F390044
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 194 | 289 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0124440|Ga0501083_0124440_305_619 |
| Length | 104 |
| Sequence | MNAEATNPGAAEIAANVEAGKALIATLTGRVVSDKMQKTVTVLVERRVKHPLYGKFITRSAKYHAHDEDNACKAGDLVEIQATRKLSKTKAWKVTRVVEKAVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 59 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 98 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 99 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 100 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 101 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 102 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 105 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 106 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 107 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 114 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 115 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 117 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 118 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 123 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 142 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 145 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 146 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 171 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 176 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 180 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 187 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 188 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 190 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 191 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.28 |
| Metatranscriptomes | 11.38 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.79 |
| Nodule | 0 |
| Rhizoplane | 4.14 |
| Rhizosphere | 90 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10004257 | 3300003322 | Bacteria | 11441 |
| 2 | JGI26145J50221_1001595 | 3300003371 | Bacteria | 1790 |
| 3 | Ga0070658_11906129 | 3300005327 | Unclassified | 513 |
| 4 | Ga0070676_10314916 | 3300005328 | Bacteria | 1065 |
| 5 | Ga0070683_101221798 | 3300005329 | Bacteria | 722 |
| 6 | Ga0070680_100612270 | 3300005336 | Bacteria | 935 |
| 7 | Ga0070682_101792314 | 3300005337 | Bacteria | 535 |
| 8 | Ga0070660_100590010 | 3300005339 | Bacteria | 928 |
| 9 | Ga0070671_100262166 | 3300005355 | Bacteria | 1469 |
| 10 | Ga0070673_100180192 | 3300005364 | Bacteria | 1808 |
| 11 | Ga0070673_100210052 | 3300005364 | Bacteria | 1680 |
| 12 | Ga0070659_100039243 | 3300005366 | Bacteria | 3696 |
| 13 | Ga0070659_100067710 | 3300005366 | Bacteria | 2832 |
| 14 | Ga0070667_100602303 | 3300005367 | Bacteria | 1012 |
| 15 | Ga0070714_100019109 | 3300005435 | Bacteria | 5577 |
| 16 | Ga0070713_101933339 | 3300005436 | Unclassified | 572 |
| 17 | Ga0070694_100773875 | 3300005444 | Bacteria | 785 |
| 18 | Ga0070708_100217706 | 3300005445 | Bacteria | 1790 |
| 19 | Ga0070663_101177775 | 3300005455 | Bacteria | 673 |
| 20 | Ga0070663_102034917 | 3300005455 | Bacteria | 517 |
| 21 | Ga0070662_100212947 | 3300005457 | Bacteria | 1538 |
| 22 | Ga0070662_100953139 | 3300005457 | Bacteria | 734 |
| 23 | Ga0070681_10931101 | 3300005458 | Bacteria | 788 |
| 24 | Ga0070681_11405167 | 3300005458 | Bacteria | 622 |
| 25 | Ga0068867_100438530 | 3300005459 | Bacteria | 1110 |
| 26 | Ga0070707_100236261 | 3300005468 | Bacteria | 1779 |
| 27 | Ga0070698_100198051 | 3300005471 | Bacteria | 1945 |
| 28 | Ga0070699_100137776 | 3300005518 | Bacteria | 2153 |
| 29 | Ga0070679_100853212 | 3300005530 | Bacteria | 854 |
| 30 | Ga0070672_100768039 | 3300005543 | Bacteria | 847 |
| 31 | Ga0070696_101545687 | 3300005546 | Bacteria | 569 |
| 32 | Ga0070693_101095488 | 3300005547 | Bacteria | 607 |
| 33 | Ga0068855_101732945 | 3300005563 | Unclassified | 636 |
| 34 | Ga0068856_100044462 | 3300005614 | Bacteria | 4372 |
| 35 | Ga0070702_100462353 | 3300005615 | Bacteria | 923 |
| 36 | Ga0068861_101001687 | 3300005719 | Bacteria | 797 |
| 37 | Ga0068863_101405454 | 3300005841 | Bacteria | 706 |
| 38 | Ga0075364_10011108 | 3300006051 | Bacteria | 5468 |
| 39 | Ga0070716_101658742 | 3300006173 | Unclassified | 526 |
| 40 | Ga0070712_101105915 | 3300006175 | Bacteria | 688 |
| 41 | Ga0075366_10502310 | 3300006195 | Bacteria | 750 |
| 42 | Ga0075370_10126170 | 3300006353 | Bacteria | 1492 |
| 43 | Ga0075433_10868857 | 3300006852 | Bacteria | 787 |
| 44 | Ga0075434_102024668 | 3300006871 | Bacteria | 581 |
| 45 | Ga0097620_101006658 | 3300006931 | Bacteria | 915 |
| 46 | Ga0075435_100100606 | 3300007076 | Bacteria | 2395 |
| 47 | Ga0075435_101084825 | 3300007076 | Bacteria | 700 |
| 48 | Ga0105240_11445438 | 3300009093 | Bacteria | 722 |
| 49 | Ga0111539_10104296 | 3300009094 | Bacteria | 3327 |
| 50 | Ga0105241_10601868 | 3300009174 | Unclassified | 993 |
| 51 | Ga0105248_10258530 | 3300009177 | Bacteria | 1960 |
| 52 | Ga0105239_11657208 | 3300010375 | Bacteria | 740 |
| 53 | Ga0157373_10063367 | 3300013100 | Bacteria | 2618 |
| 54 | Ga0157370_10003375 | 3300013104 | Bacteria | 18774 |
| 55 | Ga0157370_10758176 | 3300013104 | Bacteria | 884 |
