F390455

General Info

Members Datasets Scaffolds Average Seq Length
291 193 282 285

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0034044|Ga0373927_0034044_350_1327
Length 325
Sequence VRRHLLCFGLGYTARALARILGPDWSITGTSRDEEPRASSRGANFRWLRFDRDHPLEPVVFAGVTHVLVSVPPDEAGDPVLDRHRDDMAAISGLAWLGYLSTTGVYGNRDGGWVDEHSESSPSGARGRRRAAAEAAWLDLSRDRGLPVHVFRLAGIYGPGRSPFDALRAGTAKRIDKPGQVFSRIHVDDIANVLMASIARPRPGAIYNVCDDEPAASAEVIAHAAGLLGVAPPPLLPFETAGLSTMARSFYDDSKRVSNALIKSELGVSLRYPTYRDGLAAILAVESIRSRAGLEACPAPRHPASSAPAGGRGAASATDPAKEER

Samples

Sample ID Description Type Environment
1 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
2 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
3 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
6 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
125 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
126 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 641522639 Methylobacterium sp. 4-46 Isolate Nodule
192 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
193 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0
Isolates 3.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 1.37
Rhizoplane 3.44
Rhizosphere 78.35
Stem 0
Stem Tuber 0
Unclassified 12.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000124 3300003187 Bacteria 105038
2 rootH1_10044830 3300003316 Bacteria 4196
3 JGI25160J50197_1004916 3300003354 Bacteria 5688
4 Ga0070670_100051453 3300005331 Unclassified 3537
5 Ga0070680_100002988 3300005336 Bacteria 12555
6 Ga0070668_100033205 3300005347 Bacteria 3928
7 Ga0070674_100334416 3300005356 Unclassified 1218
8 Ga0070667_100024144 3300005367 Bacteria 5049
9 Ga0070667_100032838 3300005367 Unclassified 4331
10 Ga0070714_100143407 3300005435 Bacteria 2146
11 Ga0070713_100020989 3300005436 Bacteria 5015
12 Ga0070713_100039676 3300005436 Bacteria 3823
13 Ga0070713_100213251 3300005436 Bacteria 1749
14 Ga0070713_100425108 3300005436 Bacteria 1244
15 Ga0070711_100106817 3300005439 Bacteria 2047
16 Ga0070663_100025295 3300005455 Bacteria 4006
17 Ga0070678_100045780 3300005456 Bacteria 3132
18 Ga0070681_10000987 3300005458 Bacteria 24071
19 Ga0070706_100481726 3300005467 Bacteria 1154
20 Ga0070707_100003690 3300005468 Bacteria 14447
21 Ga0070698_100627886 3300005471 Bacteria 1015
22 Ga0070679_100007116 3300005530 Bacteria 10442
23 Ga0068853_100258435 3300005539 Bacteria 1600
24 Ga0070695_100013985 3300005545 Bacteria 4832
25 Ga0068854_100022782 3300005578 Bacteria 4273
26 Ga0068854_100397096 3300005578 Bacteria 1140
27 Ga0068856_100011378 3300005614 Bacteria 8632
28 Ga0068859_100296307 3300005617 Bacteria 1711
29 Ga0068864_100384283 3300005618 Bacteria 1331
30 Ga0068861_100026768 3300005719 Bacteria 4196
31 Ga0068861_100464774 3300005719 Bacteria 1136
32 Ga0068870_10133557 3300005840 Bacteria 1444
33 Ga0068863_100001132 3300005841 Bacteria 26633
34 Ga0068858_100000928 3300005842 Bacteria 30413
35 Ga0068860_100001736 3300005843 Bacteria 23228
36 Ga0068860_100020344 3300005843 Bacteria 6428
37 Ga0068862_100011369 3300005844 Bacteria 7350
38 Ga0070717_10056682 3300006028 Bacteria 3238
39 Ga0075362_10000932 3300006177 Bacteria 8914
40 Ga0075362_10047528 3300006177 Bacteria 1912
41 Ga0075428_100445497 3300006844 Bacteria 1387
42 Ga0075430_100034707 3300006846 Bacteria 4282
43 Ga0075430_100093945 3300006846 Bacteria 2507
44 Ga0075431_100018281 3300006847 Bacteria 7132
45 Ga0075431_100084383 3300006847 Bacteria 3279
46 Ga0075431_100224968 3300006847 Bacteria 1913
47 Ga0075431_100286268 3300006847 Bacteria 1668
48 Ga0068865_100064148 3300006881 Bacteria 2584
49 Ga0068865_100281456 3300006881 Bacteria 1324
50 Ga0075436_100005588 3300006914 Bacteria 8630
51 Ga0075435_100045372 3300007076 Bacteria 3523
52 Ga0099795_10088711 3300007788 Bacteria 1196
53 Ga0105240_10038880 3300009093 Bacteria 6099
54 Ga0105240_10050366 3300009093 Bacteria 5251
55 Ga0111539_10258457 3300009094 Bacteria 2027
56 Ga0105245_10194591 3300009098 Bacteria 1944
57 Ga0105247_10004946 3300009101 Bacteria 8468
58 Ga0114129_10255584 3300009147 Bacteria 2350
59 Ga0105243_10668926 3300009148 Bacteria 1008
60 Ga0105237_10146561 3300009545 Bacteria 2356
61 Ga0105237_10218231 3300009545 Unclassified 1907
62 Ga0105237_10223610 3300009545 Bacteria 1883
63 Ga0105238_10047304 3300009551 Bacteria 4339
64 Ga0105238_10151857 3300009551 Bacteria 2291
65 Ga0105249_10006995 3300009553 Bacteria 9844
66 Ga0105249_10019520 3300009553 Bacteria 6049
67 Ga0099796_10003373 3300010159 Bacteria 3696
68 Ga0099796_10008581 3300010159 Bacteria 2729
69 Ga0105239_10911876 3300010375 Bacteria 1009
70 Ga0157370_10003504 3300013104 Bacteria 18396
71 Ga0157378_10253467 3300013297 Bacteria 1686
72 Ga0163162_10288140 3300013306 Bacteria 1774
73 Ga0163162_10462466 3300013306 Bacteria 1400
74 Ga0163162_10483776 3300013306 Bacteria 1369
75 Ga0163162_10629093 3300013306 Bacteria 1198
76 Ga0163162_10720544 3300013306 Bacteria 1118
77 Ga0157380_10091465 3300014326 Bacteria 2512
78 Ga0157380_10763611 3300014326 Bacteria 980
79 Ga0182008_10025893 3300014497 Bacteria 2977
80 Ga0157379_10052090 3300014968 Bacteria 3655
81 Ga0157379_10236346 3300014968 Bacteria 1657
82 Ga0157376_10170890 3300014969 Bacteria 1979
83 Ga0163161_10009753 3300017792 Bacteria 6653
84 Ga0163161_10177171 3300017792 Bacteria 1633
85 Ga0213872_10009803 3300021361 Bacteria 4578
86 Ga0213875_10002240 3300021388 Bacteria 11732
87 Ga0213871_10048881 3300021441 Unclassified 1154
88 Ga0209130_1000270 3300025284 Bacteria 65057
89 Ga0209025_1000705 3300025294 Bacteria 56926
90 Ga0209758_1004689 3300025297 Bacteria 11165
91 Ga0207426_1000443 3300025302 Bacteria 66593
92 Ga0207710_10010896 3300025900 Bacteria 3829
93 Ga0207680_10088069 3300025903 Unclassified 1967
94 Ga0207699_10019305 3300025906 Bacteria 3632
95 Ga0207707_10004835 3300025912 Bacteria 11814
96 Ga0207707_10175327 3300025912 Bacteria 1873
97 Ga0207695_10240011 3300025913 Bacteria 1714
98 Ga0207671_10034651 3300025914 Bacteria 3750
99 Ga0207693_10002515 3300025915 Bacteria 15940
100 Ga0207663_10021382 3300025916 Bacteria 3682
101 Ga0207663_10129641 3300025916 Bacteria 1741
102 Ga0207660_10011410 3300025917 Bacteria 5780
103 Ga0207652_10003311 3300025921 Bacteria 13341
104 Ga0207646_10013143 3300025922 Bacteria 7924
105 Ga0207694_10086832 3300025924 Bacteria 2463
106 Ga0207694_10126003 3300025924 Bacteria 2049
107 Ga0207700_10009550 3300025928 Bacteria 6070
108 Ga0207664_10024289 3300025929 Bacteria 4553
109 Ga0207709_10217354 3300025935 Bacteria 1376
110 Ga0207704_10046965 3300025938 Bacteria 2578
111 Ga0207661_10104548 3300025944 Unclassified 2385
112 Ga0207712_10087588 3300025961 Unclassified 2284
113 Ga0207668_10023580 3300025972 Bacteria 3958
114 Ga0207640_10016713 3300025981 Bacteria 4276
115 Ga0207658_10263637 3300025986 Unclassified 1469
116 Ga0207703_10000617 3300026035 Bacteria 35947
117 Ga0207702_10414777 3300026078 Unclassified 1301
118 Ga0207641_10000289 3300026088 Bacteria 62844
119 Ga0207648_10182859 3300026089 Bacteria 1856
120 Ga0207676_10203492 3300026095 Bacteria 1751
121 Ga0207675_100011404 3300026118 Bacteria 8318
122 Ga0268266_10004656 3300028379 Bacteria 13072
123 Ga0268266_10096280 3300028379 Unclassified 2601
124 Ga0268265_10003022 3300028380 Bacteria 12274
125 Ga0265324_10003964 3300029957 Bacteria 6844
126 Ga0265328_10008671 3300031239 Bacteria 4177
127 Ga0265320_10002022 3300031240 Bacteria 14313
128 Ga0265340_10111377 3300031247 Bacteria 1265
129 Ga0265331_10000644 3300031250 Bacteria 30205
130 Ga0265331_10000805 3300031250 Bacteria 25935
131 Ga0265327_10000460 3300031251 Bacteria 73013
132 Ga0307408_100024537 3300031548 Bacteria 4119
133 Ga0265313_10000529 3300031595 Bacteria 39938
134 Ga0265313_10000622 3300031595 Bacteria 36655
135 Ga0265314_10007116 3300031711 Bacteria 9753
136 Ga0265314_10050412 3300031711 Bacteria 2908
137 Ga0265342_10011322 3300031712 Bacteria 6115
138 Ga0316576_10010503 3300031727 Bacteria 6020
139 Ga0316576_10041546 3300031727 Bacteria 3311
140 Ga0316576_10129441 3300031727 Bacteria 1899
141 Ga0307510_10000010 3300033180 Bacteria 377457
142 Ga0307510_10011156 3300033180 Bacteria 10685
143 Ga0307510_10127981 3300033180 Bacteria 2222
144 Ga0373932_0012655 3300035112 Bacteria 2082
145 Ga0373932_0073460 3300035112 Bacteria 1066
146 Ga0373936_0003546 3300035113 Bacteria 5871
147 Ga0373936_0016128 3300035113 Bacteria 2871
148 Ga0373939_0012820 3300035114 Bacteria 2145
149 Ga0316574_0000057 3300035398 Bacteria 29135
150 Ga0373927_0034044 3300035695 Bacteria 3315
151 Ga0373947_0270634 3300035725 Bacteria 1128
152 Ga0373937_0017944 3300036401 Bacteria 6313
153 Ga0316582_0079099 3300036647 Bacteria 2143
154 Ga0316584_0060525 3300036712 Bacteria 2836
155 Ga0316584_0287472 3300036712 Bacteria 1193
156 Ga0373925_0105218 3300037068 Bacteria 2174
157 Ga0373925_0279443 3300037068 Bacteria 1344
158 Ga0436364_0048878 3300037853 Bacteria 2441
159 Ga0436364_0519232 3300037853 Bacteria 78366
160 Ga0400485_18958 3300038735 Bacteria 2189
161 Ga0400483_013353 3300039062 Bacteria 2968
162 Ga0400483_050342 3300039062 Bacteria 2427
163 Ga0400483_249811 3300039062 Bacteria 3970
164 Ga0400487_14027 3300039110 Bacteria 3449
165 Ga0436365_0892608 3300039437 Bacteria 3891
166 Ga0436365_1934223 3300039437 Bacteria 2760
167 Ga0436360_0030258 3300039438 Bacteria 4242
168 Ga0436360_0411737 3300039438 Bacteria 1799
169 Ga0436361_0277890 3300039447 Bacteria 6008
170 Ga0436361_0282068 3300039447 Bacteria 1172
171 Ga0436361_0499976 3300039447 Bacteria 1047
172 Ga0436361_0830018 3300039447 Bacteria 1537
173 Ga0436363_0048675 3300039450 Bacteria 1024
174 Ga0436363_1120322 3300039450 Bacteria 1116
175 Ga0436362_0293991 3300039453 Bacteria 1339
176 Ga0436362_0332318 3300039453 Bacteria 1808
177 Ga0436362_0958195 3300039453 Bacteria 7517
178 Ga0453683_0018547 3300044673 Bacteria 4467
179 Ga0453684_0000015 3300044712 Bacteria 969198
180 Ga0453684_0000020 3300044712 Bacteria 879938
181 Ga0453684_0009064 3300044712 Bacteria 17558
182 Ga0453684_0130120 3300044712 Bacteria 3021
183 Ga0453684_0162142 3300044712 Bacteria 2643
184 Ga0451576_0001922 3300045051 Bacteria 33279
185 Ga0451576_0198803 3300045051 Bacteria 2094
186 Ga0451576_0206403 3300045051 Bacteria 2052
187 Ga0495610_0009610 3300046512 Bacteria 6097
188 Ga0496101_0004187 3300048904 Bacteria 9040
189 Ga0496104_0096698 3300048907 Bacteria 2825
190 Ga0496106_0346860 3300048909 Bacteria 1192
191 Ga0496107_0000431 3300048910 Bacteria 22701
192 Ga0496108_0253276 3300048911 Bacteria 1532
193 Ga0496112_0152752 3300048915 Bacteria 2276
194 Ga0496113_0010689 3300048916 Bacteria 6080
195 Ga0496114_0003041 3300048917 Bacteria 12849
196 Ga0496115_0075047 3300048918 Bacteria 2746
197 Ga0496115_0205501 3300048918 Bacteria 1627
198 Ga0496116_0082773 3300048919 Bacteria 1984
199 Ga0496117_0000152 3300048920 Bacteria 147897
200 Ga0496118_0000052 3300048921 Bacteria 237465
201 Ga0496119_0000151 3300048922 Bacteria 96860
202 Ga0496119_0012647 3300048922 Bacteria 6829
203 Ga0496120_0000286 3300048923 Bacteria 84869
204 Ga0496120_0011408 3300048923 Bacteria 6112
205 Ga0496120_0029688 3300048923 Bacteria 3334
206 Ga0496121_0085661 3300048924 Bacteria 2479
207 Ga0496121_0103556 3300048924 Bacteria 2189
208 Ga0496121_0271808 3300048924 Unclassified 1164
209 Ga0496124_0020815 3300048927 Bacteria 6053
210 Ga0496125_0001409 3300048928 Bacteria 35088
211 Ga0496125_0047616 3300048928 Bacteria 3582
212 Ga0496126_0011622 3300048929 Bacteria 9087
213 Ga0496126_0024812 3300048929 Bacteria 5781
214 Ga0496126_0219991 3300048929 Unclassified 1595
215 Ga0501031_0100760 3300049568 Bacteria 1884
216 Ga0501033_0071271 3300049570 Bacteria 2553
217 Ga0501036_0037503 3300049572 Bacteria 4100
218 Ga0501036_0040247 3300049572 Bacteria 3953
219 Ga0501036_0085709 3300049572 Bacteria 2663
220 Ga0501038_0074949 3300049574 Bacteria 2861
221 Ga0501039_0015437 3300049575 Bacteria 5846
222 Ga0501039_0064394 3300049575 Bacteria 2842
223 Ga0501039_0073384 3300049575 Bacteria 2659
224 Ga0501040_0016470 3300049576 Bacteria 4894
225 Ga0501040_0100555 3300049576 Bacteria 2016
226 Ga0501040_0159156 3300049576 Bacteria 1596
227 Ga0501041_0155560 3300049577 Bacteria 1428
228 Ga0501041_0166772 3300049577 Bacteria 1378
229 Ga0501041_0197376 3300049577 Bacteria 1261
230 Ga0501042_0008458 3300049578 Bacteria 6795
231 Ga0501042_0096954 3300049578 Bacteria 2119
232 Ga0501042_0147920 3300049578 Bacteria 1693
233 Ga0501043_0090255 3300049579 Bacteria 2409
234 Ga0501046_0035669 3300049580 Bacteria 4007
235 Ga0501047_0107519 3300049581 Bacteria 2671
236 Ga0501048_0058777 3300049582 Bacteria 2725
237 Ga0501048_0065480 3300049582 Bacteria 2569
238 Ga0501048_0094320 3300049582 Bacteria 2111
239 Ga0501048_0158024 3300049582 Bacteria 1604
240 Ga0501068_0043110 3300049584 Bacteria 2714
241 Ga0501069_0092932 3300049585 Bacteria 1707
242 Ga0501069_0114636 3300049585 Bacteria 1537
243 Ga0501071_0011454 3300049587 Bacteria 5975
244 Ga0501071_0115039 3300049587 Bacteria 1990
245 Ga0501072_0009672 3300049588 Bacteria 7332
246 Ga0501075_0012245 3300049591 Bacteria 6089
247 Ga0501075_0277091 3300049591 Bacteria 1278
248 Ga0501076_0341607 3300049592 Bacteria 1229
249 Ga0501077_0004078 3300049593 Bacteria 8819
250 Ga0501077_0018145 3300049593 Bacteria 4449
251 Ga0501077_0056962 3300049593 Bacteria 2482
252 Ga0501079_0159854 3300049741 Bacteria 1756
253 Ga0501079_0268450 3300049741 Bacteria 1334
254 Ga0501080_0103724 3300049742 Bacteria 2637
255 Ga0501081_0112307 3300049743 Bacteria 1934
256 Ga0501081_0118037 3300049743 Bacteria 1887
257 Ga0501081_0337621 3300049743 Bacteria 1109
258 Ga0501083_0051330 3300049744 Bacteria 2774
259 Ga0501083_0086512 3300049744 Bacteria 2073
260 Ga0501035_0099152 3300049822 Bacteria 2558
261 Ga0501045_0014577 3300049824 Bacteria 5572
262 Ga0501045_0250336 3300049824 Bacteria 1319
263 Ga0501045_0258162 3300049824 Bacteria 1297
264 nmdc:mga03683_307_c1 3300050489 Bacteria 14414
265 nmdc:mga05p37_205693_c1 3300050507 Bacteria 2381
266 nmdc:mga0qj67_4938_c1 3300050509 Bacteria 9695
267 nmdc:mga0qj67_84114_c1 3300050509 Bacteria 2551
268 nmdc:mga06r32_208476_c1 3300050510 Bacteria 1942
269 nmdc:mga06r32_270596_c1 3300050510 Bacteria 1686
270 nmdc:mga06r32_3543_c1 3300050510 Bacteria 13937
271 nmdc:mga06r32_3841_c1 3300050510 Bacteria 13443
272 nmdc:mga08x19_4200_c1 3300050514 Bacteria 8533
273 nmdc:mga0a205_168384_c1 3300050515 Bacteria 2086
274 Ga0500556_0000281 3300053104 Bacteria 40052
275 Ga0500562_010433 3300053108 Bacteria 2354
276 Ga0500637_0121439 3300053178 Bacteria 1516
277 Ga0501084_0024754 3300054114 Bacteria 5009
278 Ga0501084_0048893 3300054114 Bacteria 3540
279 Ga0501082_0058538 3300060353 Bacteria 3320
280 Ga0501082_0059005 3300060353 Bacteria 3307
281 Ga0501082_0068041 3300060353 Bacteria 3067
282 Ga0530510_0052041 3300061734 Bacteria 2959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10483776 Ga0163162_104837762 228
2 3300005842 Ga0068858_100000928 Ga0068858_10000092821 233
3 3300026035 Ga0207703_10000617 Ga0207703_1000061716 233
4 3300048924 Ga0496121_0271808 Ga0496121_0271808_419_1144 239
5 3300048929 Ga0496126_0219991 Ga0496126_0219991_822_1547 239
6 3300009148 Ga0105243_10668926 Ga0105243_106689262 242
7 3300049585 Ga0501069_0114636 Ga0501069_0114636_92_832 242
8 3300049582 Ga0501048_0158024 Ga0501048_0158024_845_1579 244
9 3300049592 Ga0501076_0341607 Ga0501076_0341607_21_755 244
10 3300039447 Ga0436361_0499976 Ga0436361_0499976_158_931 248
11 3300028379 Ga0268266_10096280 Ga0268266_100962803 249
12 3300021361 Ga0213872_10009803 Ga0213872_100098034 260
13 3300039447 Ga0436361_0277890 Ga0436361_0277890_869_1702 260
14 3300053178 Ga0500637_0121439 Ga0500637_0121439_553_1395 260
15 3300049581 Ga0501047_0107519 Ga0501047_0107519_1008_1802 261
16 3300039450 Ga0436363_0048675 Ga0436363_0048675_29_847 262
17 3300036401 Ga0373937_0017944 Ga0373937_0017944_3660_4505 264
18 3300044673 Ga0453683_0018547 Ga0453683_0018547_1564_2409 264
19 3300045051 Ga0451576_0001922 Ga0451576_0001922_23647_24492 264
20 3300049744 Ga0501083_0051330 Ga0501083_0051330_253_1050 265
21 3300053108 Ga0500562_010433 Ga0500562_010433_1031_1906 266
22 3300005436 Ga0070713_100425108 Ga0070713_1004251082 267
23 3300031247 Ga0265340_10111377 Ga0265340_101113772 267
24 3300031250 Ga0265331_10000805 Ga0265331_1000080515 267
25 3300031595 Ga0265313_10000622 Ga0265313_1000062227 267
26 3300031711 Ga0265314_10050412 Ga0265314_100504122 267
27 3300031712 Ga0265342_10011322 Ga0265342_100113223 267
28 3300045051 Ga0451576_0198803 Ga0451576_0198803_314_1171 267
29 3300005455 Ga0070663_100025295 Ga0070663_1000252952 268
30 3300025912 Ga0207707_10175327 Ga0207707_101753271 268
31 3300049578 Ga0501042_0096954 Ga0501042_0096954_14_883 268
32 3300035112 Ga0373932_0073460 Ga0373932_0073460_82_966 270
33 3300060353 Ga0501082_0059005 Ga0501082_0059005_1049_1903 270
34 3300049576 Ga0501040_0100555 Ga0501040_0100555_1047_1928 271
35 3300049824 Ga0501045_0250336 Ga0501045_0250336_349_1230 271
36 3300005367 Ga0070667_100024144 Ga0070667_1000241444 272
37 3300013306 Ga0163162_10720544 Ga0163162_107205441 272
38 3300021441 Ga0213871_10048881 Ga0213871_100488812 272
39 3300039438 Ga0436360_0030258 Ga0436360_0030258_708_1550 272
40 3300039438 Ga0436360_0411737 Ga0436360_0411737_81_989 272
41 3300054114 Ga0501084_0048893 Ga0501084_0048893_859_1746 272
42 iso_pu_bacteria 3003665799 3003668911 272
43 3300036647 Ga0316582_0079099 Ga0316582_0079099_1158_2039 273
44 3300039437 Ga0436365_1934223 Ga0436365_1934223_1040_1870 273
45 3300039450 Ga0436363_1120322 Ga0436363_1120322_140_991 273
46 3300049572 Ga0501036_0040247 Ga0501036_0040247_2397_3284 273
47 3300049575 Ga0501039_0073384 Ga0501039_0073384_235_1122 273
48 3300049587 Ga0501071_0115039 Ga0501071_0115039_1079_1966 273
49 3300049593 Ga0501077_0018145 Ga0501077_0018145_3209_4096 273
50 3300049741 Ga0501079_0268450 Ga0501079_0268450_81_968 273
51 3300031240 Ga0265320_10002022 Ga0265320_100020227 274
52 3300031711 Ga0265314_10007116 Ga0265314_100071166 274
53 3300049585 Ga0501069_0092932 Ga0501069_0092932_521_1402 274
54 3300005336 Ga0070680_100002988 Ga0070680_10000298811 275
55 3300005458 Ga0070681_10000987 Ga0070681_1000098713 275
56 3300005530 Ga0070679_100007116 Ga0070679_1000071165 275
57 3300005578 Ga0068854_100022782 Ga0068854_1000227823 275
58 3300009093 Ga0105240_10050366 Ga0105240_100503663 275
59 3300013104 Ga0157370_10003504 Ga0157370_100035048 275
60 3300021388 Ga0213875_10002240 Ga0213875_1000224011 275
61 3300025912 Ga0207707_10004835 Ga0207707_100048354 275
62 3300025917 Ga0207660_10011410 Ga0207660_100114103 275
63 3300025921 Ga0207652_10003311 Ga0207652_100033118 275
64 3300025981 Ga0207640_10016713 Ga0207640_100167133 275
65 3300029957 Ga0265324_10003964 Ga0265324_100039647 275
66 3300031239 Ga0265328_10008671 Ga0265328_100086714 275
67 3300031250 Ga0265331_10000644 Ga0265331_1000064412 275
68 3300044712 Ga0453684_0162142 Ga0453684_0162142_1369_2211 275
69 3300003316 rootH1_10044830 rootH1_100448302 276
70 3300005539 Ga0068853_100258435 Ga0068853_1002584352 276
71 3300009093 Ga0105240_10038880 Ga0105240_100388804 276
72 3300009551 Ga0105238_10151857 Ga0105238_101518572 276
73 3300009553 Ga0105249_10006995 Ga0105249_100069957 276
74 3300025913 Ga0207695_10240011 Ga0207695_102400112 276
75 3300025924 Ga0207694_10126003 Ga0207694_101260032 276
76 3300025961 Ga0207712_10087588 Ga0207712_100875883 276
77 3300028379 Ga0268266_10004656 Ga0268266_100046569 276
78 3300028380 Ga0268265_10003022 Ga0268265_100030224 276
79 3300031548 Ga0307408_100024537 Ga0307408_1000245372 276
80 3300039062 Ga0400483_249811 Ga0400483_249811_2422_3258 276
81 3300039453 Ga0436362_0332318 Ga0436362_0332318_930_1769 276
82 3300049577 Ga0501041_0197376 Ga0501041_0197376_238_1125 276
83 3300060353 Ga0501082_0058538 Ga0501082_0058538_999_1886 276
84 3300031251 Ga0265327_10000460 Ga0265327_1000046013 277
85 3300031595 Ga0265313_10000529 Ga0265313_1000052933 277
86 3300049575 Ga0501039_0064394 Ga0501039_0064394_159_1001 277
87 iso_pu_bacteria 2545555834 2545672826 277
88 iso_pu_bacteria 641522639 641640542 277
89 3300039447 Ga0436361_0830018 Ga0436361_0830018_568_1428 278
90 3300048909 Ga0496106_0346860 Ga0496106_0346860_222_1064 278
91 3300048918 Ga0496115_0205501 Ga0496115_0205501_562_1404 278
92 3300048919 Ga0496116_0082773 Ga0496116_0082773_1096_1938 278
93 3300048920 Ga0496117_0000152 Ga0496117_0000152_98655_99497 278
94 3300048921 Ga0496118_0000052 Ga0496118_0000052_84312_85154 278
95 3300048922 Ga0496119_0000151 Ga0496119_0000151_28332_29177 278
96 3300048922 Ga0496119_0012647 Ga0496119_0012647_3141_3983 278
97 3300048923 Ga0496120_0000286 Ga0496120_0000286_45198_46043 278
98 3300048923 Ga0496120_0011408 Ga0496120_0011408_955_1797 278
99 3300048923 Ga0496120_0029688 Ga0496120_0029688_1564_2406 278
100 3300048924 Ga0496121_0085661 Ga0496121_0085661_1599_2441 278
101 3300048927 Ga0496124_0020815 Ga0496124_0020815_3631_4473 278
102 3300048928 Ga0496125_0047616 Ga0496125_0047616_1887_2729 278
103 3300048929 Ga0496126_0024812 Ga0496126_0024812_1873_2715 278
104 iso_pu_bacteria 643348564 643603053 278
105 3300031727 Ga0316576_10010503 Ga0316576_100105036 279
106 3300036712 Ga0316584_0287472 Ga0316584_0287472_170_1009 279
107 3300037853 Ga0436364_0519232 Ga0436364_0519232_2282_3274 279
108 3300005331 Ga0070670_100051453 Ga0070670_1000514533 280
109 3300005367 Ga0070667_100032838 Ga0070667_1000328383 280
110 3300005617 Ga0068859_100296307 Ga0068859_1002963072 280
111 3300005841 Ga0068863_100001132 Ga0068863_10000113220 280
112 3300005843 Ga0068860_100001736 Ga0068860_10000173617 280
113 3300006177 Ga0075362_10000932 Ga0075362_100009327 280
114 3300009098 Ga0105245_10194591 Ga0105245_101945912 280
115 3300009101 Ga0105247_10004946 Ga0105247_100049465 280
116 3300009545 Ga0105237_10146561 Ga0105237_101465613 280
117 3300009545 Ga0105237_10218231 Ga0105237_102182313 280
118 3300009545 Ga0105237_10223610 Ga0105237_102236102 280
119 3300009551 Ga0105238_10047304 Ga0105238_100473043 280
120 3300010375 Ga0105239_10911876 Ga0105239_109118761 280
121 3300013306 Ga0163162_10288140 Ga0163162_102881402 280
122 3300014968 Ga0157379_10236346 Ga0157379_102363462 280
123 3300025900 Ga0207710_10010896 Ga0207710_100108964 280
124 3300025903 Ga0207680_10088069 Ga0207680_100880692 280
125 3300025914 Ga0207671_10034651 Ga0207671_100346513 280
126 3300025924 Ga0207694_10086832 Ga0207694_100868322 280
127 3300025986 Ga0207658_10263637 Ga0207658_102636372 280
128 3300026078 Ga0207702_10414777 Ga0207702_104147772 280
129 3300026088 Ga0207641_10000289 Ga0207641_1000028923 280
130 3300033180 Ga0307510_10000010 Ga0307510_10000010217 280
131 3300035725 Ga0373947_0270634 Ga0373947_0270634_201_1052 280
132 3300048911 Ga0496108_0253276 Ga0496108_0253276_237_1088 280
133 3300048924 Ga0496121_0103556 Ga0496121_0103556_531_1391 280
134 3300048928 Ga0496125_0001409 Ga0496125_0001409_22948_23808 280
135 3300048929 Ga0496126_0011622 Ga0496126_0011622_4749_5609 280
136 3300050515 nmdc:mga0a205_168384_c1 nmdc:mga0a205_168384_c1_647_1498 280
137 iso_pu_bacteria 2821443989 2821447918 280
138 3300006846 Ga0075430_100034707 Ga0075430_1000347073 281
139 3300006847 Ga0075431_100084383 Ga0075431_1000843833 281
140 3300006847 Ga0075431_100224968 Ga0075431_1002249682 281
141 3300009147 Ga0114129_10255584 Ga0114129_102555842 281
142 3300049576 Ga0501040_0159156 Ga0501040_0159156_151_1002 281
143 3300049577 Ga0501041_0155560 Ga0501041_0155560_394_1245 281
144 3300049577 Ga0501041_0166772 Ga0501041_0166772_41_892 281
145 3300049582 Ga0501048_0094320 Ga0501048_0094320_458_1309 281
146 3300049591 Ga0501075_0277091 Ga0501075_0277091_283_1134 281
147 3300049743 Ga0501081_0112307 Ga0501081_0112307_262_1113 281
148 3300049824 Ga0501045_0258162 Ga0501045_0258162_40_891 281
149 3300050507 nmdc:mga05p37_205693_c1 nmdc:mga05p37_205693_c1_778_1629 281
150 3300050509 nmdc:mga0qj67_84114_c1 nmdc:mga0qj67_84114_c1_1556_2407 281
151 3300050510 nmdc:mga06r32_208476_c1 nmdc:mga06r32_208476_c1_716_1567 281
152 3300050510 nmdc:mga06r32_3543_c1 nmdc:mga06r32_3543_c1_1074_1925 281
153 3300060353 Ga0501082_0068041 Ga0501082_0068041_800_1651 281
154 iso_pu_bacteria 2884298095 2884301316 281
155 3300037068 Ga0373925_0279443 Ga0373925_0279443_243_1145 282
156 3300039447 Ga0436361_0282068 Ga0436361_0282068_214_1065 282
157 3300010159 Ga0099796_10003373 Ga0099796_100033732 283
158 3300033180 Ga0307510_10011156 Ga0307510_100111564 283
159 3300039062 Ga0400483_050342 Ga0400483_050342_611_1474 283
160 iso_pu_bacteria 2728368998 2728752562 283
161 3300033180 Ga0307510_10127981 Ga0307510_101279812 284
162 3300035113 Ga0373936_0016128 Ga0373936_0016128_1994_2848 284
163 3300037853 Ga0436364_0048878 Ga0436364_0048878_1311_2174 284
164 3300039110 Ga0400487_14027 Ga0400487_14027_347_1210 284
165 3300044712 Ga0453684_0000015 Ga0453684_0000015_590438_591292 284
166 3300044712 Ga0453684_0000020 Ga0453684_0000020_610898_611752 284
167 3300044712 Ga0453684_0130120 Ga0453684_0130120_937_1797 284
168 3300049568 Ga0501031_0100760 Ga0501031_0100760_258_1145 284
169 3300049570 Ga0501033_0071271 Ga0501033_0071271_409_1296 284
170 3300049572 Ga0501036_0037503 Ga0501036_0037503_1837_2724 284
171 3300049574 Ga0501038_0074949 Ga0501038_0074949_1695_2582 284
172 3300049575 Ga0501039_0015437 Ga0501039_0015437_82_969 284
173 3300049576 Ga0501040_0016470 Ga0501040_0016470_268_1155 284
174 3300049578 Ga0501042_0008458 Ga0501042_0008458_3577_4464 284
175 3300049579 Ga0501043_0090255 Ga0501043_0090255_967_1854 284
176 3300049580 Ga0501046_0035669 Ga0501046_0035669_3042_3929 284
177 3300049582 Ga0501048_0065480 Ga0501048_0065480_1499_2386 284
178 3300049584 Ga0501068_0043110 Ga0501068_0043110_1196_2083 284
179 3300049587 Ga0501071_0011454 Ga0501071_0011454_986_1873 284
180 3300049588 Ga0501072_0009672 Ga0501072_0009672_5347_6234 284
181 3300049591 Ga0501075_0012245 Ga0501075_0012245_1263_2150 284
182 3300049593 Ga0501077_0004078 Ga0501077_0004078_1988_2875 284
183 3300049741 Ga0501079_0159854 Ga0501079_0159854_268_1155 284
184 3300049742 Ga0501080_0103724 Ga0501080_0103724_640_1527 284
185 3300049743 Ga0501081_0118037 Ga0501081_0118037_268_1155 284
186 3300049744 Ga0501083_0086512 Ga0501083_0086512_66_953 284
187 3300049822 Ga0501035_0099152 Ga0501035_0099152_839_1726 284
188 3300049824 Ga0501045_0014577 Ga0501045_0014577_1240_2127 284
189 3300050489 nmdc:mga03683_307_c1 nmdc:mga03683_307_c1_4567_5427 284
190 3300054114 Ga0501084_0024754 Ga0501084_0024754_240_1127 284
191 3300061734 Ga0530510_0052041 Ga0530510_0052041_447_1334 284
192 3300005467 Ga0070706_100481726 Ga0070706_1004817262 285
193 3300006177 Ga0075362_10047528 Ga0075362_100475282 285
194 3300006844 Ga0075428_100445497 Ga0075428_1004454972 285
195 3300006846 Ga0075430_100093945 Ga0075430_1000939454 285
196 3300006847 Ga0075431_100018281 Ga0075431_1000182819 285
197 3300006847 Ga0075431_100286268 Ga0075431_1002862682 285
198 3300050509 nmdc:mga0qj67_4938_c1 nmdc:mga0qj67_4938_c1_7708_8571 285
199 3300005545 Ga0070695_100013985 Ga0070695_1000139852 286
200 3300031727 Ga0316576_10129441 Ga0316576_101294412 286
201 3300005456 Ga0070678_100045780 Ga0070678_1000457802 287
202 3300005471 Ga0070698_100627886 Ga0070698_1006278861 287
203 3300014326 Ga0157380_10763611 Ga0157380_107636111 287
204 3300017792 Ga0163161_10177171 Ga0163161_101771712 287
205 3300031727 Ga0316576_10041546 Ga0316576_100415462 287
206 3300035398 Ga0316574_0000057 Ga0316574_0000057_18727_19593 287
207 3300036712 Ga0316584_0060525 Ga0316584_0060525_1233_2099 287
208 3300038735 Ga0400485_18958 Ga0400485_18958_477_1349 287
209 3300039437 Ga0436365_0892608 Ga0436365_0892608_2959_3843 287
210 3300039453 Ga0436362_0293991 Ga0436362_0293991_409_1281 287
211 3300039453 Ga0436362_0958195 Ga0436362_0958195_6274_7158 287
212 3300049743 Ga0501081_0337621 Ga0501081_0337621_144_1013 287
213 iso_pu_bacteria 8054563764 8054564272 287
214 3300005435 Ga0070714_100143407 Ga0070714_1001434071 288
215 3300005436 Ga0070713_100020989 Ga0070713_1000209891 288
216 3300005436 Ga0070713_100213251 Ga0070713_1002132511 288
217 3300005468 Ga0070707_100003690 Ga0070707_1000036904 288
218 3300005614 Ga0068856_100011378 Ga0068856_1000113787 288
219 3300005719 Ga0068861_100464774 Ga0068861_1004647741 288
220 3300006028 Ga0070717_10056682 Ga0070717_100566821 288
221 3300006881 Ga0068865_100281456 Ga0068865_1002814561 288
222 3300006914 Ga0075436_100005588 Ga0075436_1000055886 288
223 3300007076 Ga0075435_100045372 Ga0075435_1000453722 288
224 3300007788 Ga0099795_10088711 Ga0099795_100887111 288
225 3300009553 Ga0105249_10019520 Ga0105249_100195202 288
226 3300010159 Ga0099796_10008581 Ga0099796_100085812 288
227 3300013297 Ga0157378_10253467 Ga0157378_102534672 288
228 3300013306 Ga0163162_10462466 Ga0163162_104624662 288
229 3300014326 Ga0157380_10091465 Ga0157380_100914652 288
230 3300014497 Ga0182008_10025893 Ga0182008_100258931 288
231 3300014969 Ga0157376_10170890 Ga0157376_101708902 288
232 3300025906 Ga0207699_10019305 Ga0207699_100193051 288
233 3300025922 Ga0207646_10013143 Ga0207646_100131436 288
234 3300025928 Ga0207700_10009550 Ga0207700_100095505 288
235 3300025929 Ga0207664_10024289 Ga0207664_100242894 288
236 3300026089 Ga0207648_10182859 Ga0207648_101828592 288
237 3300035695 Ga0373927_0034044 Ga0373927_0034044_350_1327 288
238 3300037068 Ga0373925_0105218 Ga0373925_0105218_868_1845 288
239 3300048907 Ga0496104_0096698 Ga0496104_0096698_1733_2605 288
240 3300048915 Ga0496112_0152752 Ga0496112_0152752_36_908 288
241 3300048916 Ga0496113_0010689 Ga0496113_0010689_4901_5773 288
242 3300049593 Ga0501077_0056962 Ga0501077_0056962_1542_2414 288
243 3300050514 nmdc:mga08x19_4200_c1 nmdc:mga08x19_4200_c1_5773_6645 288
244 3300053104 Ga0500556_0000281 Ga0500556_0000281_26759_27634 288
245 3300025916 Ga0207663_10129641 Ga0207663_101296412 289
246 3300035113 Ga0373936_0003546 Ga0373936_0003546_1459_2343 289
247 iso_pu_bacteria 2844533157 2844533566 289
248 3300005356 Ga0070674_100334416 Ga0070674_1003344161 290
249 3300005436 Ga0070713_100039676 Ga0070713_1000396762 290
250 3300005439 Ga0070711_100106817 Ga0070711_1001068172 290
251 3300009094 Ga0111539_10258457 Ga0111539_102584572 290
252 3300013306 Ga0163162_10629093 Ga0163162_106290932 290
253 3300025915 Ga0207693_10002515 Ga0207693_1000251515 290
254 3300025916 Ga0207663_10021382 Ga0207663_100213822 290
255 3300025944 Ga0207661_10104548 Ga0207661_101045481 290
256 3300039062 Ga0400483_013353 Ga0400483_013353_1866_2765 290
257 3300050510 nmdc:mga06r32_270596_c1 nmdc:mga06r32_270596_c1_446_1324 290
258 3300050510 nmdc:mga06r32_3841_c1 nmdc:mga06r32_3841_c1_1162_2040 290
259 3300044712 Ga0453684_0009064 Ga0453684_0009064_12215_13114 291
260 3300005347 Ga0070668_100033205 Ga0070668_1000332052 292
261 3300005578 Ga0068854_100397096 Ga0068854_1003970962 292
262 3300005618 Ga0068864_100384283 Ga0068864_1003842832 292
263 3300005719 Ga0068861_100026768 Ga0068861_1000267683 292
264 3300005840 Ga0068870_10133557 Ga0068870_101335572 292
265 3300005843 Ga0068860_100020344 Ga0068860_1000203444 292
266 3300005844 Ga0068862_100011369 Ga0068862_1000113692 292
267 3300006881 Ga0068865_100064148 Ga0068865_1000641483 292
268 3300014968 Ga0157379_10052090 Ga0157379_100520903 292
269 3300017792 Ga0163161_10009753 Ga0163161_100097532 292
270 3300025935 Ga0207709_10217354 Ga0207709_102173542 292
271 3300025938 Ga0207704_10046965 Ga0207704_100469652 292
272 3300025972 Ga0207668_10023580 Ga0207668_100235802 292
273 3300026095 Ga0207676_10203492 Ga0207676_102034922 292
274 3300026118 Ga0207675_100011404 Ga0207675_1000114047 292
275 3300048904 Ga0496101_0004187 Ga0496101_0004187_4345_5238 292
276 3300048910 Ga0496107_0000431 Ga0496107_0000431_4586_5479 292
277 3300048917 Ga0496114_0003041 Ga0496114_0003041_11434_12327 292
278 3300048918 Ga0496115_0075047 Ga0496115_0075047_437_1330 292
279 3300003187 JGI25151J46595_10000124 JGI25151J46595_1000012462 293
280 3300003354 JGI25160J50197_1004916 JGI25160J50197_10049162 293
281 3300025284 Ga0209130_1000270 Ga0209130_100027027 293
282 3300025294 Ga0209025_1000705 Ga0209025_100070513 293
283 3300025297 Ga0209758_1004689 Ga0209758_10046899 293
284 3300025302 Ga0207426_1000443 Ga0207426_100044359 293
285 3300035112 Ga0373932_0012655 Ga0373932_0012655_405_1346 293
286 3300035114 Ga0373939_0012820 Ga0373939_0012820_377_1318 293
287 3300045051 Ga0451576_0206403 Ga0451576_0206403_870_1781 293
288 3300046512 Ga0495610_0009610 Ga0495610_0009610_4071_4952 293
289 3300049572 Ga0501036_0085709 Ga0501036_0085709_1236_2150 293
290 3300049578 Ga0501042_0147920 Ga0501042_0147920_570_1484 293
291 3300049582 Ga0501048_0058777 Ga0501048_0058777_712_1626 293

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ius-assembly2.cif.gz_B the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.9482 7 293
3ius-assembly1.cif.gz_A the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.9478 7 290
3ius-assembly2.cif.gz_B the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.9416 7 293
3ius-assembly1.cif.gz_A the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.9315 7 290
1ky5-assembly1.cif.gz_B d244e mutant s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints 0.8449 7 107
ID Description Score Start End Superfamily
3iusB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9447 7 293 3.40.50.720
3iusB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.938 7 293 3.40.50.720
af_B4F8E5_18_318_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8684 5 290 3.40.50.720
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8659 6 39 3.50.50.60
af_K7M5D4_27_313_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8473 4 275 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Z8SCE3-F1-model_v4 deleted 0.9866 2 291
AF-A0A437QNC7-F1-model_v4 SDR family oxidoreductase 0.985 6 287
AF-A0A849ECK4-F1-model_v4 SDR family oxidoreductase 0.9816 66 287
AF-A0A2S5MD92-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9814 7 291
AF-A0A327JLY9-F1-model_v4 deleted 0.9767 99 292

Feature Viewer

pLDDT pTM Quality
94.3 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map