F390276

General Info

Members Datasets Scaffolds Average Seq Length
291 205 276 161

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100026634|Ga0075428_1000266345
Length 179
Sequence VAGQGYNVAAMSASRKPLVGIIMGSKSDWETLQHAAAQLDELGVPYEAQVVSAHRTPDLLFEYASAAAGRGLEVIIAGAGGAAHLPGMAASKTALPVVGVPVESKALKGLDSLLSIVQMPGGVPVGTMAIGKAGAINAALLATAILGNKHDKFRKAYERFRKEQTQHVLGDRKLDKVAK

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 2818991459 Paenibacillus sp. 597 Isolate Unclassified
7 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
8 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
9 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
10 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
11 2941471342 Luteibacter sp. 621 Isolate Unclassified
12 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
13 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
14 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
15 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
108 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0.34
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 1.72
Rhizosphere 87.97
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012254 3300001989 Bacteria 3148
2 JGI24737J22298_10013498 3300001990 Bacteria 2658
3 JGI24735J21928_10010485 3300002067 Bacteria 2954
4 JGI25156J39149_1004496 3300002705 Bacteria 4234
5 JGI25157J39369_1002295 3300002741 Bacteria 5044
6 JGI25153J46596_10073363 3300003215 Bacteria 877
7 Ga0058862_12498050 3300004803 Bacteria 630
8 Ga0068869_100679812 3300005334 Bacteria 876
9 Ga0070682_100011575 3300005337 Bacteria 5045
10 Ga0068868_100578632 3300005338 Bacteria 992
11 Ga0070673_100165892 3300005364 Bacteria 1882
12 Ga0070713_101692966 3300005436 Bacteria 614
13 Ga0070711_100415030 3300005439 Bacteria 1095
14 Ga0070700_100222135 3300005441 Bacteria 1339
15 Ga0070708_100236077 3300005445 Bacteria 1716
16 Ga0070663_100008761 3300005455 Bacteria 6238
17 Ga0070698_100214148 3300005471 Bacteria 1861
18 Ga0070679_100123338 3300005530 Bacteria 2574
19 Ga0070693_100023185 3300005547 Bacteria 3314
20 Ga0068855_100057271 3300005563 Bacteria 4569
21 Ga0068856_100747051 3300005614 Bacteria 998
22 Ga0068861_100200236 3300005719 Bacteria 1675
23 Ga0068858_100812482 3300005842 Bacteria 912
24 Ga0068862_100844325 3300005844 Bacteria 897
25 Ga0068862_100849494 3300005844 Bacteria 894
26 Ga0081455_10004851 3300005937 Bacteria 14922
27 Ga0075432_10034465 3300006058 Bacteria 1758
28 Ga0068871_101027518 3300006358 Unclassified 768
29 Ga0075428_100026634 3300006844 Bacteria 6402
30 Ga0075428_100440428 3300006844 Bacteria 1396
31 Ga0075431_100128646 3300006847 Bacteria 2613
32 Ga0075433_10122568 3300006852 Bacteria 2309
33 Ga0075436_100160790 3300006914 Bacteria 1583
34 Ga0075435_100024538 3300007076 Bacteria 4681
35 Ga0111539_10163636 3300009094 Bacteria 2602
36 Ga0111539_11277237 3300009094 Bacteria 852
37 Ga0114129_10071909 3300009147 Bacteria 4823
38 Ga0114129_10806593 3300009147 Bacteria 1197
39 Ga0114129_12367294 3300009147 Bacteria 636
40 Ga0105237_10026114 3300009545 Bacteria 5968
41 Ga0105239_10148696 3300010375 Bacteria 2614
42 Ga0157373_10398758 3300013100 Bacteria 986
43 Ga0157370_10012178 3300013104 Bacteria 8941
44 Ga0157370_10032303 3300013104 Bacteria 5112
45 Ga0157369_10001986 3300013105 Bacteria 24631
46 Ga0157369_10494500 3300013105 Bacteria 1265
47 Ga0157369_12226110 3300013105 Bacteria 556
48 Ga0157375_10972957 3300013308 Bacteria 989
49 Ga0163163_10447673 3300014325 Bacteria 1351
50 Ga0157376_10514946 3300014969 Bacteria 1178
51 Ga0157376_11134989 3300014969 Bacteria 808
52 Ga0183368_1003 3300015687 Bacteria 1276390
53 Ga0213875_10000103 3300021388 Bacteria 96738
54 Ga0209674_100012 3300025226 Bacteria 950162
55 Ga0209258_107067 3300025242 Bacteria 1696
56 Ga0209129_1000686 3300025258 Bacteria 22253
57 Ga0209758_1011754 3300025297 Bacteria 5016
58 Ga0209256_1026282 3300025299 Bacteria 1680
59 Ga0207647_10000078 3300025904 Bacteria 73787
60 Ga0207647_10010809 3300025904 Bacteria 6425
61 Ga0207645_10100417 3300025907 Bacteria 1866
62 Ga0207671_10026274 3300025914 Bacteria 4365
63 Ga0207663_10584246 3300025916 Bacteria 876
64 Ga0207660_10158263 3300025917 Bacteria 1745
65 Ga0207652_10043660 3300025921 Bacteria 3817
66 Ga0207650_10139471 3300025925 Bacteria 1905
67 Ga0207664_10005277 3300025929 Bacteria 8828
68 Ga0207691_10285833 3300025940 Bacteria 1419
69 Ga0207661_10142199 3300025944 Bacteria 2066
70 Ga0207667_10675544 3300025949 Bacteria 1037
71 Ga0207668_10340591 3300025972 Bacteria 1251
72 Ga0207658_10394306 3300025986 Bacteria 1215
73 Ga0207703_10735041 3300026035 Bacteria 940
74 Ga0207675_100074987 3300026118 Bacteria 3166
75 Ga0207428_10037115 3300027907 Bacteria 3967
76 Ga0316575_10085705 3300031665 Bacteria 1272
77 Ga0265314_10179363 3300031711 Bacteria 1271
78 Ga0307406_10037303 3300031901 Bacteria 3001
79 Ga0373926_0003890 3300035083 Bacteria 4878
80 Ga0373934_0268599 3300035086 Bacteria 706
81 Ga0373944_0000129 3300035089 Bacteria 14456
82 Ga0373923_0008293 3300035111 Bacteria 3698
83 Ga0373936_0000327 3300035113 Bacteria 16072
84 Ga0373945_0008010 3300035116 Bacteria 3431
85 Ga0373954_0032892 3300035118 Bacteria 2399
86 Ga0373946_0001062 3300035171 Bacteria 9463
87 Ga0373955_0017577 3300035172 Bacteria 3542
88 Ga0373931_0229091 3300035691 Bacteria 1122
89 Ga0373935_0001764 3300035692 Bacteria 12155
90 Ga0373927_0000001 3300035695 Bacteria 1082160
91 Ga0373927_0007329 3300035695 Bacteria 7470
92 Ga0373933_0657965 3300035724 Bacteria 689
93 Ga0373947_0004353 3300035725 Bacteria 8309
94 Ga0316582_0042975 3300036647 Bacteria 2834
95 Ga0373925_0012155 3300037068 Bacteria 6231
96 Ga0395899_0400039 3300037312 Bacteria 909
97 Ga0395900_0090091 3300037418 Bacteria 3153
98 Ga0395905_1250313 3300037471 Bacteria 646
99 Ga0436364_0129406 3300037853 Bacteria 129389
100 Ga0395901_0006378 3300038443 Bacteria 11952
101 Ga0395901_0106550 3300038443 Bacteria 2942
102 Ga0395901_0124261 3300038443 Bacteria 2712
103 Ga0395901_1000314 3300038443 Bacteria 812
104 Ga0237819_00619 3300038705 Bacteria 11626
105 Ga0436365_1738733 3300039437 Bacteria 1097
106 Ga0439437_000065 3300042000 Bacteria 7194
107 Ga0439432_079349 3300042006 Bacteria 995
108 Ga0439455_0041536 3300042012 Bacteria 1179
109 Ga0439459_0022741 3300042438 Bacteria 1215
110 Ga0451577_0066681 3300042876 Bacteria 3210
111 Ga0451577_0308817 3300042876 Bacteria 1433
112 Ga0451577_0325147 3300042876 Bacteria 1395
113 Ga0451577_1014700 3300042876 Bacteria 745
114 Ga0453684_0681202 3300044712 Bacteria 1119
115 Ga0453684_0907898 3300044712 Bacteria 943
116 Ga0466959_0322040 3300045049 Bacteria 1057
117 Ga0466967_0047172 3300045976 Bacteria 3755
118 Ga0495603_0048108 3300046455 Bacteria 2539
119 Ga0495629_0014984 3300046459 Bacteria 5570
120 Ga0495638_0000763 3300046460 Bacteria 34215
121 Ga0495641_0003209 3300046461 Bacteria 12418
122 Ga0495653_0630789 3300046463 Bacteria 656
123 Ga0495580_0051043 3300046472 Bacteria 2924
124 Ga0495582_0001721 3300046473 Bacteria 12342
125 Ga0495639_0002902 3300046475 Bacteria 7466
126 Ga0495662_0000538 3300046476 Bacteria 17375
127 Ga0495594_0045214 3300046499 Bacteria 2417
128 Ga0495630_0103815 3300046517 Bacteria 2151
129 Ga0495630_0272662 3300046517 Bacteria 1293
130 Ga0495630_0579773 3300046517 Bacteria 860
131 Ga0495666_0335343 3300046526 Bacteria 682
132 Ga0495665_0000176 3300046531 Bacteria 32475
133 Ga0495640_0002150 3300046533 Bacteria 15750
134 Ga0495586_0035265 3300046535 Bacteria 2687
135 Ga0495598_0100216 3300046537 Bacteria 957
136 Ga0495621_0000143 3300046539 Bacteria 15314
137 Ga0495622_0013790 3300046557 Bacteria 3747
138 Ga0495667_0057980 3300046559 Bacteria 2544
139 Ga0495634_0081600 3300046642 Bacteria 2114
140 Ga0495588_0001525 3300046674 Bacteria 9904
141 Ga0495658_0000339 3300046683 Bacteria 26398
142 Ga0495624_0019795 3300046690 Bacteria 4485
143 Ga0495581_0002182 3300047315 Bacteria 11029
144 Ga0495604_0151986 3300047317 Bacteria 1644
145 Ga0495604_0290590 3300047317 Bacteria 1101
146 Ga0495604_0679780 3300047317 Bacteria 655
147 Ga0495674_0001223 3300047319 Bacteria 24908
148 Ga0495674_0125843 3300047319 Bacteria 2163
149 Ga0495676_0004941 3300047321 Bacteria 12226
150 Ga0495680_0003166 3300047322 Bacteria 16382
151 Ga0495684_0032980 3300047471 Bacteria 3977
152 Ga0495684_0324844 3300047471 Bacteria 1099
153 Ga0495593_0000762 3300047673 Bacteria 18698
154 Ga0495614_0023423 3300048089 Bacteria 2664
155 Ga0496106_0465288 3300048909 Bacteria 1016
156 Ga0496107_0137251 3300048910 Bacteria 1807
157 Ga0496113_0067016 3300048916 Bacteria 2720
158 Ga0496114_0411443 3300048917 Bacteria 1198
159 Ga0496115_0007393 3300048918 Bacteria 8081
160 Ga0496116_0144969 3300048919 Bacteria 1329
161 Ga0496116_0151536 3300048919 Bacteria 1287
162 Ga0496117_0009154 3300048920 Bacteria 9282
163 Ga0496118_0001059 3300048921 Bacteria 42966
164 Ga0496121_0000541 3300048924 Bacteria 71839
165 Ga0496122_0082148 3300048925 Bacteria 2239
166 Ga0496123_0012351 3300048926 Bacteria 7292
167 Ga0496125_0017338 3300048928 Bacteria 6874
168 Ga0496126_0040703 3300048929 Bacteria 4307
169 Ga0501031_0030316 3300049568 Bacteria 3528
170 Ga0501031_0114268 3300049568 Bacteria 1763
171 Ga0501032_0069713 3300049569 Bacteria 2346
172 Ga0501033_0062541 3300049570 Bacteria 2741
173 Ga0501033_0070992 3300049570 Bacteria 2558
174 Ga0501033_0209985 3300049570 Bacteria 1388
175 Ga0501034_0479399 3300049571 Bacteria 1159
176 Ga0501034_0613490 3300049571 Bacteria 992
177 Ga0501036_0020623 3300049572 Bacteria 5536
178 Ga0501036_0044564 3300049572 Bacteria 3757
179 Ga0501036_0597183 3300049572 Bacteria 916
180 Ga0501036_0850081 3300049572 Bacteria 750
181 Ga0501037_0042451 3300049573 Bacteria 3342
182 Ga0501037_0288355 3300049573 Bacteria 1142
183 Ga0501038_0010100 3300049574 Bacteria 8641
184 Ga0501038_0136100 3300049574 Bacteria 2013
185 Ga0501039_0030858 3300049575 Bacteria 4133
186 Ga0501039_0055048 3300049575 Bacteria 3080
187 Ga0501039_0330653 3300049575 Bacteria 1197
188 Ga0501039_0689084 3300049575 Bacteria 799
189 Ga0501040_0003697 3300049576 Bacteria 9912
190 Ga0501040_0814113 3300049576 Bacteria 676
191 Ga0501041_0034823 3300049577 Bacteria 3049
192 Ga0501041_0068557 3300049577 Bacteria 2174
193 Ga0501042_0017336 3300049578 Bacteria 4965
194 Ga0501042_0153356 3300049578 Bacteria 1661
195 Ga0501042_0173517 3300049578 Bacteria 1555
196 Ga0501042_1303566 3300049578 Bacteria 529
197 Ga0501043_0233870 3300049579 Bacteria 1419
198 Ga0501046_0014136 3300049580 Bacteria 6741
199 Ga0501046_0136952 3300049580 Bacteria 1854
200 Ga0501047_0884441 3300049581 Bacteria 707
201 Ga0501048_0064782 3300049582 Bacteria 2584
202 Ga0501067_0282898 3300049583 Bacteria 923
203 Ga0501068_0002334 3300049584 Bacteria 10108
204 Ga0501068_0108859 3300049584 Bacteria 1722
205 Ga0501068_0341910 3300049584 Bacteria 961
206 Ga0501069_0055246 3300049585 Bacteria 2212
207 Ga0501069_0109186 3300049585 Bacteria 1574
208 Ga0501069_0196354 3300049585 Bacteria 1168
209 Ga0501069_0273309 3300049585 Bacteria 988
210 Ga0501070_0161488 3300049586 Bacteria 1847
211 Ga0501070_0630386 3300049586 Bacteria 853
212 Ga0501070_1098789 3300049586 Bacteria 613
213 Ga0501071_0007378 3300049587 Bacteria 7213
214 Ga0501071_0062241 3300049587 Bacteria 2703
215 Ga0501071_0598048 3300049587 Bacteria 848
216 Ga0501072_0000081 3300049588 Bacteria 70723
217 Ga0501072_0001818 3300049588 Bacteria 15887
218 Ga0501072_0013919 3300049588 Bacteria 6166
219 Ga0501072_0162821 3300049588 Bacteria 1780
220 Ga0501072_0784342 3300049588 Bacteria 747
221 Ga0501073_0061641 3300049589 Bacteria 2617
222 Ga0501073_0124340 3300049589 Bacteria 1788
223 Ga0501074_0018458 3300049590 Bacteria 5067
224 Ga0501074_0642442 3300049590 Bacteria 750
225 Ga0501075_0066094 3300049591 Bacteria 2729
226 Ga0501075_0142851 3300049591 Bacteria 1824
227 Ga0501075_0231362 3300049591 Bacteria 1409
228 Ga0501075_0664595 3300049591 Bacteria 794
229 Ga0501076_0003380 3300049592 Bacteria 11206
230 Ga0501076_0082250 3300049592 Bacteria 2585
231 Ga0501076_0092128 3300049592 Bacteria 2438
232 Ga0501076_0103050 3300049592 Bacteria 2301
233 Ga0501076_0582753 3300049592 Bacteria 923
234 Ga0501076_0803788 3300049592 Bacteria 776
235 Ga0501077_0019202 3300049593 Bacteria 4322
236 Ga0501077_0160191 3300049593 Bacteria 1428
237 Ga0501079_0056799 3300049741 Bacteria 3020
238 Ga0501079_0207202 3300049741 Bacteria 1531
239 Ga0501079_0325242 3300049741 Bacteria 1204
240 Ga0501079_0560510 3300049741 Bacteria 898
241 Ga0501080_0059262 3300049742 Bacteria 3563
242 Ga0501081_0006658 3300049743 Bacteria 7513
243 Ga0501083_0030368 3300049744 Bacteria 3713
244 Ga0501035_0074914 3300049822 Bacteria 2993
245 Ga0501035_0082369 3300049822 Bacteria 2839
246 Ga0501035_0492143 3300049822 Bacteria 1010
247 Ga0501044_0443336 3300049823 Bacteria 1206
248 Ga0501044_0535694 3300049823 Bacteria 1069
249 Ga0501045_0015756 3300049824 Bacteria 5363
250 Ga0501045_0101738 3300049824 Bacteria 2127
251 Ga0501045_0471776 3300049824 Bacteria 932
252 Ga0501045_0626655 3300049824 Bacteria 795
253 Ga0501045_1120623 3300049824 Bacteria 575
254 nmdc:mga05p37_485102_c1 3300050507 Bacteria 1422
255 nmdc:mga05p37_59503_c1 3300050507 Bacteria 4705
256 nmdc:mga09592_81297_c1 3300050508 Bacteria 2761
257 nmdc:mga0qj67_50576_c1 3300050509 Bacteria 3287
258 nmdc:mga06r32_1415854_c1 3300050510 Bacteria 637
259 nmdc:mga08y16_156822_c1 3300050511 Bacteria 2366
260 nmdc:mga08y16_689220_c1 3300050511 Bacteria 1023
261 nmdc:mga0n895_287986_c1 3300050512 Bacteria 1665
262 nmdc:mga0rr50_155529_c1 3300050513 Bacteria 1852
263 nmdc:mga08x19_33182_c1 3300050514 Bacteria 3257
264 nmdc:mga0a205_336782_c1 3300050515 Bacteria 1378
265 Ga0495619_0071269 3300053085 Bacteria 2325
266 Ga0501084_0012068 3300054114 Bacteria 7156
267 Ga0501084_0213533 3300054114 Bacteria 1628
268 Ga0501084_0216479 3300054114 Bacteria 1616
269 Ga0501084_0462203 3300054114 Bacteria 1073
270 Ga0590075_021897 3300059424 Bacteria 1597
271 Ga0501082_0017600 3300060353 Bacteria 6155
272 Ga0501082_0361136 3300060353 Bacteria 1267
273 Ga0530510_0011782 3300061734 Bacteria 6135
274 Ga0530510_0030996 3300061734 Bacteria 3843
275 Ga0530510_0093468 3300061734 Bacteria 2196
276 Ga0530510_0639159 3300061734 Bacteria 810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061734 Ga0530510_0030996 Ga0530510_0030996_3414_3821 135
2 3300049584 Ga0501068_0341910 Ga0501068_0341910_11_433 140
3 3300025949 Ga0207667_10675544 Ga0207667_106755442 142
4 3300046537 Ga0495598_0100216 Ga0495598_0100216_208_723 142
5 3300046539 Ga0495621_0000143 Ga0495621_0000143_12234_12749 142
6 3300042876 Ga0451577_0325147 Ga0451577_0325147_107_610 143
7 3300049578 Ga0501042_0153356 Ga0501042_0153356_1010_1504 143
8 3300049585 Ga0501069_0055246 Ga0501069_0055246_813_1307 143
9 3300038443 Ga0395901_1000314 Ga0395901_1000314_285_773 144
10 3300049741 Ga0501079_0207202 Ga0501079_0207202_1074_1508 144
11 3300049824 Ga0501045_1120623 Ga0501045_1120623_21_458 144
12 3300049571 Ga0501034_0479399 Ga0501034_0479399_184_648 145
13 3300049588 Ga0501072_0000081 Ga0501072_0000081_70271_70711 145
14 3300049741 Ga0501079_0325242 Ga0501079_0325242_228_689 146
15 3300005445 Ga0070708_100236077 Ga0070708_1002360772 147
16 3300031901 Ga0307406_10037303 Ga0307406_100373032 147
17 3300038705 Ga0237819_00619 Ga0237819_00619_2230_2733 150
18 3300005441 Ga0070700_100222135 Ga0070700_1002221353 151
19 3300005937 Ga0081455_10004851 Ga0081455_1000485115 151
20 3300049572 Ga0501036_0850081 Ga0501036_0850081_80_571 152
21 3300049592 Ga0501076_0082250 Ga0501076_0082250_835_1326 152
22 3300054114 Ga0501084_0213533 Ga0501084_0213533_737_1228 152
23 3300060353 Ga0501082_0361136 Ga0501082_0361136_388_879 152
24 3300061734 Ga0530510_0093468 Ga0530510_0093468_650_1141 152
25 3300005471 Ga0070698_100214148 Ga0070698_1002141482 153
26 3300009094 Ga0111539_10163636 Ga0111539_101636361 153
27 3300009147 Ga0114129_10071909 Ga0114129_100719092 153
28 3300009147 Ga0114129_12367294 Ga0114129_123672941 153
29 3300042876 Ga0451577_0308817 Ga0451577_0308817_240_701 153
30 3300048909 Ga0496106_0465288 Ga0496106_0465288_35_496 153
31 3300048917 Ga0496114_0411443 Ga0496114_0411443_709_1170 153
32 3300049570 Ga0501033_0070992 Ga0501033_0070992_2068_2538 153
33 3300049572 Ga0501036_0597183 Ga0501036_0597183_371_832 153
34 3300049575 Ga0501039_0689084 Ga0501039_0689084_267_728 153
35 3300049576 Ga0501040_0814113 Ga0501040_0814113_101_562 153
36 3300049585 Ga0501069_0273309 Ga0501069_0273309_192_653 153
37 3300049587 Ga0501071_0598048 Ga0501071_0598048_372_833 153
38 3300049588 Ga0501072_0013919 Ga0501072_0013919_5321_5782 153
39 3300049588 Ga0501072_0162821 Ga0501072_0162821_410_901 153
40 3300049591 Ga0501075_0066094 Ga0501075_0066094_165_626 153
41 3300049591 Ga0501075_0664595 Ga0501075_0664595_106_567 153
42 3300049592 Ga0501076_0803788 Ga0501076_0803788_122_583 153
43 3300050507 nmdc:mga05p37_59503_c1 nmdc:mga05p37_59503_c1_3914_4378 153
44 3300050508 nmdc:mga09592_81297_c1 nmdc:mga09592_81297_c1_337_801 153
45 3300050509 nmdc:mga0qj67_50576_c1 nmdc:mga0qj67_50576_c1_725_1189 153
46 3300050511 nmdc:mga08y16_156822_c1 nmdc:mga08y16_156822_c1_224_688 153
47 3300050514 nmdc:mga08x19_33182_c1 nmdc:mga08x19_33182_c1_2159_2620 153
48 3300050515 nmdc:mga0a205_336782_c1 nmdc:mga0a205_336782_c1_906_1367 153
49 3300054114 Ga0501084_0216479 Ga0501084_0216479_228_689 153
50 3300061734 Ga0530510_0639159 Ga0530510_0639159_316_777 153
51 3300002705 JGI25156J39149_1004496 JGI25156J39149_10044963 154
52 3300002741 JGI25157J39369_1002295 JGI25157J39369_10022952 154
53 3300005337 Ga0070682_100011575 Ga0070682_1000115752 154
54 3300005338 Ga0068868_100578632 Ga0068868_1005786321 154
55 3300005436 Ga0070713_101692966 Ga0070713_1016929661 154
56 3300005455 Ga0070663_100008761 Ga0070663_1000087613 154
57 3300005547 Ga0070693_100023185 Ga0070693_1000231852 154
58 3300010375 Ga0105239_10148696 Ga0105239_101486962 154
59 3300013104 Ga0157370_10032303 Ga0157370_100323033 154
60 3300013105 Ga0157369_10494500 Ga0157369_104945002 154
61 3300013105 Ga0157369_12226110 Ga0157369_122261101 154
62 3300025904 Ga0207647_10010809 Ga0207647_100108093 154
63 3300025907 Ga0207645_10100417 Ga0207645_101004172 154
64 3300031665 Ga0316575_10085705 Ga0316575_100857052 154
65 3300035691 Ga0373931_0229091 Ga0373931_0229091_15_485 154
66 3300036647 Ga0316582_0042975 Ga0316582_0042975_1875_2354 154
67 3300037312 Ga0395899_0400039 Ga0395899_0400039_379_843 154
68 3300038443 Ga0395901_0006378 Ga0395901_0006378_2237_2701 154
69 3300038443 Ga0395901_0106550 Ga0395901_0106550_2243_2707 154
70 3300038443 Ga0395901_0124261 Ga0395901_0124261_1717_2184 154
71 3300042000 Ga0439437_000065 Ga0439437_000065_5619_6083 154
72 3300042006 Ga0439432_079349 Ga0439432_079349_104_568 154
73 3300042012 Ga0439455_0041536 Ga0439455_0041536_66_530 154
74 3300042876 Ga0451577_1014700 Ga0451577_1014700_47_520 154
75 3300044712 Ga0453684_0907898 Ga0453684_0907898_19_492 154
76 3300045976 Ga0466967_0047172 Ga0466967_0047172_2095_2559 154
77 3300046460 Ga0495638_0000763 Ga0495638_0000763_25362_25826 154
78 3300046557 Ga0495622_0013790 Ga0495622_0013790_2758_3222 154
79 3300048916 Ga0496113_0067016 Ga0496113_0067016_1300_1764 154
80 3300048918 Ga0496115_0007393 Ga0496115_0007393_7409_7873 154
81 3300049586 Ga0501070_1098789 Ga0501070_1098789_48_512 154
82 3300059424 Ga0590075_021897 Ga0590075_021897_973_1437 154
83 3300014325 Ga0163163_10447673 Ga0163163_104476732 155
84 3300046517 Ga0495630_0272662 Ga0495630_0272662_112_582 155
85 3300047319 Ga0495674_0125843 Ga0495674_0125843_252_722 155
86 3300047471 Ga0495684_0032980 Ga0495684_0032980_1130_1600 155
87 iso_pu_bacteria 2576861424 2578335139 157
88 iso_pu_bacteria 2643221676 2644421852 157
89 iso_pu_bacteria 2818991459 2819675811 157
90 iso_pu_bacteria 2881636855 2881641611 157
91 iso_pu_bacteria 2904755435 2904756120 157
92 iso_pu_bacteria 2907202186 2907207763 157
93 iso_pu_bacteria 2971511577 2971516304 157
94 iso_pu_bacteria 2980176882 2980181725 157
95 iso_pu_bacteria 2984527788 2984527813 157
96 iso_pu_bacteria 2984532647 2984533922 157
97 3300042438 Ga0439459_0022741 Ga0439459_0022741_50_526 158
98 3300047317 Ga0495604_0151986 Ga0495604_0151986_419_898 158
99 iso_pu_bacteria 2537561836 2538833993 158
100 iso_pu_bacteria 2919425241 2919431459 158
101 3300046517 Ga0495630_0579773 Ga0495630_0579773_72_563 159
102 3300048910 Ga0496107_0137251 Ga0496107_0137251_304_786 159
103 3300049568 Ga0501031_0030316 Ga0501031_0030316_145_627 159
104 3300049572 Ga0501036_0020623 Ga0501036_0020623_4860_5342 159
105 3300049573 Ga0501037_0288355 Ga0501037_0288355_177_659 159
106 3300049574 Ga0501038_0136100 Ga0501038_0136100_993_1475 159
107 3300049575 Ga0501039_0055048 Ga0501039_0055048_361_843 159
108 3300049576 Ga0501040_0003697 Ga0501040_0003697_7408_7890 159
109 3300049577 Ga0501041_0034823 Ga0501041_0034823_1970_2452 159
110 3300049578 Ga0501042_0017336 Ga0501042_0017336_2694_3176 159
111 3300049578 Ga0501042_1303566 Ga0501042_1303566_27_509 159
112 3300049580 Ga0501046_0136952 Ga0501046_0136952_1023_1505 159
113 3300049582 Ga0501048_0064782 Ga0501048_0064782_317_799 159
114 3300049585 Ga0501069_0109186 Ga0501069_0109186_244_726 159
115 3300049586 Ga0501070_0161488 Ga0501070_0161488_475_957 159
116 3300049587 Ga0501071_0007378 Ga0501071_0007378_2715_3197 159
117 3300049587 Ga0501071_0062241 Ga0501071_0062241_1851_2333 159
118 3300049588 Ga0501072_0001818 Ga0501072_0001818_3955_4437 159
119 3300049589 Ga0501073_0124340 Ga0501073_0124340_908_1390 159
120 3300049590 Ga0501074_0018458 Ga0501074_0018458_935_1417 159
121 3300049591 Ga0501075_0142851 Ga0501075_0142851_1172_1654 159
122 3300049591 Ga0501075_0231362 Ga0501075_0231362_334_816 159
123 3300049592 Ga0501076_0003380 Ga0501076_0003380_937_1419 159
124 3300049592 Ga0501076_0092128 Ga0501076_0092128_1937_2419 159
125 3300049593 Ga0501077_0019202 Ga0501077_0019202_2764_3246 159
126 3300049742 Ga0501080_0059262 Ga0501080_0059262_2755_3237 159
127 3300049743 Ga0501081_0006658 Ga0501081_0006658_3059_3541 159
128 3300049822 Ga0501035_0492143 Ga0501035_0492143_376_858 159
129 3300049823 Ga0501044_0443336 Ga0501044_0443336_164_646 159
130 3300049824 Ga0501045_0015756 Ga0501045_0015756_2905_3387 159
131 3300049824 Ga0501045_0471776 Ga0501045_0471776_50_532 159
132 3300054114 Ga0501084_0012068 Ga0501084_0012068_5663_6145 159
133 3300060353 Ga0501082_0017600 Ga0501082_0017600_2910_3392 159
134 3300006058 Ga0075432_10034465 Ga0075432_100344653 160
135 3300006358 Ga0068871_101027518 Ga0068871_1010275182 160
136 3300035118 Ga0373954_0032892 Ga0373954_0032892_983_1483 160
137 3300035695 Ga0373927_0000001 Ga0373927_0000001_761384_761887 160
138 3300035724 Ga0373933_0657965 Ga0373933_0657965_172_672 160
139 3300047317 Ga0495604_0290590 Ga0495604_0290590_542_1042 160
140 3300049590 Ga0501074_0642442 Ga0501074_0642442_127_612 160
141 3300049592 Ga0501076_0582753 Ga0501076_0582753_33_518 160
142 3300005844 Ga0068862_100844325 Ga0068862_1008443252 161
143 3300005844 Ga0068862_100849494 Ga0068862_1008494942 161
144 3300025916 Ga0207663_10584246 Ga0207663_105842461 161
145 3300025929 Ga0207664_10005277 Ga0207664_100052778 161
146 3300031711 Ga0265314_10179363 Ga0265314_101793632 161
147 3300046517 Ga0495630_0103815 Ga0495630_0103815_537_1049 161
148 3300046526 Ga0495666_0335343 Ga0495666_0335343_102_614 161
149 3300049573 Ga0501037_0042451 Ga0501037_0042451_2031_2522 161
150 3300005439 Ga0070711_100415030 Ga0070711_1004150301 162
151 3300005842 Ga0068858_100812482 Ga0068858_1008124822 162
152 3300006852 Ga0075433_10122568 Ga0075433_101225683 162
153 3300006914 Ga0075436_100160790 Ga0075436_1001607902 162
154 3300007076 Ga0075435_100024538 Ga0075435_1000245385 162
155 3300014969 Ga0157376_11134989 Ga0157376_111349892 162
156 3300026035 Ga0207703_10735041 Ga0207703_107350412 162
157 3300035083 Ga0373926_0003890 Ga0373926_0003890_2227_2718 162
158 3300035086 Ga0373934_0268599 Ga0373934_0268599_179_670 162
159 3300035089 Ga0373944_0000129 Ga0373944_0000129_4375_4866 162
160 3300035111 Ga0373923_0008293 Ga0373923_0008293_1085_1576 162
161 3300035113 Ga0373936_0000327 Ga0373936_0000327_13339_13830 162
162 3300035116 Ga0373945_0008010 Ga0373945_0008010_2139_2630 162
163 3300035171 Ga0373946_0001062 Ga0373946_0001062_2462_2953 162
164 3300035172 Ga0373955_0017577 Ga0373955_0017577_2988_3479 162
165 3300035692 Ga0373935_0001764 Ga0373935_0001764_1040_1531 162
166 3300035695 Ga0373927_0007329 Ga0373927_0007329_6177_6668 162
167 3300035725 Ga0373947_0004353 Ga0373947_0004353_2323_2814 162
168 3300037068 Ga0373925_0012155 Ga0373925_0012155_3900_4391 162
169 3300037471 Ga0395905_1250313 Ga0395905_1250313_23_514 162
170 3300039437 Ga0436365_1738733 Ga0436365_1738733_157_660 162
171 3300045049 Ga0466959_0322040 Ga0466959_0322040_184_675 162
172 3300046455 Ga0495603_0048108 Ga0495603_0048108_363_857 162
173 3300046459 Ga0495629_0014984 Ga0495629_0014984_4958_5449 162
174 3300046461 Ga0495641_0003209 Ga0495641_0003209_10215_10706 162
175 3300046463 Ga0495653_0630789 Ga0495653_0630789_20_511 162
176 3300046472 Ga0495580_0051043 Ga0495580_0051043_684_1175 162
177 3300046473 Ga0495582_0001721 Ga0495582_0001721_9736_10227 162
178 3300046475 Ga0495639_0002902 Ga0495639_0002902_6286_6777 162
179 3300046476 Ga0495662_0000538 Ga0495662_0000538_13110_13601 162
180 3300046499 Ga0495594_0045214 Ga0495594_0045214_582_1073 162
181 3300046531 Ga0495665_0000176 Ga0495665_0000176_123_614 162
182 3300046533 Ga0495640_0002150 Ga0495640_0002150_13131_13622 162
183 3300046535 Ga0495586_0035265 Ga0495586_0035265_1463_1954 162
184 3300046559 Ga0495667_0057980 Ga0495667_0057980_1008_1499 162
185 3300046642 Ga0495634_0081600 Ga0495634_0081600_202_693 162
186 3300046674 Ga0495588_0001525 Ga0495588_0001525_5038_5529 162
187 3300046683 Ga0495658_0000339 Ga0495658_0000339_24169_24660 162
188 3300046690 Ga0495624_0019795 Ga0495624_0019795_46_537 162
189 3300047315 Ga0495581_0002182 Ga0495581_0002182_3900_4391 162
190 3300047317 Ga0495604_0679780 Ga0495604_0679780_77_568 162
191 3300047319 Ga0495674_0001223 Ga0495674_0001223_20597_21088 162
192 3300047321 Ga0495676_0004941 Ga0495676_0004941_3698_4189 162
193 3300047322 Ga0495680_0003166 Ga0495680_0003166_13589_14080 162
194 3300047673 Ga0495593_0000762 Ga0495593_0000762_105_596 162
195 3300048089 Ga0495614_0023423 Ga0495614_0023423_14_505 162
196 3300049568 Ga0501031_0114268 Ga0501031_0114268_62_553 162
197 3300049569 Ga0501032_0069713 Ga0501032_0069713_256_747 162
198 3300049570 Ga0501033_0062541 Ga0501033_0062541_635_1126 162
199 3300049570 Ga0501033_0209985 Ga0501033_0209985_847_1338 162
200 3300049571 Ga0501034_0613490 Ga0501034_0613490_474_965 162
201 3300049572 Ga0501036_0044564 Ga0501036_0044564_3070_3561 162
202 3300049574 Ga0501038_0010100 Ga0501038_0010100_3701_4192 162
203 3300049575 Ga0501039_0030858 Ga0501039_0030858_2097_2588 162
204 3300049575 Ga0501039_0330653 Ga0501039_0330653_291_782 162
205 3300049577 Ga0501041_0068557 Ga0501041_0068557_1446_1937 162
206 3300049578 Ga0501042_0173517 Ga0501042_0173517_314_805 162
207 3300049579 Ga0501043_0233870 Ga0501043_0233870_392_883 162
208 3300049580 Ga0501046_0014136 Ga0501046_0014136_3152_3643 162
209 3300049581 Ga0501047_0884441 Ga0501047_0884441_37_528 162
210 3300049583 Ga0501067_0282898 Ga0501067_0282898_104_604 162
211 3300049584 Ga0501068_0002334 Ga0501068_0002334_2863_3354 162
212 3300049584 Ga0501068_0108859 Ga0501068_0108859_549_1049 162
213 3300049585 Ga0501069_0196354 Ga0501069_0196354_324_815 162
214 3300049586 Ga0501070_0630386 Ga0501070_0630386_151_648 162
215 3300049589 Ga0501073_0061641 Ga0501073_0061641_1528_2019 162
216 3300049592 Ga0501076_0103050 Ga0501076_0103050_1579_2070 162
217 3300049593 Ga0501077_0160191 Ga0501077_0160191_238_729 162
218 3300049741 Ga0501079_0056799 Ga0501079_0056799_1579_2070 162
219 3300049741 Ga0501079_0560510 Ga0501079_0560510_151_642 162
220 3300049744 Ga0501083_0030368 Ga0501083_0030368_2893_3384 162
221 3300049822 Ga0501035_0074914 Ga0501035_0074914_924_1415 162
222 3300049822 Ga0501035_0082369 Ga0501035_0082369_375_866 162
223 3300049823 Ga0501044_0535694 Ga0501044_0535694_130_621 162
224 3300049824 Ga0501045_0101738 Ga0501045_0101738_1399_1890 162
225 3300049824 Ga0501045_0626655 Ga0501045_0626655_67_558 162
226 3300050513 nmdc:mga0rr50_155529_c1 nmdc:mga0rr50_155529_c1_819_1316 162
227 3300053085 Ga0495619_0071269 Ga0495619_0071269_1713_2204 162
228 3300061734 Ga0530510_0011782 Ga0530510_0011782_3817_4308 162
229 3300006847 Ga0075431_100128646 Ga0075431_1001286464 163
230 3300009545 Ga0105237_10026114 Ga0105237_100261142 163
231 3300013100 Ga0157373_10398758 Ga0157373_103987582 163
232 3300025914 Ga0207671_10026274 Ga0207671_100262746 163
233 3300027907 Ga0207428_10037115 Ga0207428_100371154 163
234 3300049588 Ga0501072_0784342 Ga0501072_0784342_204_698 163
235 3300050512 nmdc:mga0n895_287986_c1 nmdc:mga0n895_287986_c1_253_750 163
236 3300054114 Ga0501084_0462203 Ga0501084_0462203_71_565 163
237 iso_pu_bacteria 2687453130 2687584195 163
238 3300047471 Ga0495684_0324844 Ga0495684_0324844_12_509 164
239 3300004803 Ga0058862_12498050 Ga0058862_124980501 165
240 3300005530 Ga0070679_100123338 Ga0070679_1001233382 165
241 3300005563 Ga0068855_100057271 Ga0068855_1000572712 165
242 3300005614 Ga0068856_100747051 Ga0068856_1007470512 165
243 3300006844 Ga0075428_100026634 Ga0075428_1000266345 165
244 3300006844 Ga0075428_100440428 Ga0075428_1004404281 165
245 3300009147 Ga0114129_10806593 Ga0114129_108065932 165
246 3300021388 Ga0213875_10000103 Ga0213875_1000010350 165
247 3300025917 Ga0207660_10158263 Ga0207660_101582632 165
248 3300025921 Ga0207652_10043660 Ga0207652_100436602 165
249 3300025944 Ga0207661_10142199 Ga0207661_101421992 165
250 3300037853 Ga0436364_0129406 Ga0436364_0129406_47723_48253 165
251 3300042876 Ga0451577_0066681 Ga0451577_0066681_1888_2388 165
252 3300044712 Ga0453684_0681202 Ga0453684_0681202_513_1013 165
253 3300050507 nmdc:mga05p37_485102_c1 nmdc:mga05p37_485102_c1_21_530 165
254 3300050510 nmdc:mga06r32_1415854_c1 nmdc:mga06r32_1415854_c1_63_602 165
255 3300050511 nmdc:mga08y16_689220_c1 nmdc:mga08y16_689220_c1_109_648 165
256 3300037418 Ga0395900_0090091 Ga0395900_0090091_399_929 166
257 3300001989 JGI24739J22299_10012254 JGI24739J22299_100122543 167
258 3300001990 JGI24737J22298_10013498 JGI24737J22298_100134982 167
259 3300002067 JGI24735J21928_10010485 JGI24735J21928_100104852 167
260 3300003215 JGI25153J46596_10073363 JGI25153J46596_100733632 167
261 3300005334 Ga0068869_100679812 Ga0068869_1006798122 167
262 3300005364 Ga0070673_100165892 Ga0070673_1001658923 167
263 3300005719 Ga0068861_100200236 Ga0068861_1002002362 167
264 3300009094 Ga0111539_11277237 Ga0111539_112772372 167
265 3300013104 Ga0157370_10012178 Ga0157370_100121788 167
266 3300013105 Ga0157369_10001986 Ga0157369_100019869 167
267 3300013308 Ga0157375_10972957 Ga0157375_109729572 167
268 3300014969 Ga0157376_10514946 Ga0157376_105149461 167
269 3300015687 Ga0183368_1003 Ga0183368_1003539 167
270 3300025226 Ga0209674_100012 Ga0209674_100012284 167
271 3300025242 Ga0209258_107067 Ga0209258_1070673 167
272 3300025258 Ga0209129_1000686 Ga0209129_10006862 167
273 3300025297 Ga0209758_1011754 Ga0209758_10117543 167
274 3300025299 Ga0209256_1026282 Ga0209256_10262823 167
275 3300025904 Ga0207647_10000078 Ga0207647_100000789 167
276 3300025925 Ga0207650_10139471 Ga0207650_101394712 167
277 3300025940 Ga0207691_10285833 Ga0207691_102858333 167
278 3300025972 Ga0207668_10340591 Ga0207668_103405912 167
279 3300025986 Ga0207658_10394306 Ga0207658_103943062 167
280 3300026118 Ga0207675_100074987 Ga0207675_1000749873 167
281 3300048919 Ga0496116_0144969 Ga0496116_0144969_22_537 167
282 3300048919 Ga0496116_0151536 Ga0496116_0151536_551_1066 167
283 3300048920 Ga0496117_0009154 Ga0496117_0009154_4730_5245 167
284 3300048921 Ga0496118_0001059 Ga0496118_0001059_8398_8913 167
285 3300048924 Ga0496121_0000541 Ga0496121_0000541_20674_21189 167
286 3300048925 Ga0496122_0082148 Ga0496122_0082148_976_1491 167
287 3300048926 Ga0496123_0012351 Ga0496123_0012351_2337_2852 167
288 3300048928 Ga0496125_0017338 Ga0496125_0017338_3102_3617 167
289 3300048929 Ga0496126_0040703 Ga0496126_0040703_35_550 167
290 iso_pu_bacteria 2593339239 2595451554 167
291 iso_pu_bacteria 2941471342 2941472498 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

18

167

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fw8-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89g from the acidophilic bacterium acetobacter aceti, at ph 8 0.9964 7 159
5clg-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) mutant h59n from the acidophilic bacterium acetobacter aceti, at ph 5.4 0.9964 7 159
5bor-assembly1.cif.gz_A structure of acetobacter aceti pure-s57c, sulfonate form 0.9962 7 159
5clh-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59n from the acidophilic bacterium acetobacter aceti, at ph 8 0.9959 8 159
4z7j-assembly1.cif.gz_A structure of acetobacter aceti pure-s57a 0.9957 7 159
ID Description Score Start End Superfamily
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9923 7 159 3.40.50.1970
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9884 30 161 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9867 14 161 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9801 10 161 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9723 2 160 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A017HSY8-F1-model_v4 Multifunctional fusion protein [Includes: N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase); N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase)] 1.002 8 133 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034023
GO:0034028
GO:0046872
AF-A0A317EAF4-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9991 4 157 GO:0006189
GO:0034023
AF-A0A136H9C8-F1-model_v4 deleted 0.999 9 147
AF-A0A2W7RNK3-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9988 8 158 GO:0006189
GO:0016829
GO:0034023
AF-A0A357KZ10-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase 0.9986 14 148 GO:0006189
GO:0016853

Feature Viewer

pLDDT pTM Quality
94.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map