| 56 | Ga0157374_10063292 | 3300013296 | Bacteria | 3469 |
| 57 | Ga0157378_10290591 | 3300013297 | Bacteria | 1579 |
| 58 | Ga0163162_12504835 | 3300013306 | Unclassified | 593 |
| 59 | Ga0157372_10126936 | 3300013307 | Bacteria | 2933 |
| 60 | Ga0157375_11190902 | 3300013308 | Bacteria | 893 |
| 61 | Ga0157380_10799396 | 3300014326 | Bacteria | 960 |
| 62 | Ga0182008_10130948 | 3300014497 | Bacteria | 1250 |
| 63 | Ga0163161_10223293 | 3300017792 | Unclassified | 1459 |
| 64 | Ga0213872_10007356 | 3300021361 | Bacteria | 5430 |
| 65 | Ga0213872_10062289 | 3300021361 | Bacteria | 1685 |
| 66 | Ga0213872_10216070 | 3300021361 | Bacteria | 817 |
| 67 | Ga0207645_10469378 | 3300025907 | Bacteria | 850 |
| 68 | Ga0207705_10988363 | 3300025909 | Bacteria | 650 |
| 69 | Ga0207654_10983628 | 3300025911 | Bacteria | 613 |
| 70 | Ga0207695_10981324 | 3300025913 | Bacteria | 724 |
| 71 | Ga0207693_10271269 | 3300025915 | Bacteria | 1329 |
| 72 | Ga0207657_10433103 | 3300025919 | Bacteria | 1033 |
| 73 | Ga0207652_10591283 | 3300025921 | Bacteria | 996 |
| 74 | Ga0207646_10158398 | 3300025922 | Bacteria | 2043 |
| 75 | Ga0207700_11463226 | 3300025928 | Bacteria | 607 |
| 76 | Ga0207690_10047030 | 3300025932 | Bacteria | 2861 |
| 77 | Ga0207690_10149986 | 3300025932 | Bacteria | 1727 |
| 78 | Ga0207706_10095885 | 3300025933 | Bacteria | 2609 |
| 79 | Ga0207706_10271395 | 3300025933 | Bacteria | 1480 |
| 80 | Ga0207691_10426527 | 3300025940 | Bacteria | 1130 |
| 81 | Ga0207691_10519794 | 3300025940 | Bacteria | 1010 |
| 82 | Ga0207667_12055444 | 3300025949 | Unclassified | 531 |
| 83 | Ga0207651_10733928 | 3300025960 | Bacteria | 872 |
| 84 | Ga0207658_10569036 | 3300025986 | Bacteria | 1015 |
| 85 | Ga0207678_10798992 | 3300026067 | Bacteria | 833 |
| 86 | Ga0207702_10074732 | 3300026078 | Bacteria | 2926 |
| 87 | Ga0209969_1000547 | 3300027360 | Bacteria | 5071 |
| 88 | Ga0209969_1014255 | 3300027360 | Bacteria | 1156 |
| 89 | Ga0209967_1002852 | 3300027364 | Bacteria | 2258 |
| 90 | Ga0209981_1081912 | 3300027378 | Bacteria | 503 |
| 91 | Ga0209996_1071808 | 3300027395 | Bacteria | 538 |
| 92 | Ga0209984_1013538 | 3300027424 | Bacteria | 1071 |
| 93 | Ga0210000_1006381 | 3300027462 | Bacteria | 1716 |
| 94 | Ga0209995_1012354 | 3300027471 | Bacteria | 1393 |
| 95 | Ga0209968_1012035 | 3300027526 | Bacteria | 1346 |
| 96 | Ga0209999_1043024 | 3300027543 | Bacteria | 848 |
| 97 | Ga0209982_1015979 | 3300027552 | Bacteria | 1140 |
| 98 | Ga0210002_1034197 | 3300027617 | Bacteria | 851 |
| 99 | Ga0209983_1003146 | 3300027665 | Bacteria | 3549 |
| 100 | Ga0209971_1000807 | 3300027682 | Bacteria | 8071 |
| 101 | Ga0209971_1125710 | 3300027682 | Bacteria | 631 |
| 102 | Ga0209966_1047485 | 3300027695 | Bacteria | 907 |
| 103 | Ga0209974_10000163 | 3300027876 | Bacteria | 20307 |
| 104 | Ga0209974_10037645 | 3300027876 | Bacteria | 1606 |
| 105 | Ga0207428_10129594 | 3300027907 | Bacteria | 1931 |
| 106 | Ga0265328_10156147 | 3300031239 | Bacteria | 859 |
| 107 | Ga0265331_10100416 | 3300031250 | Bacteria | 1332 |
| 108 | Ga0265327_10003591 | 3300031251 | Bacteria | 14634 |
| 109 | Ga0307509_10000050 | 3300031507 | Bacteria | 165692 |
| 110 | Ga0307408_100992821 | 3300031548 | Bacteria | 773 |
| 111 | Ga0307508_10349110 | 3300031616 | Bacteria | 1071 |
| 112 | Ga0316575_10001575 | 3300031665 | Bacteria | 7413 |
| 113 | Ga0316579_10000104 | 3300031691 | Bacteria | 22526 |
| 114 | Ga0316579_10003374 | 3300031691 | Bacteria | 6211 |
| 115 | Ga0316576_10000067 | 3300031727 | Bacteria | 34602 |
| 116 | Ga0316576_10000365 | 3300031727 | Bacteria | 20446 |
| 117 | Ga0316576_10014200 | 3300031727 | Bacteria | 5317 |
| 118 | Ga0316576_10027065 | 3300031727 | Bacteria | 4028 |
| 119 | Ga0316578_10000046 | 3300031728 | Bacteria | 25015 |
| 120 | Ga0316578_10014738 | 3300031728 | Bacteria | 4186 |
| 121 | Ga0316578_10045285 | 3300031728 | Bacteria | 2560 |
| 122 | Ga0316577_10001498 | 3300031733 | Bacteria | 11066 |
| 123 | Ga0316577_10140069 | 3300031733 | Bacteria | 1363 |
| 124 | Ga0316577_10232815 | 3300031733 | Bacteria | 1041 |
| 125 | Ga0307412_10605704 | 3300031911 | Bacteria | 928 |
| 126 | Ga0307412_12040513 | 3300031911 | Bacteria | 531 |
| 127 | Ga0316583_10009674 | 3300032133 | Bacteria | 3473 |
| 128 | Ga0316583_10083355 | 3300032133 | Bacteria | 1116 |
| 129 | Ga0316583_10278925 | 3300032133 | Bacteria | 578 |
| 130 | Ga0316585_10000029 | 3300032137 | Bacteria | 21513 |
| 131 | Ga0316585_10010856 | 3300032137 | Bacteria | 2677 |
| 132 | Ga0316585_10099456 | 3300032137 | Bacteria | 954 |
| 133 | Ga0316580_10000016 | 3300032139 | Bacteria | 26098 |
| 134 | Ga0316580_10006329 | 3300032139 | Bacteria | 3494 |
| 135 | Ga0316593_10000459 | 3300032168 | Bacteria | 7485 |
| 136 | Ga0316593_10000468 | 3300032168 | Bacteria | 7436 |
| 137 | Ga0316593_10000658 | 3300032168 | Bacteria | 6651 |
| 138 | Ga0316593_10006662 | 3300032168 | Bacteria | 3133 |
| 139 | Ga0316593_10013401 | 3300032168 | Bacteria | 2427 |
| 140 | Ga0316593_10092926 | 3300032168 | Bacteria | 1063 |
| 141 | Ga0316593_10094272 | 3300032168 | Bacteria | 1056 |
| 142 | Ga0316592_1000052 | 3300033524 | Bacteria | 9955 |
| 143 | Ga0316592_1013706 | 3300033524 | Bacteria | 1675 |
| 144 | Ga0316592_1046117 | 3300033524 | Bacteria | 970 |
| 145 | Ga0316592_1093821 | 3300033524 | Bacteria | 688 |
| 146 | Ga0316586_1001114 | 3300033527 | Bacteria | 2935 |
| 147 | Ga0316586_1006413 | 3300033527 | Bacteria | 1688 |
| 148 | Ga0316586_1078839 | 3300033527 | Bacteria | 613 |
| 149 | Ga0316588_1000195 | 3300033528 | Bacteria | 6976 |
| 150 | Ga0316588_1000372 | 3300033528 | Bacteria | 5863 |
| 151 | Ga0316588_1016607 | 3300033528 | Bacteria | 1633 |
| 152 | Ga0316588_1064440 | 3300033528 | Bacteria | 896 |
| 153 | Ga0316588_1078123 | 3300033528 | Bacteria | 817 |
| 154 | Ga0316587_1025920 | 3300033529 | Bacteria | 1020 |
| 155 | Ga0316596_1000017 | 3300033541 | Bacteria | 15063 |
| 156 | Ga0316596_1000038 | 3300033541 | Bacteria | 13809 |
| 157 | Ga0316596_1000971 | 3300033541 | Bacteria | 5484 |
| 158 | Ga0316596_1001409 | 3300033541 | Bacteria | 4831 |
| 159 | Ga0316596_1009066 | 3300033541 | Bacteria | 2384 |
| 160 | Ga0316596_1022080 | 3300033541 | Bacteria | 1625 |
| 161 | Ga0316596_1153301 | 3300033541 | Bacteria | 633 |
| 162 | Ga0373939_0274014 | 3300035114 | Bacteria | 664 |
| 163 | Ga0316574_0000016 | 3300035398 | Bacteria | 41302 |
| 164 | Ga0316574_0007928 | 3300035398 | Bacteria | 5862 |
| 165 | Ga0316574_0837227 | 3300035398 | Bacteria | 559 |
| 166 | Ga0373931_0035587 | 3300035691 | Bacteria | 2590 |
| 167 | Ga0373931_0795900 | 3300035691 | Bacteria | 630 |
| 168 | Ga0373933_0430762 | 3300035724 | Bacteria | 862 |
| 169 | Ga0316582_0000015 | 3300036647 | Bacteria | 41441 |
| 170 | Ga0316582_0019628 | 3300036647 | Bacteria | 3961 |
| 171 | Ga0316584_0000487 | 3300036712 | Bacteria | 20931 |
| 172 | Ga0316584_0004211 | 3300036712 | Bacteria | 9495 |
| 173 | Ga0316584_0151736 | 3300036712 | Bacteria | 1724 |
| 174 | Ga0316584_1033160 | 3300036712 | Bacteria | 548 |
| 175 | Ga0395900_0102763 | 3300037418 | Bacteria | 2936 |
| 176 | Ga0316581_0012590 | 3300037588 | Bacteria | 2383 |
| 177 | Ga0395901_1217122 | 3300038443 | Unclassified | 718 |
| 178 | Ga0400490_03371 | 3300038726 | Bacteria | 14955 |
| 179 | Ga0400483_085385 | 3300039062 | Bacteria | 1023 |
| 180 | Ga0436361_0206489 | 3300039447 | Bacteria | 1817 |
| 181 | Ga0436361_0687719 | 3300039447 | Bacteria | 1943 |
| 182 | Ga0451807_1162296 | 3300041486 | Bacteria | 749 |
| 183 | Ga0453684_0240501 | 3300044712 | Bacteria | 2084 |
| 184 | Ga0453684_0266270 | 3300044712 | Bacteria | 1961 |
| 185 | Ga0453684_0734082 | 3300044712 | Bacteria | 1070 |
| 186 | Ga0453684_1453507 | 3300044712 | Bacteria | 709 |
| 187 | Ga0466971_0690066 | 3300044719 | Bacteria | 513 |
| 188 | Ga0466957_0650074 | 3300044842 | Bacteria | 741 |
| 189 | Ga0451576_0091779 | 3300045051 | Bacteria | 3159 |
| 190 | Ga0451576_0409789 | 3300045051 | Bacteria | 1422 |
| 191 | Ga0451576_0973319 | 3300045051 | Bacteria | 889 |
| 192 | Ga0495607_0000153 | 3300046501 | Bacteria | 72099 |
| 193 | Ga0495624_0203340 | 3300046690 | Bacteria | 1203 |
| 194 | Ga0495626_0427112 | 3300048091 | Bacteria | 510 |
| 195 | Ga0496100_0064332 | 3300048903 | Bacteria | 2427 |
| 196 | Ga0496104_0551561 | 3300048907 | Bacteria | 1063 |
| 197 | Ga0496107_1016596 | 3300048910 | Bacteria | 601 |
| 198 | Ga0496108_0607844 | 3300048911 | Bacteria | 952 |
| 199 | Ga0496109_0128868 | 3300048912 | Bacteria | 2360 |
| 200 | Ga0496111_0464946 | 3300048914 | Bacteria | 933 |
| 201 | Ga0496113_0228299 | 3300048916 | Bacteria | 1484 |
| 202 | Ga0496113_0344565 | 3300048916 | Bacteria | 1195 |
| 203 | Ga0496114_0005126 | 3300048917 | Bacteria | 10216 |
| 204 | Ga0496114_0017760 | 3300048917 | Bacteria | 5748 |
| 205 | Ga0496115_0227645 | 3300048918 | Bacteria | 1538 |
| 206 | Ga0501343_008263 | 3300049132 | Bacteria | 830 |
| 207 | Ga0501305_008053 | 3300049161 | Bacteria | 1354 |
| 208 | Ga0501290_001582 | 3300049513 | Bacteria | 3072 |
| 209 | Ga0501300_027263 | 3300049523 | Bacteria | 839 |
| 210 | Ga0501312_009056 | 3300049528 | Bacteria | 1305 |
| 211 | Ga0501334_05452 | 3300049550 | Bacteria | 839 |
| 212 | Ga0501337_010384 | 3300049553 | Bacteria | 678 |
| 213 | Ga0501031_0003260 | 3300049568 | Bacteria | 10431 |
| 214 | Ga0501031_0500020 | 3300049568 | Bacteria | 784 |
| 215 | Ga0501031_0764554 | 3300049568 | Bacteria | 620 |
| 216 | Ga0501032_0000036 | 3300049569 | Bacteria | 117044 |
| 217 | Ga0501032_0298229 | 3300049569 | Bacteria | 1042 |
| 218 | Ga0501033_0001817 | 3300049570 | Bacteria | 18639 |
| 219 | Ga0501033_0016663 | 3300049570 | Bacteria | 5558 |
| 220 | Ga0501033_0635592 | 3300049570 | Bacteria | 730 |
| 221 | Ga0501034_0003361 | 3300049571 | Bacteria | 18264 |
| 222 | Ga0501034_0115492 | 3300049571 | Bacteria | 2673 |
| 223 | Ga0501036_0000512 | 3300049572 | Bacteria | 27832 |
| 224 | Ga0501036_0001490 | 3300049572 | Bacteria | 18035 |
| 225 | Ga0501036_0155706 | 3300049572 | Bacteria | 1927 |
| 226 | Ga0501036_0958378 | 3300049572 | Bacteria | 701 |
| 227 | Ga0501037_0001263 | 3300049573 | Bacteria | 18639 |
| 228 | Ga0501038_0003243 | 3300049574 | Bacteria | 15162 |
| 229 | Ga0501038_0082883 | 3300049574 | Bacteria | 2700 |
| 230 | Ga0501038_0104700 | 3300049574 | Bacteria | 2351 |
| 231 | Ga0501038_0431340 | 3300049574 | Bacteria | 1016 |
| 232 | Ga0501039_0011968 | 3300049575 | Bacteria | 6612 |
| 233 | Ga0501039_0066388 | 3300049575 | Bacteria | 2800 |
| 234 | Ga0501040_0000218 | 3300049576 | Bacteria | 33403 |
| 235 | Ga0501041_0000437 | 3300049577 | Bacteria | 21135 |
| 236 | Ga0501042_0000031 | 3300049578 | Bacteria | 46017 |
| 237 | Ga0501042_0053887 | 3300049578 | Bacteria | 2869 |
| 238 | Ga0501043_0000157 | 3300049579 | Bacteria | 62190 |
| 239 | Ga0501043_0006833 | 3300049579 | Bacteria | 9109 |
| 240 | Ga0501043_0293149 | 3300049579 | Bacteria | 1245 |
| 241 | Ga0501043_0917166 | 3300049579 | Bacteria | 627 |
| 242 | Ga0501046_0002577 | 3300049580 | Bacteria | 16965 |
| 243 | Ga0501046_0181001 | 3300049580 | Bacteria | 1576 |
| 244 | Ga0501047_0002207 | 3300049581 | Bacteria | 18639 |
| 245 | Ga0501048_0002716 | 3300049582 | Bacteria | 13496 |
| 246 | Ga0501048_0794461 | 3300049582 | Bacteria | 680 |
| 247 | Ga0501067_0414298 | 3300049583 | Bacteria | 752 |
| 248 | Ga0501068_0001608 | 3300049584 | Bacteria | 12025 |
| 249 | Ga0501068_0185450 | 3300049584 | Bacteria | 1316 |
| 250 | Ga0501071_0133510 | 3300049587 | Bacteria | 1845 |
| 251 | Ga0501072_0217347 | 3300049588 | Bacteria | 1523 |
| 252 | Ga0501074_1204390 | 3300049590 | Bacteria | 531 |
| 253 | Ga0501075_0001690 | 3300049591 | Bacteria | 14492 |
| 254 | Ga0501228_024033 | 3300049666 | Bacteria | 707 |
| 255 | Ga0501079_0049598 | 3300049741 | Bacteria | 3240 |
| 256 | Ga0501079_0081724 | 3300049741 | Bacteria | 2499 |
| 257 | Ga0501080_0259274 | 3300049742 | Bacteria | 1584 |
| 258 | Ga0501081_0002862 | 3300049743 | Bacteria | 10959 |
| 259 | Ga0501081_0677090 | 3300049743 | Bacteria | 774 |
| 260 | Ga0501081_0759496 | 3300049743 | Bacteria | 729 |
| 261 | Ga0501083_0124440 | 3300049744 | Bacteria | 1690 |
| 262 | Ga0501280_000425 | 3300049776 | Bacteria | 10117 |
| 263 | Ga0501035_0008893 | 3300049822 | Bacteria | 9344 |
| 264 | Ga0501035_0021868 | 3300049822 | Bacteria | 5876 |
| 265 | Ga0501035_0143044 | 3300049822 | Bacteria | 2078 |
| 266 | Ga0501044_0000389 | 3300049823 | Bacteria | 54483 |
| 267 | Ga0501044_0000747 | 3300049823 | Bacteria | 39287 |
| 268 | Ga0501044_0069788 | 3300049823 | Bacteria | 3577 |
| 269 | Ga0501044_0114288 | 3300049823 | Bacteria | 2706 |
| 270 | Ga0501045_0006501 | 3300049824 | Bacteria | 8101 |
| 271 | Ga0501045_0945479 | 3300049824 | Bacteria | 633 |
| 272 | nmdc:mga00v17_35453_c1 | 3300050491 | Bacteria | 2969 |
| 273 | nmdc:mga0k408_560282_c1 | 3300050493 | Bacteria | 675 |
| 274 | nmdc:mga07m45_58156_c1 | 3300050496 | Bacteria | 2187 |
| 275 | nmdc:mga08y16_199488_c1 | 3300050511 | Bacteria | 2074 |
| 276 | nmdc:mga0n895_1204233_c1 | 3300050512 | Bacteria | 731 |
| 277 | nmdc:mga0rr50_72239_c1 | 3300050513 | Bacteria | 2634 |
| 278 | nmdc:mga0a205_664123_c1 | 3300050515 | Bacteria | 893 |
| 279 | Ga0500607_007545 | 3300053121 | Bacteria | 6708 |
| 280 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 281 | Ga0500636_0017061 | 3300053177 | Bacteria | 4282 |
| 282 | Ga0500637_0015290 | 3300053178 | Bacteria | 4066 |
| 283 | Ga0500625_052930 | 3300053729 | Bacteria | 1868 |
| 284 | Ga0501084_0058903 | 3300054114 | Bacteria | 3214 |
| 285 | Ga0501084_0344694 | 3300054114 | Bacteria | 1258 |
| 286 | Ga0587076_002771 | 3300059645 | Bacteria | 2007 |
| 287 | Ga0501082_0023114 | 3300060353 | Bacteria | 5361 |
| 288 | Ga0501082_0782044 | 3300060353 | Bacteria | 835 |
| 289 | Ga0530510_0062355 | 3300061734 | Bacteria | 2699 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031727 | Ga0316576_10027065 | Ga0316576_100270658 | 82 |
| 2 | 3300031728 | Ga0316578_10014738 | Ga0316578_100147383 | 82 |
| 3 | 3300031733 | Ga0316577_10140069 | Ga0316577_101400693 | 82 |
| 4 | 3300032168 | Ga0316593_10006662 | Ga0316593_100066627 | 82 |
| 5 | 3300033524 | Ga0316592_1013706 | Ga0316592_10137064 | 82 |
| 6 | 3300033527 | Ga0316586_1078839 | Ga0316586_10788391 | 82 |
| 7 | 3300033528 | Ga0316588_1078123 | Ga0316588_10781232 | 82 |
| 8 | 3300033541 | Ga0316596_1000971 | Ga0316596_10009717 | 82 |
| 9 | 3300035691 | Ga0373931_0795900 | Ga0373931_0795900_61_318 | 82 |
| 10 | 3300046690 | Ga0495624_0203340 | Ga0495624_0203340_844_1101 | 82 |
| 11 | 3300041486 | Ga0451807_1162296 | Ga0451807_1162296_27_296 | 84 |
| 12 | 3300059645 | Ga0587076_002771 | Ga0587076_002771_1102_1362 | 84 |
| 13 | iso_pu_bacteria | 2643221603 | 2644026933 | 84 |
| 14 | 3300031665 | Ga0316575_10001575 | Ga0316575_100015754 | 85 |
| 15 | 3300031691 | Ga0316579_10000104 | Ga0316579_1000010426 | 85 |
| 16 | 3300031691 | Ga0316579_10003374 | Ga0316579_100033749 | 85 |
| 17 | 3300031727 | Ga0316576_10000067 | Ga0316576_1000006727 | 85 |
| 18 | 3300031727 | Ga0316576_10000365 | Ga0316576_1000036520 | 85 |
| 19 | 3300031727 | Ga0316576_10014200 | Ga0316576_100142009 | 85 |
| 20 | 3300031728 | Ga0316578_10000046 | Ga0316578_1000004612 | 85 |
| 21 | 3300031728 | Ga0316578_10045285 | Ga0316578_100452857 | 85 |
| 22 | 3300031733 | Ga0316577_10001498 | Ga0316577_1000149814 | 85 |
| 23 | 3300031733 | Ga0316577_10232815 | Ga0316577_102328153 | 85 |
| 24 | 3300032133 | Ga0316583_10009674 | Ga0316583_100096743 | 85 |
| 25 | 3300032133 | Ga0316583_10083355 | Ga0316583_100833554 | 85 |
| 26 | 3300032133 | Ga0316583_10278925 | Ga0316583_102789251 | 85 |
| 27 | 3300032137 | Ga0316585_10000029 | Ga0316585_1000002912 | 85 |
| 28 | 3300032137 | Ga0316585_10010856 | Ga0316585_100108564 | 85 |
| 29 | 3300032137 | Ga0316585_10099456 | Ga0316585_100994562 | 85 |
| 30 | 3300032139 | Ga0316580_10000016 | Ga0316580_1000001628 | 85 |
| 31 | 3300032139 | Ga0316580_10006329 | Ga0316580_100063297 | 85 |
| 32 | 3300032168 | Ga0316593_10000459 | Ga0316593_100004595 | 85 |
| 33 | 3300032168 | Ga0316593_10000468 | Ga0316593_100004686 | 85 |
| 34 | 3300032168 | Ga0316593_10000658 | Ga0316593_100006585 | 85 |
| 35 | 3300032168 | Ga0316593_10013401 | Ga0316593_100134013 | 85 |
| 36 | 3300032168 | Ga0316593_10092926 | Ga0316593_100929261 | 85 |
| 37 | 3300032168 | Ga0316593_10094272 | Ga0316593_100942724 | 85 |
| 38 | 3300033524 | Ga0316592_1000052 | Ga0316592_100005211 | 85 |
| 39 | 3300033524 | Ga0316592_1046117 | Ga0316592_10461172 | 85 |
| 40 | 3300033524 | Ga0316592_1093821 | Ga0316592_10938212 | 85 |
| 41 | 3300033527 | Ga0316586_1001114 | Ga0316586_10011144 | 85 |
| 42 | 3300033527 | Ga0316586_1006413 | Ga0316586_10064133 | 85 |
| 43 | 3300033528 | Ga0316588_1000195 | Ga0316588_10001955 | 85 |
| 44 | 3300033528 | Ga0316588_1000372 | Ga0316588_10003723 | 85 |
| 45 | 3300033528 | Ga0316588_1016607 | Ga0316588_10166074 | 85 |
| 46 | 3300033528 | Ga0316588_1064440 | Ga0316588_10644402 | 85 |
| 47 | 3300033529 | Ga0316587_1025920 | Ga0316587_10259201 | 85 |
| 48 | 3300033541 | Ga0316596_1000017 | Ga0316596_100001719 | 85 |
| 49 | 3300033541 | Ga0316596_1000038 | Ga0316596_100003818 | 85 |
| 50 | 3300033541 | Ga0316596_1001409 | Ga0316596_100140910 | 85 |
| 51 | 3300033541 | Ga0316596_1009066 | Ga0316596_10090663 | 85 |
| 52 | 3300033541 | Ga0316596_1022080 | Ga0316596_10220804 | 85 |
| 53 | 3300033541 | Ga0316596_1153301 | Ga0316596_11533011 | 85 |
| 54 | 3300035398 | Ga0316574_0000016 | Ga0316574_0000016_2735_2995 | 85 |
| 55 | 3300035398 | Ga0316574_0007928 | Ga0316574_0007928_2716_2991 | 85 |
| 56 | 3300035398 | Ga0316574_0837227 | Ga0316574_0837227_268_525 | 85 |
| 57 | 3300036647 | Ga0316582_0000015 | Ga0316582_0000015_5922_6182 | 85 |
| 58 | 3300036647 | Ga0316582_0019628 | Ga0316582_0019628_2366_2641 | 85 |
| 59 | 3300036712 | Ga0316584_0000487 | Ga0316584_0000487_15808_16068 | 85 |
| 60 | 3300036712 | Ga0316584_0004211 | Ga0316584_0004211_1065_1340 | 85 |
| 61 | 3300036712 | Ga0316584_0151736 | Ga0316584_0151736_986_1261 | 85 |
| 62 | 3300036712 | Ga0316584_1033160 | Ga0316584_1033160_73_330 | 85 |
| 63 | 3300037588 | Ga0316581_0012590 | Ga0316581_0012590_1633_1908 | 85 |
| 64 | 3300038726 | Ga0400490_03371 | Ga0400490_03371_5043_5306 | 85 |
| 65 | 3300039062 | Ga0400483_085385 | Ga0400483_085385_368_628 | 85 |
| 66 | 3300049570 | Ga0501033_0635592 | Ga0501033_0635592_234_491 | 85 |
| 67 | 3300003322 | rootL2_10004257 | rootL2_100042574 | 87 |
| 68 | 3300003371 | JGI26145J50221_1001595 | JGI26145J50221_10015954 | 87 |
| 69 | 3300005327 | Ga0070658_11906129 | Ga0070658_119061291 | 87 |
| 70 | 3300005328 | Ga0070676_10314916 | Ga0070676_103149162 | 87 |
| 71 | 3300005329 | Ga0070683_101221798 | Ga0070683_1012217982 | 87 |
| 72 | 3300005336 | Ga0070680_100612270 | Ga0070680_1006122702 | 87 |
| 73 | 3300005337 | Ga0070682_101792314 | Ga0070682_1017923141 | 87 |
| 74 | 3300005339 | Ga0070660_100590010 | Ga0070660_1005900101 | 87 |
| 75 | 3300005355 | Ga0070671_100262166 | Ga0070671_1002621664 | 87 |
| 76 | 3300005364 | Ga0070673_100180192 | Ga0070673_1001801924 | 87 |
| 77 | 3300005364 | Ga0070673_100210052 | Ga0070673_1002100522 | 87 |
| 78 | 3300005366 | Ga0070659_100039243 | Ga0070659_1000392435 | 87 |
| 79 | 3300005366 | Ga0070659_100067710 | Ga0070659_1000677104 | 87 |
| 80 | 3300005367 | Ga0070667_100602303 | Ga0070667_1006023033 | 87 |
| 81 | 3300005435 | Ga0070714_100019109 | Ga0070714_10001910911 | 87 |
| 82 | 3300005436 | Ga0070713_101933339 | Ga0070713_1019333391 | 87 |
| 83 | 3300005444 | Ga0070694_100773875 | Ga0070694_1007738751 | 87 |
| 84 | 3300005445 | Ga0070708_100217706 | Ga0070708_1002177064 | 87 |
| 85 | 3300005455 | Ga0070663_101177775 | Ga0070663_1011777751 | 87 |
| 86 | 3300005455 | Ga0070663_102034917 | Ga0070663_1020349171 | 87 |
| 87 | 3300005457 | Ga0070662_100212947 | Ga0070662_1002129473 | 87 |
| 88 | 3300005457 | Ga0070662_100953139 | Ga0070662_1009531392 | 87 |
| 89 | 3300005458 | Ga0070681_10931101 | Ga0070681_109311011 | 87 |
| 90 | 3300005458 | Ga0070681_11405167 | Ga0070681_114051673 | 87 |
| 91 | 3300005459 | Ga0068867_100438530 | Ga0068867_1004385302 | 87 |
| 92 | 3300005468 | Ga0070707_100236261 | Ga0070707_1002362612 | 87 |
| 93 | 3300005471 | Ga0070698_100198051 | Ga0070698_1001980514 | 87 |
| 94 | 3300005518 | Ga0070699_100137776 | Ga0070699_1001377764 | 87 |
| 95 | 3300005530 | Ga0070679_100853212 | Ga0070679_1008532123 | 87 |
| 96 | 3300005543 | Ga0070672_100768039 | Ga0070672_1007680393 | 87 |
| 97 | 3300005546 | Ga0070696_101545687 | Ga0070696_1015456871 | 87 |
| 98 | 3300005547 | Ga0070693_101095488 | Ga0070693_1010954883 | 87 |
| 99 | 3300005563 | Ga0068855_101732945 | Ga0068855_1017329452 | 87 |
| 100 | 3300005614 | Ga0068856_100044462 | Ga0068856_1000444627 | 87 |
| 101 | 3300005615 | Ga0070702_100462353 | Ga0070702_1004623532 | 87 |
| 102 | 3300005719 | Ga0068861_101001687 | Ga0068861_1010016871 | 87 |
| 103 | 3300005841 | Ga0068863_101405454 | Ga0068863_1014054543 | 87 |
| 104 | 3300006051 | Ga0075364_10011108 | Ga0075364_1001110811 | 87 |
| 105 | 3300006173 | Ga0070716_101658742 | Ga0070716_1016587421 | 87 |
| 106 | 3300006175 | Ga0070712_101105915 | Ga0070712_1011059152 | 87 |
| 107 | 3300006195 | Ga0075366_10502310 | Ga0075366_105023103 | 87 |
| 108 | 3300006353 | Ga0075370_10126170 | Ga0075370_101261704 | 87 |
| 109 | 3300006852 | Ga0075433_10868857 | Ga0075433_108688572 | 87 |
| 110 | 3300006871 | Ga0075434_102024668 | Ga0075434_1020246682 | 87 |
| 111 | 3300006931 | Ga0097620_101006658 | Ga0097620_1010066581 | 87 |
| 112 | 3300007076 | Ga0075435_100100606 | Ga0075435_1001006063 | 87 |
| 113 | 3300007076 | Ga0075435_101084825 | Ga0075435_1010848252 | 87 |
| 114 | 3300009093 | Ga0105240_11445438 | Ga0105240_114454382 | 87 |
| 115 | 3300009094 | Ga0111539_10104296 | Ga0111539_101042965 | 87 |
| 116 | 3300009174 | Ga0105241_10601868 | Ga0105241_106018683 | 87 |
| 117 | 3300009177 | Ga0105248_10258530 | Ga0105248_102585303 | 87 |
| 118 | 3300010375 | Ga0105239_11657208 | Ga0105239_116572081 | 87 |
| 119 | 3300013100 | Ga0157373_10063367 | Ga0157373_100633673 | 87 |
| 120 | 3300013104 | Ga0157370_10003375 | Ga0157370_1000337512 | 87 |
| 121 | 3300013104 | Ga0157370_10758176 | Ga0157370_107581762 | 87 |
| 122 | 3300013296 | Ga0157374_10063292 | Ga0157374_100632923 | 87 |
| 123 | 3300013297 | Ga0157378_10290591 | Ga0157378_102905914 | 87 |
| 124 | 3300013306 | Ga0163162_12504835 | Ga0163162_125048352 | 87 |
| 125 | 3300013307 | Ga0157372_10126936 | Ga0157372_101269362 | 87 |
| 126 | 3300013308 | Ga0157375_11190902 | Ga0157375_111909023 | 87 |
| 127 | 3300014326 | Ga0157380_10799396 | Ga0157380_107993963 | 87 |
| 128 | 3300014497 | Ga0182008_10130948 | Ga0182008_101309483 | 87 |
| 129 | 3300017792 | Ga0163161_10223293 | Ga0163161_102232931 | 87 |
| 130 | 3300021361 | Ga0213872_10007356 | Ga0213872_100073562 | 87 |
| 131 | 3300021361 | Ga0213872_10062289 | Ga0213872_100622894 | 87 |
| 132 | 3300021361 | Ga0213872_10216070 | Ga0213872_102160702 | 87 |
| 133 | 3300025907 | Ga0207645_10469378 | Ga0207645_104693783 | 87 |
| 134 | 3300025909 | Ga0207705_10988363 | Ga0207705_109883631 | 87 |
| 135 | 3300025911 | Ga0207654_10983628 | Ga0207654_109836281 | 87 |
| 136 | 3300025913 | Ga0207695_10981324 | Ga0207695_109813242 | 87 |
| 137 | 3300025915 | Ga0207693_10271269 | Ga0207693_102712691 | 87 |
| 138 | 3300025919 | Ga0207657_10433103 | Ga0207657_104331032 | 87 |
| 139 | 3300025921 | Ga0207652_10591283 | Ga0207652_105912831 | 87 |
| 140 | 3300025922 | Ga0207646_10158398 | Ga0207646_101583984 | 87 |
| 141 | 3300025928 | Ga0207700_11463226 | Ga0207700_114632261 | 87 |
| 142 | 3300025932 | Ga0207690_10047030 | Ga0207690_100470305 | 87 |
| 143 | 3300025932 | Ga0207690_10149986 | Ga0207690_101499862 | 87 |
| 144 | 3300025933 | Ga0207706_10095885 | Ga0207706_100958851 | 87 |
| 145 | 3300025933 | Ga0207706_10271395 | Ga0207706_102713954 | 87 |
| 146 | 3300025940 | Ga0207691_10426527 | Ga0207691_104265273 | 87 |
| 147 | 3300025940 | Ga0207691_10519794 | Ga0207691_105197941 | 87 |
| 148 | 3300025949 | Ga0207667_12055444 | Ga0207667_120554441 | 87 |
| 149 | 3300025960 | Ga0207651_10733928 | Ga0207651_107339282 | 87 |
| 150 | 3300025986 | Ga0207658_10569036 | Ga0207658_105690361 | 87 |
| 151 | 3300026067 | Ga0207678_10798992 | Ga0207678_107989922 | 87 |
| 152 | 3300026078 | Ga0207702_10074732 | Ga0207702_100747324 | 87 |
| 153 | 3300027360 | Ga0209969_1000547 | Ga0209969_10005473 | 87 |
| 154 | 3300027360 | Ga0209969_1014255 | Ga0209969_10142553 | 87 |
| 155 | 3300027364 | Ga0209967_1002852 | Ga0209967_10028523 | 87 |
| 156 | 3300027378 | Ga0209981_1081912 | Ga0209981_10819122 | 87 |
| 157 | 3300027395 | Ga0209996_1071808 | Ga0209996_10718082 | 87 |
| 158 | 3300027424 | Ga0209984_1013538 | Ga0209984_10135383 | 87 |
| 159 | 3300027462 | Ga0210000_1006381 | Ga0210000_10063814 | 87 |
| 160 | 3300027471 | Ga0209995_1012354 | Ga0209995_10123543 | 87 |
| 161 | 3300027526 | Ga0209968_1012035 | Ga0209968_10120352 | 87 |
| 162 | 3300027543 | Ga0209999_1043024 | Ga0209999_10430242 | 87 |
| 163 | 3300027552 | Ga0209982_1015979 | Ga0209982_10159792 | 87 |
| 164 | 3300027617 | Ga0210002_1034197 | Ga0210002_10341972 | 87 |
| 165 | 3300027665 | Ga0209983_1003146 | Ga0209983_10031464 | 87 |
| 166 | 3300027682 | Ga0209971_1000807 | Ga0209971_100080715 | 87 |
| 167 | 3300027682 | Ga0209971_1125710 | Ga0209971_11257102 | 87 |
| 168 | 3300027695 | Ga0209966_1047485 | Ga0209966_10474852 | 87 |
| 169 | 3300027876 | Ga0209974_10000163 | Ga0209974_1000016326 | 87 |
| 170 | 3300027876 | Ga0209974_10037645 | Ga0209974_100376452 | 87 |
| 171 | 3300027907 | Ga0207428_10129594 | Ga0207428_101295944 | 87 |
| 172 | 3300031239 | Ga0265328_10156147 | Ga0265328_101561471 | 87 |
| 173 | 3300031250 | Ga0265331_10100416 | Ga0265331_101004162 | 87 |
| 174 | 3300031251 | Ga0265327_10003591 | Ga0265327_1000359120 | 87 |
| 175 | 3300031507 | Ga0307509_10000050 | Ga0307509_1000005055 | 87 |
| 176 | 3300031548 | Ga0307408_100992821 | Ga0307408_1009928211 | 87 |
| 177 | 3300031616 | Ga0307508_10349110 | Ga0307508_103491102 | 87 |
| 178 | 3300031911 | Ga0307412_10605704 | Ga0307412_106057042 | 87 |
| 179 | 3300031911 | Ga0307412_12040513 | Ga0307412_120405132 | 87 |
| 180 | 3300035114 | Ga0373939_0274014 | Ga0373939_0274014_115_387 | 87 |
| 181 | 3300035691 | Ga0373931_0035587 | Ga0373931_0035587_661_933 | 87 |
| 182 | 3300035724 | Ga0373933_0430762 | Ga0373933_0430762_13_327 | 87 |
| 183 | 3300037418 | Ga0395900_0102763 | Ga0395900_0102763_212_478 | 87 |
| 184 | 3300038443 | Ga0395901_1217122 | Ga0395901_1217122_272_538 | 87 |
| 185 | 3300039447 | Ga0436361_0206489 | Ga0436361_0206489_344_607 | 87 |
| 186 | 3300039447 | Ga0436361_0687719 | Ga0436361_0687719_1338_1601 | 87 |
| 187 | 3300044712 | Ga0453684_0240501 | Ga0453684_0240501_1806_2069 | 87 |
| 188 | 3300044712 | Ga0453684_0266270 | Ga0453684_0266270_924_1190 | 87 |
| 189 | 3300044712 | Ga0453684_0734082 | Ga0453684_0734082_733_996 | 87 |
| 190 | 3300044712 | Ga0453684_1453507 | Ga0453684_1453507_44_307 | 87 |
| 191 | 3300044719 | Ga0466971_0690066 | Ga0466971_0690066_158_427 | 87 |
| 192 | 3300044842 | Ga0466957_0650074 | Ga0466957_0650074_65_337 | 87 |
| 193 | 3300045051 | Ga0451576_0091779 | Ga0451576_0091779_1812_2075 | 87 |
| 194 | 3300045051 | Ga0451576_0409789 | Ga0451576_0409789_786_1055 | 87 |
| 195 | 3300045051 | Ga0451576_0973319 | Ga0451576_0973319_269_535 | 87 |
| 196 | 3300046501 | Ga0495607_0000153 | Ga0495607_0000153_66476_66739 | 87 |
| 197 | 3300048091 | Ga0495626_0427112 | Ga0495626_0427112_107_370 | 87 |
| 198 | 3300048903 | Ga0496100_0064332 | Ga0496100_0064332_817_1083 | 87 |
| 199 | 3300048907 | Ga0496104_0551561 | Ga0496104_0551561_76_342 | 87 |
| 200 | 3300048910 | Ga0496107_1016596 | Ga0496107_1016596_134_400 | 87 |
| 201 | 3300048911 | Ga0496108_0607844 | Ga0496108_0607844_112_378 | 87 |
| 202 | 3300048912 | Ga0496109_0128868 | Ga0496109_0128868_1985_2251 | 87 |
| 203 | 3300048914 | Ga0496111_0464946 | Ga0496111_0464946_83_349 | 87 |
| 204 | 3300048916 | Ga0496113_0228299 | Ga0496113_0228299_995_1267 | 87 |
| 205 | 3300048916 | Ga0496113_0344565 | Ga0496113_0344565_247_513 | 87 |
| 206 | 3300048917 | Ga0496114_0005126 | Ga0496114_0005126_2331_2597 | 87 |
| 207 | 3300048917 | Ga0496114_0017760 | Ga0496114_0017760_230_496 | 87 |
| 208 | 3300048918 | Ga0496115_0227645 | Ga0496115_0227645_510_776 | 87 |
| 209 | 3300049132 | Ga0501343_008263 | Ga0501343_008263_510_782 | 87 |
| 210 | 3300049161 | Ga0501305_008053 | Ga0501305_008053_165_437 | 87 |
| 211 | 3300049513 | Ga0501290_001582 | Ga0501290_001582_1239_1505 | 87 |
| 212 | 3300049523 | Ga0501300_027263 | Ga0501300_027263_337_606 | 87 |
| 213 | 3300049528 | Ga0501312_009056 | Ga0501312_009056_228_500 | 87 |
| 214 | 3300049550 | Ga0501334_05452 | Ga0501334_05452_268_537 | 87 |
| 215 | 3300049553 | Ga0501337_010384 | Ga0501337_010384_20_286 | 87 |
| 216 | 3300049568 | Ga0501031_0003260 | Ga0501031_0003260_4834_5100 | 87 |
| 217 | 3300049568 | Ga0501031_0500020 | Ga0501031_0500020_91_360 | 87 |
| 218 | 3300049568 | Ga0501031_0764554 | Ga0501031_0764554_211_480 | 87 |
| 219 | 3300049569 | Ga0501032_0000036 | Ga0501032_0000036_103737_104003 | 87 |
| 220 | 3300049569 | Ga0501032_0298229 | Ga0501032_0298229_584_853 | 87 |
| 221 | 3300049570 | Ga0501033_0001817 | Ga0501033_0001817_5332_5598 | 87 |
| 222 | 3300049570 | Ga0501033_0016663 | Ga0501033_0016663_3284_3550 | 87 |
| 223 | 3300049571 | Ga0501034_0003361 | Ga0501034_0003361_5332_5598 | 87 |
| 224 | 3300049571 | Ga0501034_0115492 | Ga0501034_0115492_1466_1732 | 87 |
| 225 | 3300049572 | Ga0501036_0000512 | Ga0501036_0000512_25547_25813 | 87 |
| 226 | 3300049572 | Ga0501036_0001490 | Ga0501036_0001490_7838_8107 | 87 |
| 227 | 3300049572 | Ga0501036_0155706 | Ga0501036_0155706_1185_1448 | 87 |
| 228 | 3300049572 | Ga0501036_0958378 | Ga0501036_0958378_351_617 | 87 |
| 229 | 3300049573 | Ga0501037_0001263 | Ga0501037_0001263_13042_13308 | 87 |
| 230 | 3300049574 | Ga0501038_0003243 | Ga0501038_0003243_13042_13308 | 87 |
| 231 | 3300049574 | Ga0501038_0082883 | Ga0501038_0082883_1252_1515 | 87 |
| 232 | 3300049574 | Ga0501038_0104700 | Ga0501038_0104700_1857_2123 | 87 |
| 233 | 3300049574 | Ga0501038_0431340 | Ga0501038_0431340_244_513 | 87 |
| 234 | 3300049575 | Ga0501039_0011968 | Ga0501039_0011968_3378_3644 | 87 |
| 235 | 3300049575 | Ga0501039_0066388 | Ga0501039_0066388_1513_1776 | 87 |
| 236 | 3300049576 | Ga0501040_0000218 | Ga0501040_0000218_24143_24409 | 87 |
| 237 | 3300049577 | Ga0501041_0000437 | Ga0501041_0000437_7366_7629 | 87 |
| 238 | 3300049578 | Ga0501042_0000031 | Ga0501042_0000031_13330_13596 | 87 |
| 239 | 3300049578 | Ga0501042_0053887 | Ga0501042_0053887_150_413 | 87 |
| 240 | 3300049579 | Ga0501043_0000157 | Ga0501043_0000157_48883_49149 | 87 |
| 241 | 3300049579 | Ga0501043_0006833 | Ga0501043_0006833_5330_5599 | 87 |
| 242 | 3300049579 | Ga0501043_0293149 | Ga0501043_0293149_238_501 | 87 |
| 243 | 3300049579 | Ga0501043_0917166 | Ga0501043_0917166_265_531 | 87 |
| 244 | 3300049580 | Ga0501046_0002577 | Ga0501046_0002577_5311_5577 | 87 |
| 245 | 3300049580 | Ga0501046_0181001 | Ga0501046_0181001_135_398 | 87 |
| 246 | 3300049581 | Ga0501047_0002207 | Ga0501047_0002207_13042_13308 | 87 |
| 247 | 3300049582 | Ga0501048_0002716 | Ga0501048_0002716_13013_13279 | 87 |
| 248 | 3300049582 | Ga0501048_0794461 | Ga0501048_0794461_309_572 | 87 |
| 249 | 3300049583 | Ga0501067_0414298 | Ga0501067_0414298_439_705 | 87 |
| 250 | 3300049584 | Ga0501068_0001608 | Ga0501068_0001608_8388_8654 | 87 |
| 251 | 3300049584 | Ga0501068_0185450 | Ga0501068_0185450_396_659 | 87 |
| 252 | 3300049587 | Ga0501071_0133510 | Ga0501071_0133510_1533_1796 | 87 |
| 253 | 3300049588 | Ga0501072_0217347 | Ga0501072_0217347_488_751 | 87 |
| 254 | 3300049590 | Ga0501074_1204390 | Ga0501074_1204390_203_508 | 87 |
| 255 | 3300049591 | Ga0501075_0001690 | Ga0501075_0001690_9479_9742 | 87 |
| 256 | 3300049666 | Ga0501228_024033 | Ga0501228_024033_322_588 | 87 |
| 257 | 3300049741 | Ga0501079_0049598 | Ga0501079_0049598_2221_2484 | 87 |
| 258 | 3300049741 | Ga0501079_0081724 | Ga0501079_0081724_428_691 | 87 |
| 259 | 3300049742 | Ga0501080_0259274 | Ga0501080_0259274_889_1152 | 87 |
| 260 | 3300049743 | Ga0501081_0002862 | Ga0501081_0002862_5234_5497 | 87 |
| 261 | 3300049743 | Ga0501081_0677090 | Ga0501081_0677090_437_700 | 87 |
| 262 | 3300049743 | Ga0501081_0759496 | Ga0501081_0759496_165_434 | 87 |
| 263 | 3300049744 | Ga0501083_0124440 | Ga0501083_0124440_305_619 | 87 |
| 264 | 3300049776 | Ga0501280_000425 | Ga0501280_000425_8865_9134 | 87 |
| 265 | 3300049822 | Ga0501035_0008893 | Ga0501035_0008893_5332_5598 | 87 |
| 266 | 3300049822 | Ga0501035_0021868 | Ga0501035_0021868_278_547 | 87 |
| 267 | 3300049822 | Ga0501035_0143044 | Ga0501035_0143044_31_297 | 87 |
| 268 | 3300049823 | Ga0501044_0000389 | Ga0501044_0000389_7045_7314 | 87 |
| 269 | 3300049823 | Ga0501044_0000747 | Ga0501044_0000747_27515_27781 | 87 |
| 270 | 3300049823 | Ga0501044_0069788 | Ga0501044_0069788_2777_3043 | 87 |
| 271 | 3300049823 | Ga0501044_0114288 | Ga0501044_0114288_1524_1790 | 87 |
| 272 | 3300049824 | Ga0501045_0006501 | Ga0501045_0006501_5332_5598 | 87 |
| 273 | 3300049824 | Ga0501045_0945479 | Ga0501045_0945479_28_297 | 87 |
| 274 | 3300050491 | nmdc:mga00v17_35453_c1 | nmdc:mga00v17_35453_c1_1608_1892 | 87 |
| 275 | 3300050493 | nmdc:mga0k408_560282_c1 | nmdc:mga0k408_560282_c1_35_313 | 87 |
| 276 | 3300050496 | nmdc:mga07m45_58156_c1 | nmdc:mga07m45_58156_c1_367_645 | 87 |
| 277 | 3300050511 | nmdc:mga08y16_199488_c1 | nmdc:mga08y16_199488_c1_773_1039 | 87 |
| 278 | 3300050512 | nmdc:mga0n895_1204233_c1 | nmdc:mga0n895_1204233_c1_395_691 | 87 |
| 279 | 3300050513 | nmdc:mga0rr50_72239_c1 | nmdc:mga0rr50_72239_c1_1413_1709 | 87 |
| 280 | 3300050515 | nmdc:mga0a205_664123_c1 | nmdc:mga0a205_664123_c1_178_474 | 87 |
| 281 | 3300053121 | Ga0500607_007545 | Ga0500607_007545_5370_5651 | 87 |
| 282 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_5015_5287 | 87 |
| 283 | 3300053177 | Ga0500636_0017061 | Ga0500636_0017061_2432_2713 | 87 |
| 284 | 3300053178 | Ga0500637_0015290 | Ga0500637_0015290_912_1193 | 87 |
| 285 | 3300053729 | Ga0500625_052930 | Ga0500625_052930_743_1024 | 87 |
| 286 | 3300054114 | Ga0501084_0058903 | Ga0501084_0058903_689_952 | 87 |
| 287 | 3300054114 | Ga0501084_0344694 | Ga0501084_0344694_30_344 | 87 |
| 288 | 3300060353 | Ga0501082_0023114 | Ga0501082_0023114_2236_2499 | 87 |
| 289 | 3300060353 | Ga0501082_0782044 | Ga0501082_0782044_91_354 | 87 |
| 290 | 3300061734 | Ga0530510_0062355 | Ga0530510_0062355_537_800 | 87 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i96-assembly1.cif.gz_Q | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) | 0.9736 | 7 | 85 |
| 4v8c-assembly1.cif.gz_CT | crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). | 0.9696 | 7 | 85 |
| 4v4w-assembly1.cif.gz_AQ | structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 | 0.9693 | 8 | 85 |
| 4v4b-assembly1.cif.gz_AQ | structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. | 0.9683 | 8 | 80 |
| 8fr8-assembly1.cif.gz_r | structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex | 0.9671 | 7 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ms0Q00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9613 | 7 | 85 | 2.40.50.140 |
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9577 | 8 | 85 | 2.40.50.140 |
| af_Q03246_1_107_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9517 | 7 | 82 | 2.40.50.140 |
| 5xyuQ00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9502 | 7 | 84 | 2.40.50.140 |
| af_Q8ID56_26_114_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9487 | 9 | 86 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F2J2M8-F1-model_v4 | deleted | 0.9938 | 7 | 84 |
|
| AF-A0A3E0KTF9-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9878 | 7 | 83 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7Y8L3F6-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9877 | 6 | 87 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A3M1XPH5-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9868 | 7 | 85 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A5J6V8B7-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9867 | 7 | 85 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar