 3300060353 | Ga0501082_0068041 | Ga0501082_0068041_800_1651 | 281 |
| 154 | iso_pu_bacteria | 2884298095 | 2884301316 | 281 |
| 155 | 3300037068 | Ga0373925_0279443 | Ga0373925_0279443_243_1145 | 282 |
| 156 | 3300039447 | Ga0436361_0282068 | Ga0436361_0282068_214_1065 | 282 |
| 157 | 3300010159 | Ga0099796_10003373 | Ga0099796_100033732 | 283 |
| 158 | 3300033180 | Ga0307510_10011156 | Ga0307510_100111564 | 283 |
| 159 | 3300039062 | Ga0400483_050342 | Ga0400483_050342_611_1474 | 283 |
| 160 | iso_pu_bacteria | 2728368998 | 2728752562 | 283 |
| 161 | 3300033180 | Ga0307510_10127981 | Ga0307510_101279812 | 284 |
| 162 | 3300035113 | Ga0373936_0016128 | Ga0373936_0016128_1994_2848 | 284 |
| 163 | 3300037853 | Ga0436364_0048878 | Ga0436364_0048878_1311_2174 | 284 |
| 164 | 3300039110 | Ga0400487_14027 | Ga0400487_14027_347_1210 | 284 |
| 165 | 3300044712 | Ga0453684_0000015 | Ga0453684_0000015_590438_591292 | 284 |
| 166 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_610898_611752 | 284 |
| 167 | 3300044712 | Ga0453684_0130120 | Ga0453684_0130120_937_1797 | 284 |
| 168 | 3300049568 | Ga0501031_0100760 | Ga0501031_0100760_258_1145 | 284 |
| 169 | 3300049570 | Ga0501033_0071271 | Ga0501033_0071271_409_1296 | 284 |
| 170 | 3300049572 | Ga0501036_0037503 | Ga0501036_0037503_1837_2724 | 284 |
| 171 | 3300049574 | Ga0501038_0074949 | Ga0501038_0074949_1695_2582 | 284 |
| 172 | 3300049575 | Ga0501039_0015437 | Ga0501039_0015437_82_969 | 284 |
| 173 | 3300049576 | Ga0501040_0016470 | Ga0501040_0016470_268_1155 | 284 |
| 174 | 3300049578 | Ga0501042_0008458 | Ga0501042_0008458_3577_4464 | 284 |
| 175 | 3300049579 | Ga0501043_0090255 | Ga0501043_0090255_967_1854 | 284 |
| 176 | 3300049580 | Ga0501046_0035669 | Ga0501046_0035669_3042_3929 | 284 |
| 177 | 3300049582 | Ga0501048_0065480 | Ga0501048_0065480_1499_2386 | 284 |
| 178 | 3300049584 | Ga0501068_0043110 | Ga0501068_0043110_1196_2083 | 284 |
| 179 | 3300049587 | Ga0501071_0011454 | Ga0501071_0011454_986_1873 | 284 |
| 180 | 3300049588 | Ga0501072_0009672 | Ga0501072_0009672_5347_6234 | 284 |
| 181 | 3300049591 | Ga0501075_0012245 | Ga0501075_0012245_1263_2150 | 284 |
| 182 | 3300049593 | Ga0501077_0004078 | Ga0501077_0004078_1988_2875 | 284 |
| 183 | 3300049741 | Ga0501079_0159854 | Ga0501079_0159854_268_1155 | 284 |
| 184 | 3300049742 | Ga0501080_0103724 | Ga0501080_0103724_640_1527 | 284 |
| 185 | 3300049743 | Ga0501081_0118037 | Ga0501081_0118037_268_1155 | 284 |
| 186 | 3300049744 | Ga0501083_0086512 | Ga0501083_0086512_66_953 | 284 |
| 187 | 3300049822 | Ga0501035_0099152 | Ga0501035_0099152_839_1726 | 284 |
| 188 | 3300049824 | Ga0501045_0014577 | Ga0501045_0014577_1240_2127 | 284 |
| 189 | 3300050489 | nmdc:mga03683_307_c1 | nmdc:mga03683_307_c1_4567_5427 | 284 |
| 190 | 3300054114 | Ga0501084_0024754 | Ga0501084_0024754_240_1127 | 284 |
| 191 | 3300061734 | Ga0530510_0052041 | Ga0530510_0052041_447_1334 | 284 |
| 192 | 3300005467 | Ga0070706_100481726 | Ga0070706_1004817262 | 285 |
| 193 | 3300006177 | Ga0075362_10047528 | Ga0075362_100475282 | 285 |
| 194 | 3300006844 | Ga0075428_100445497 | Ga0075428_1004454972 | 285 |
| 195 | 3300006846 | Ga0075430_100093945 | Ga0075430_1000939454 | 285 |
| 196 | 3300006847 | Ga0075431_100018281 | Ga0075431_1000182819 | 285 |
| 197 | 3300006847 | Ga0075431_100286268 | Ga0075431_1002862682 | 285 |
| 198 | 3300050509 | nmdc:mga0qj67_4938_c1 | nmdc:mga0qj67_4938_c1_7708_8571 | 285 |
| 199 | 3300005545 | Ga0070695_100013985 | Ga0070695_1000139852 | 286 |
| 200 | 3300031727 | Ga0316576_10129441 | Ga0316576_101294412 | 286 |
| 201 | 3300005456 | Ga0070678_100045780 | Ga0070678_1000457802 | 287 |
| 202 | 3300005471 | Ga0070698_100627886 | Ga0070698_1006278861 | 287 |
| 203 | 3300014326 | Ga0157380_10763611 | Ga0157380_107636111 | 287 |
| 204 | 3300017792 | Ga0163161_10177171 | Ga0163161_101771712 | 287 |
| 205 | 3300031727 | Ga0316576_10041546 | Ga0316576_100415462 | 287 |
| 206 | 3300035398 | Ga0316574_0000057 | Ga0316574_0000057_18727_19593 | 287 |
| 207 | 3300036712 | Ga0316584_0060525 | Ga0316584_0060525_1233_2099 | 287 |
| 208 | 3300038735 | Ga0400485_18958 | Ga0400485_18958_477_1349 | 287 |
| 209 | 3300039437 | Ga0436365_0892608 | Ga0436365_0892608_2959_3843 | 287 |
| 210 | 3300039453 | Ga0436362_0293991 | Ga0436362_0293991_409_1281 | 287 |
| 211 | 3300039453 | Ga0436362_0958195 | Ga0436362_0958195_6274_7158 | 287 |
| 212 | 3300049743 | Ga0501081_0337621 | Ga0501081_0337621_144_1013 | 287 |
| 213 | iso_pu_bacteria | 8054563764 | 8054564272 | 287 |
| 214 | 3300005435 | Ga0070714_100143407 | Ga0070714_1001434071 | 288 |
| 215 | 3300005436 | Ga0070713_100020989 | Ga0070713_1000209891 | 288 |
| 216 | 3300005436 | Ga0070713_100213251 | Ga0070713_1002132511 | 288 |
| 217 | 3300005468 | Ga0070707_100003690 | Ga0070707_1000036904 | 288 |
| 218 | 3300005614 | Ga0068856_100011378 | Ga0068856_1000113787 | 288 |
| 219 | 3300005719 | Ga0068861_100464774 | Ga0068861_1004647741 | 288 |
| 220 | 3300006028 | Ga0070717_10056682 | Ga0070717_100566821 | 288 |
| 221 | 3300006881 | Ga0068865_100281456 | Ga0068865_1002814561 | 288 |
| 222 | 3300006914 | Ga0075436_100005588 | Ga0075436_1000055886 | 288 |
| 223 | 3300007076 | Ga0075435_100045372 | Ga0075435_1000453722 | 288 |
| 224 | 3300007788 | Ga0099795_10088711 | Ga0099795_100887111 | 288 |
| 225 | 3300009553 | Ga0105249_10019520 | Ga0105249_100195202 | 288 |
| 226 | 3300010159 | Ga0099796_10008581 | Ga0099796_100085812 | 288 |
| 227 | 3300013297 | Ga0157378_10253467 | Ga0157378_102534672 | 288 |
| 228 | 3300013306 | Ga0163162_10462466 | Ga0163162_104624662 | 288 |
| 229 | 3300014326 | Ga0157380_10091465 | Ga0157380_100914652 | 288 |
| 230 | 3300014497 | Ga0182008_10025893 | Ga0182008_100258931 | 288 |
| 231 | 3300014969 | Ga0157376_10170890 | Ga0157376_101708902 | 288 |
| 232 | 3300025906 | Ga0207699_10019305 | Ga0207699_100193051 | 288 |
| 233 | 3300025922 | Ga0207646_10013143 | Ga0207646_100131436 | 288 |
| 234 | 3300025928 | Ga0207700_10009550 | Ga0207700_100095505 | 288 |
| 235 | 3300025929 | Ga0207664_10024289 | Ga0207664_100242894 | 288 |
| 236 | 3300026089 | Ga0207648_10182859 | Ga0207648_101828592 | 288 |
| 237 | 3300035695 | Ga0373927_0034044 | Ga0373927_0034044_350_1327 | 288 |
| 238 | 3300037068 | Ga0373925_0105218 | Ga0373925_0105218_868_1845 | 288 |
| 239 | 3300048907 | Ga0496104_0096698 | Ga0496104_0096698_1733_2605 | 288 |
| 240 | 3300048915 | Ga0496112_0152752 | Ga0496112_0152752_36_908 | 288 |
| 241 | 3300048916 | Ga0496113_0010689 | Ga0496113_0010689_4901_5773 | 288 |
| 242 | 3300049593 | Ga0501077_0056962 | Ga0501077_0056962_1542_2414 | 288 |
| 243 | 3300050514 | nmdc:mga08x19_4200_c1 | nmdc:mga08x19_4200_c1_5773_6645 | 288 |
| 244 | 3300053104 | Ga0500556_0000281 | Ga0500556_0000281_26759_27634 | 288 |
| 245 | 3300025916 | Ga0207663_10129641 | Ga0207663_101296412 | 289 |
| 246 | 3300035113 | Ga0373936_0003546 | Ga0373936_0003546_1459_2343 | 289 |
| 247 | iso_pu_bacteria | 2844533157 | 2844533566 | 289 |
| 248 | 3300005356 | Ga0070674_100334416 | Ga0070674_1003344161 | 290 |
| 249 | 3300005436 | Ga0070713_100039676 | Ga0070713_1000396762 | 290 |
| 250 | 3300005439 | Ga0070711_100106817 | Ga0070711_1001068172 | 290 |
| 251 | 3300009094 | Ga0111539_10258457 | Ga0111539_102584572 | 290 |
| 252 | 3300013306 | Ga0163162_10629093 | Ga0163162_106290932 | 290 |
| 253 | 3300025915 | Ga0207693_10002515 | Ga0207693_1000251515 | 290 |
| 254 | 3300025916 | Ga0207663_10021382 | Ga0207663_100213822 | 290 |
| 255 | 3300025944 | Ga0207661_10104548 | Ga0207661_101045481 | 290 |
| 256 | 3300039062 | Ga0400483_013353 | Ga0400483_013353_1866_2765 | 290 |
| 257 | 3300050510 | nmdc:mga06r32_270596_c1 | nmdc:mga06r32_270596_c1_446_1324 | 290 |
| 258 | 3300050510 | nmdc:mga06r32_3841_c1 | nmdc:mga06r32_3841_c1_1162_2040 | 290 |
| 259 | 3300044712 | Ga0453684_0009064 | Ga0453684_0009064_12215_13114 | 291 |
| 260 | 3300005347 | Ga0070668_100033205 | Ga0070668_1000332052 | 292 |
| 261 | 3300005578 | Ga0068854_100397096 | Ga0068854_1003970962 | 292 |
| 262 | 3300005618 | Ga0068864_100384283 | Ga0068864_1003842832 | 292 |
| 263 | 3300005719 | Ga0068861_100026768 | Ga0068861_1000267683 | 292 |
| 264 | 3300005840 | Ga0068870_10133557 | Ga0068870_101335572 | 292 |
| 265 | 3300005843 | Ga0068860_100020344 | Ga0068860_1000203444 | 292 |
| 266 | 3300005844 | Ga0068862_100011369 | Ga0068862_1000113692 | 292 |
| 267 | 3300006881 | Ga0068865_100064148 | Ga0068865_1000641483 | 292 |
| 268 | 3300014968 | Ga0157379_10052090 | Ga0157379_100520903 | 292 |
| 269 | 3300017792 | Ga0163161_10009753 | Ga0163161_100097532 | 292 |
| 270 | 3300025935 | Ga0207709_10217354 | Ga0207709_102173542 | 292 |
| 271 | 3300025938 | Ga0207704_10046965 | Ga0207704_100469652 | 292 |
| 272 | 3300025972 | Ga0207668_10023580 | Ga0207668_100235802 | 292 |
| 273 | 3300026095 | Ga0207676_10203492 | Ga0207676_102034922 | 292 |
| 274 | 3300026118 | Ga0207675_100011404 | Ga0207675_1000114047 | 292 |
| 275 | 3300048904 | Ga0496101_0004187 | Ga0496101_0004187_4345_5238 | 292 |
| 276 | 3300048910 | Ga0496107_0000431 | Ga0496107_0000431_4586_5479 | 292 |
| 277 | 3300048917 | Ga0496114_0003041 | Ga0496114_0003041_11434_12327 | 292 |
| 278 | 3300048918 | Ga0496115_0075047 | Ga0496115_0075047_437_1330 | 292 |
| 279 | 3300003187 | JGI25151J46595_10000124 | JGI25151J46595_1000012462 | 293 |
| 280 | 3300003354 | JGI25160J50197_1004916 | JGI25160J50197_10049162 | 293 |
| 281 | 3300025284 | Ga0209130_1000270 | Ga0209130_100027027 | 293 |
| 282 | 3300025294 | Ga0209025_1000705 | Ga0209025_100070513 | 293 |
| 283 | 3300025297 | Ga0209758_1004689 | Ga0209758_10046899 | 293 |
| 284 | 3300025302 | Ga0207426_1000443 | Ga0207426_100044359 | 293 |
| 285 | 3300035112 | Ga0373932_0012655 | Ga0373932_0012655_405_1346 | 293 |
| 286 | 3300035114 | Ga0373939_0012820 | Ga0373939_0012820_377_1318 | 293 |
| 287 | 3300045051 | Ga0451576_0206403 | Ga0451576_0206403_870_1781 | 293 |
| 288 | 3300046512 | Ga0495610_0009610 | Ga0495610_0009610_4071_4952 | 293 |
| 289 | 3300049572 | Ga0501036_0085709 | Ga0501036_0085709_1236_2150 | 293 |
| 290 | 3300049578 | Ga0501042_0147920 | Ga0501042_0147920_570_1484 | 293 |
| 291 | 3300049582 | Ga0501048_0058777 | Ga0501048_0058777_712_1626 | 293 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ius-assembly2.cif.gz_B | the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss | 0.9482 | 7 | 293 |
| 3ius-assembly1.cif.gz_A | the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss | 0.9478 | 7 | 290 |
| 3ius-assembly2.cif.gz_B | the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss | 0.9416 | 7 | 293 |
| 3ius-assembly1.cif.gz_A | the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss | 0.9315 | 7 | 290 |
| 1ky5-assembly1.cif.gz_B | d244e mutant s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints | 0.8449 | 7 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iusB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9447 | 7 | 293 | 3.40.50.720 |
| 3iusB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.938 | 7 | 293 | 3.40.50.720 |
| af_B4F8E5_18_318_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8684 | 5 | 290 | 3.40.50.720 |
| af_Q0D7W4_71_358_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8659 | 6 | 39 | 3.50.50.60 |
| af_K7M5D4_27_313_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8473 | 4 | 275 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Z8SCE3-F1-model_v4 | deleted | 0.9866 | 2 | 291 |
|
| AF-A0A437QNC7-F1-model_v4 | SDR family oxidoreductase | 0.985 | 6 | 287 |
|
| AF-A0A849ECK4-F1-model_v4 | SDR family oxidoreductase | 0.9816 | 66 | 287 |
|
| AF-A0A2S5MD92-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9814 | 7 | 291 |
|
| AF-A0A327JLY9-F1-model_v4 | deleted | 0.9767 | 99 | 292 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar