F390044

General Info

Members Datasets Scaffolds Average Seq Length
290 194 289 89

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0124440|Ga0501083_0124440_305_619
Length 104
Sequence MNAEATNPGAAEIAANVEAGKALIATLTGRVVSDKMQKTVTVLVERRVKHPLYGKFITRSAKYHAHDEDNACKAGDLVEIQATRKLSKTKAWKVTRVVEKAVAV

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
106 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
107 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
123 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
145 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
146 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.28
Metatranscriptomes 11.38
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 0
Rhizoplane 4.14
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10004257 3300003322 Bacteria 11441
2 JGI26145J50221_1001595 3300003371 Bacteria 1790
3 Ga0070658_11906129 3300005327 Unclassified 513
4 Ga0070676_10314916 3300005328 Bacteria 1065
5 Ga0070683_101221798 3300005329 Bacteria 722
6 Ga0070680_100612270 3300005336 Bacteria 935
7 Ga0070682_101792314 3300005337 Bacteria 535
8 Ga0070660_100590010 3300005339 Bacteria 928
9 Ga0070671_100262166 3300005355 Bacteria 1469
10 Ga0070673_100180192 3300005364 Bacteria 1808
11 Ga0070673_100210052 3300005364 Bacteria 1680
12 Ga0070659_100039243 3300005366 Bacteria 3696
13 Ga0070659_100067710 3300005366 Bacteria 2832
14 Ga0070667_100602303 3300005367 Bacteria 1012
15 Ga0070714_100019109 3300005435 Bacteria 5577
16 Ga0070713_101933339 3300005436 Unclassified 572
17 Ga0070694_100773875 3300005444 Bacteria 785
18 Ga0070708_100217706 3300005445 Bacteria 1790
19 Ga0070663_101177775 3300005455 Bacteria 673
20 Ga0070663_102034917 3300005455 Bacteria 517
21 Ga0070662_100212947 3300005457 Bacteria 1538
22 Ga0070662_100953139 3300005457 Bacteria 734
23 Ga0070681_10931101 3300005458 Bacteria 788
24 Ga0070681_11405167 3300005458 Bacteria 622
25 Ga0068867_100438530 3300005459 Bacteria 1110
26 Ga0070707_100236261 3300005468 Bacteria 1779
27 Ga0070698_100198051 3300005471 Bacteria 1945
28 Ga0070699_100137776 3300005518 Bacteria 2153
29 Ga0070679_100853212 3300005530 Bacteria 854
30 Ga0070672_100768039 3300005543 Bacteria 847
31 Ga0070696_101545687 3300005546 Bacteria 569
32 Ga0070693_101095488 3300005547 Bacteria 607
33 Ga0068855_101732945 3300005563 Unclassified 636
34 Ga0068856_100044462 3300005614 Bacteria 4372
35 Ga0070702_100462353 3300005615 Bacteria 923
36 Ga0068861_101001687 3300005719 Bacteria 797
37 Ga0068863_101405454 3300005841 Bacteria 706
38 Ga0075364_10011108 3300006051 Bacteria 5468
39 Ga0070716_101658742 3300006173 Unclassified 526
40 Ga0070712_101105915 3300006175 Bacteria 688
41 Ga0075366_10502310 3300006195 Bacteria 750
42 Ga0075370_10126170 3300006353 Bacteria 1492
43 Ga0075433_10868857 3300006852 Bacteria 787
44 Ga0075434_102024668 3300006871 Bacteria 581
45 Ga0097620_101006658 3300006931 Bacteria 915
46 Ga0075435_100100606 3300007076 Bacteria 2395
47 Ga0075435_101084825 3300007076 Bacteria 700
48 Ga0105240_11445438 3300009093 Bacteria 722
49 Ga0111539_10104296 3300009094 Bacteria 3327
50 Ga0105241_10601868 3300009174 Unclassified 993
51 Ga0105248_10258530 3300009177 Bacteria 1960
52 Ga0105239_11657208 3300010375 Bacteria 740
53 Ga0157373_10063367 3300013100 Bacteria 2618
54 Ga0157370_10003375 3300013104 Bacteria 18774
55 Ga0157370_10758176 3300013104 Bacteria 884
56 Ga0157374_10063292 3300013296 Bacteria 3469
57 Ga0157378_10290591 3300013297 Bacteria 1579
58 Ga0163162_12504835 3300013306 Unclassified 593
59 Ga0157372_10126936 3300013307 Bacteria 2933
60 Ga0157375_11190902 3300013308 Bacteria 893
61 Ga0157380_10799396 3300014326 Bacteria 960
62 Ga0182008_10130948 3300014497 Bacteria 1250
63 Ga0163161_10223293 3300017792 Unclassified 1459
64 Ga0213872_10007356 3300021361 Bacteria 5430
65 Ga0213872_10062289 3300021361 Bacteria 1685
66 Ga0213872_10216070 3300021361 Bacteria 817
67 Ga0207645_10469378 3300025907 Bacteria 850
68 Ga0207705_10988363 3300025909 Bacteria 650
69 Ga0207654_10983628 3300025911 Bacteria 613
70 Ga0207695_10981324 3300025913 Bacteria 724
71 Ga0207693_10271269 3300025915 Bacteria 1329
72 Ga0207657_10433103 3300025919 Bacteria 1033
73 Ga0207652_10591283 3300025921 Bacteria 996
74 Ga0207646_10158398 3300025922 Bacteria 2043
75 Ga0207700_11463226 3300025928 Bacteria 607
76 Ga0207690_10047030 3300025932 Bacteria 2861
77 Ga0207690_10149986 3300025932 Bacteria 1727
78 Ga0207706_10095885 3300025933 Bacteria 2609
79 Ga0207706_10271395 3300025933 Bacteria 1480
80 Ga0207691_10426527 3300025940 Bacteria 1130
81 Ga0207691_10519794 3300025940 Bacteria 1010
82 Ga0207667_12055444 3300025949 Unclassified 531
83 Ga0207651_10733928 3300025960 Bacteria 872
84 Ga0207658_10569036 3300025986 Bacteria 1015
85 Ga0207678_10798992 3300026067 Bacteria 833
86 Ga0207702_10074732 3300026078 Bacteria 2926
87 Ga0209969_1000547 3300027360 Bacteria 5071
88 Ga0209969_1014255 3300027360 Bacteria 1156
89 Ga0209967_1002852 3300027364 Bacteria 2258
90 Ga0209981_1081912 3300027378 Bacteria 503
91 Ga0209996_1071808 3300027395 Bacteria 538
92 Ga0209984_1013538 3300027424 Bacteria 1071
93 Ga0210000_1006381 3300027462 Bacteria 1716
94 Ga0209995_1012354 3300027471 Bacteria 1393
95 Ga0209968_1012035 3300027526 Bacteria 1346
96 Ga0209999_1043024 3300027543 Bacteria 848
97 Ga0209982_1015979 3300027552 Bacteria 1140
98 Ga0210002_1034197 3300027617 Bacteria 851
99 Ga0209983_1003146 3300027665 Bacteria 3549
100 Ga0209971_1000807 3300027682 Bacteria 8071
101 Ga0209971_1125710 3300027682 Bacteria 631
102 Ga0209966_1047485 3300027695 Bacteria 907
103 Ga0209974_10000163 3300027876 Bacteria 20307
104 Ga0209974_10037645 3300027876 Bacteria 1606
105 Ga0207428_10129594 3300027907 Bacteria 1931
106 Ga0265328_10156147 3300031239 Bacteria 859
107 Ga0265331_10100416 3300031250 Bacteria 1332
108 Ga0265327_10003591 3300031251 Bacteria 14634
109 Ga0307509_10000050 3300031507 Bacteria 165692
110 Ga0307408_100992821 3300031548 Bacteria 773
111 Ga0307508_10349110 3300031616 Bacteria 1071
112 Ga0316575_10001575 3300031665 Bacteria 7413
113 Ga0316579_10000104 3300031691 Bacteria 22526
114 Ga0316579_10003374 3300031691 Bacteria 6211
115 Ga0316576_10000067 3300031727 Bacteria 34602
116 Ga0316576_10000365 3300031727 Bacteria 20446
117 Ga0316576_10014200 3300031727 Bacteria 5317
118 Ga0316576_10027065 3300031727 Bacteria 4028
119 Ga0316578_10000046 3300031728 Bacteria 25015
120 Ga0316578_10014738 3300031728 Bacteria 4186
121 Ga0316578_10045285 3300031728 Bacteria 2560
122 Ga0316577_10001498 3300031733 Bacteria 11066
123 Ga0316577_10140069 3300031733 Bacteria 1363
124 Ga0316577_10232815 3300031733 Bacteria 1041
125 Ga0307412_10605704 3300031911 Bacteria 928
126 Ga0307412_12040513 3300031911 Bacteria 531
127 Ga0316583_10009674 3300032133 Bacteria 3473
128 Ga0316583_10083355 3300032133 Bacteria 1116
129 Ga0316583_10278925 3300032133 Bacteria 578
130 Ga0316585_10000029 3300032137 Bacteria 21513
131 Ga0316585_10010856 3300032137 Bacteria 2677
132 Ga0316585_10099456 3300032137 Bacteria 954
133 Ga0316580_10000016 3300032139 Bacteria 26098
134 Ga0316580_10006329 3300032139 Bacteria 3494
135 Ga0316593_10000459 3300032168 Bacteria 7485
136 Ga0316593_10000468 3300032168 Bacteria 7436
137 Ga0316593_10000658 3300032168 Bacteria 6651
138 Ga0316593_10006662 3300032168 Bacteria 3133
139 Ga0316593_10013401 3300032168 Bacteria 2427
140 Ga0316593_10092926 3300032168 Bacteria 1063
141 Ga0316593_10094272 3300032168 Bacteria 1056
142 Ga0316592_1000052 3300033524 Bacteria 9955
143 Ga0316592_1013706 3300033524 Bacteria 1675
144 Ga0316592_1046117 3300033524 Bacteria 970
145 Ga0316592_1093821 3300033524 Bacteria 688
146 Ga0316586_1001114 3300033527 Bacteria 2935
147 Ga0316586_1006413 3300033527 Bacteria 1688
148 Ga0316586_1078839 3300033527 Bacteria 613
149 Ga0316588_1000195 3300033528 Bacteria 6976
150 Ga0316588_1000372 3300033528 Bacteria 5863
151 Ga0316588_1016607 3300033528 Bacteria 1633
152 Ga0316588_1064440 3300033528 Bacteria 896
153 Ga0316588_1078123 3300033528 Bacteria 817
154 Ga0316587_1025920 3300033529 Bacteria 1020
155 Ga0316596_1000017 3300033541 Bacteria 15063
156 Ga0316596_1000038 3300033541 Bacteria 13809
157 Ga0316596_1000971 3300033541 Bacteria 5484
158 Ga0316596_1001409 3300033541 Bacteria 4831
159 Ga0316596_1009066 3300033541 Bacteria 2384
160 Ga0316596_1022080 3300033541 Bacteria 1625
161 Ga0316596_1153301 3300033541 Bacteria 633
162 Ga0373939_0274014 3300035114 Bacteria 664
163 Ga0316574_0000016 3300035398 Bacteria 41302
164 Ga0316574_0007928 3300035398 Bacteria 5862
165 Ga0316574_0837227 3300035398 Bacteria 559
166 Ga0373931_0035587 3300035691 Bacteria 2590
167 Ga0373931_0795900 3300035691 Bacteria 630
168 Ga0373933_0430762 3300035724 Bacteria 862
169 Ga0316582_0000015 3300036647 Bacteria 41441
170 Ga0316582_0019628 3300036647 Bacteria 3961
171 Ga0316584_0000487 3300036712 Bacteria 20931
172 Ga0316584_0004211 3300036712 Bacteria 9495
173 Ga0316584_0151736 3300036712 Bacteria 1724
174 Ga0316584_1033160 3300036712 Bacteria 548
175 Ga0395900_0102763 3300037418 Bacteria 2936
176 Ga0316581_0012590 3300037588 Bacteria 2383
177 Ga0395901_1217122 3300038443 Unclassified 718
178 Ga0400490_03371 3300038726 Bacteria 14955
179 Ga0400483_085385 3300039062 Bacteria 1023
180 Ga0436361_0206489 3300039447 Bacteria 1817
181 Ga0436361_0687719 3300039447 Bacteria 1943
182 Ga0451807_1162296 3300041486 Bacteria 749
183 Ga0453684_0240501 3300044712 Bacteria 2084
184 Ga0453684_0266270 3300044712 Bacteria 1961
185 Ga0453684_0734082 3300044712 Bacteria 1070
186 Ga0453684_1453507 3300044712 Bacteria 709
187 Ga0466971_0690066 3300044719 Bacteria 513
188 Ga0466957_0650074 3300044842 Bacteria 741
189 Ga0451576_0091779 3300045051 Bacteria 3159
190 Ga0451576_0409789 3300045051 Bacteria 1422
191 Ga0451576_0973319 3300045051 Bacteria 889
192 Ga0495607_0000153 3300046501 Bacteria 72099
193 Ga0495624_0203340 3300046690 Bacteria 1203
194 Ga0495626_0427112 3300048091 Bacteria 510
195 Ga0496100_0064332 3300048903 Bacteria 2427
196 Ga0496104_0551561 3300048907 Bacteria 1063
197 Ga0496107_1016596 3300048910 Bacteria 601
198 Ga0496108_0607844 3300048911 Bacteria 952
199 Ga0496109_0128868 3300048912 Bacteria 2360
200 Ga0496111_0464946 3300048914 Bacteria 933
201 Ga0496113_0228299 3300048916 Bacteria 1484
202 Ga0496113_0344565 3300048916 Bacteria 1195
203 Ga0496114_0005126 3300048917 Bacteria 10216
204 Ga0496114_0017760 3300048917 Bacteria 5748
205 Ga0496115_0227645 3300048918 Bacteria 1538
206 Ga0501343_008263 3300049132 Bacteria 830
207 Ga0501305_008053 3300049161 Bacteria 1354
208 Ga0501290_001582 3300049513 Bacteria 3072
209 Ga0501300_027263 3300049523 Bacteria 839
210 Ga0501312_009056 3300049528 Bacteria 1305
211 Ga0501334_05452 3300049550 Bacteria 839
212 Ga0501337_010384 3300049553 Bacteria 678
213 Ga0501031_0003260 3300049568 Bacteria 10431
214 Ga0501031_0500020 3300049568 Bacteria 784
215 Ga0501031_0764554 3300049568 Bacteria 620
216 Ga0501032_0000036 3300049569 Bacteria 117044
217 Ga0501032_0298229 3300049569 Bacteria 1042
218 Ga0501033_0001817 3300049570 Bacteria 18639
219 Ga0501033_0016663 3300049570 Bacteria 5558
220 Ga0501033_0635592 3300049570 Bacteria 730
221 Ga0501034_0003361 3300049571 Bacteria 18264
222 Ga0501034_0115492 3300049571 Bacteria 2673
223 Ga0501036_0000512 3300049572 Bacteria 27832
224 Ga0501036_0001490 3300049572 Bacteria 18035
225 Ga0501036_0155706 3300049572 Bacteria 1927
226 Ga0501036_0958378 3300049572 Bacteria 701
227 Ga0501037_0001263 3300049573 Bacteria 18639
228 Ga0501038_0003243 3300049574 Bacteria 15162
229 Ga0501038_0082883 3300049574 Bacteria 2700
230 Ga0501038_0104700 3300049574 Bacteria 2351
231 Ga0501038_0431340 3300049574 Bacteria 1016
232 Ga0501039_0011968 3300049575 Bacteria 6612
233 Ga0501039_0066388 3300049575 Bacteria 2800
234 Ga0501040_0000218 3300049576 Bacteria 33403
235 Ga0501041_0000437 3300049577 Bacteria 21135
236 Ga0501042_0000031 3300049578 Bacteria 46017
237 Ga0501042_0053887 3300049578 Bacteria 2869
238 Ga0501043_0000157 3300049579 Bacteria 62190
239 Ga0501043_0006833 3300049579 Bacteria 9109
240 Ga0501043_0293149 3300049579 Bacteria 1245
241 Ga0501043_0917166 3300049579 Bacteria 627
242 Ga0501046_0002577 3300049580 Bacteria 16965
243 Ga0501046_0181001 3300049580 Bacteria 1576
244 Ga0501047_0002207 3300049581 Bacteria 18639
245 Ga0501048_0002716 3300049582 Bacteria 13496
246 Ga0501048_0794461 3300049582 Bacteria 680
247 Ga0501067_0414298 3300049583 Bacteria 752
248 Ga0501068_0001608 3300049584 Bacteria 12025
249 Ga0501068_0185450 3300049584 Bacteria 1316
250 Ga0501071_0133510 3300049587 Bacteria 1845
251 Ga0501072_0217347 3300049588 Bacteria 1523
252 Ga0501074_1204390 3300049590 Bacteria 531
253 Ga0501075_0001690 3300049591 Bacteria 14492
254 Ga0501228_024033 3300049666 Bacteria 707
255 Ga0501079_0049598 3300049741 Bacteria 3240
256 Ga0501079_0081724 3300049741 Bacteria 2499
257 Ga0501080_0259274 3300049742 Bacteria 1584
258 Ga0501081_0002862 3300049743 Bacteria 10959
259 Ga0501081_0677090 3300049743 Bacteria 774
260 Ga0501081_0759496 3300049743 Bacteria 729
261 Ga0501083_0124440 3300049744 Bacteria 1690
262 Ga0501280_000425 3300049776 Bacteria 10117
263 Ga0501035_0008893 3300049822 Bacteria 9344
264 Ga0501035_0021868 3300049822 Bacteria 5876
265 Ga0501035_0143044 3300049822 Bacteria 2078
266 Ga0501044_0000389 3300049823 Bacteria 54483
267 Ga0501044_0000747 3300049823 Bacteria 39287
268 Ga0501044_0069788 3300049823 Bacteria 3577
269 Ga0501044_0114288 3300049823 Bacteria 2706
270 Ga0501045_0006501 3300049824 Bacteria 8101
271 Ga0501045_0945479 3300049824 Bacteria 633
272 nmdc:mga00v17_35453_c1 3300050491 Bacteria 2969
273 nmdc:mga0k408_560282_c1 3300050493 Bacteria 675
274 nmdc:mga07m45_58156_c1 3300050496 Bacteria 2187
275 nmdc:mga08y16_199488_c1 3300050511 Bacteria 2074
276 nmdc:mga0n895_1204233_c1 3300050512 Bacteria 731
277 nmdc:mga0rr50_72239_c1 3300050513 Bacteria 2634
278 nmdc:mga0a205_664123_c1 3300050515 Bacteria 893
279 Ga0500607_007545 3300053121 Bacteria 6708
280 Ga0500622_0000002 3300053156 Bacteria 646442
281 Ga0500636_0017061 3300053177 Bacteria 4282
282 Ga0500637_0015290 3300053178 Bacteria 4066
283 Ga0500625_052930 3300053729 Bacteria 1868
284 Ga0501084_0058903 3300054114 Bacteria 3214
285 Ga0501084_0344694 3300054114 Bacteria 1258
286 Ga0587076_002771 3300059645 Bacteria 2007
287 Ga0501082_0023114 3300060353 Bacteria 5361
288 Ga0501082_0782044 3300060353 Bacteria 835
289 Ga0530510_0062355 3300061734 Bacteria 2699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10027065 Ga0316576_100270658 82
2 3300031728 Ga0316578_10014738 Ga0316578_100147383 82
3 3300031733 Ga0316577_10140069 Ga0316577_101400693 82
4 3300032168 Ga0316593_10006662 Ga0316593_100066627 82
5 3300033524 Ga0316592_1013706 Ga0316592_10137064 82
6 3300033527 Ga0316586_1078839 Ga0316586_10788391 82
7 3300033528 Ga0316588_1078123 Ga0316588_10781232 82
8 3300033541 Ga0316596_1000971 Ga0316596_10009717 82
9 3300035691 Ga0373931_0795900 Ga0373931_0795900_61_318 82
10 3300046690 Ga0495624_0203340 Ga0495624_0203340_844_1101 82
11 3300041486 Ga0451807_1162296 Ga0451807_1162296_27_296 84
12 3300059645 Ga0587076_002771 Ga0587076_002771_1102_1362 84
13 iso_pu_bacteria 2643221603 2644026933 84
14 3300031665 Ga0316575_10001575 Ga0316575_100015754 85
15 3300031691 Ga0316579_10000104 Ga0316579_1000010426 85
16 3300031691 Ga0316579_10003374 Ga0316579_100033749 85
17 3300031727 Ga0316576_10000067 Ga0316576_1000006727 85
18 3300031727 Ga0316576_10000365 Ga0316576_1000036520 85
19 3300031727 Ga0316576_10014200 Ga0316576_100142009 85
20 3300031728 Ga0316578_10000046 Ga0316578_1000004612 85
21 3300031728 Ga0316578_10045285 Ga0316578_100452857 85
22 3300031733 Ga0316577_10001498 Ga0316577_1000149814 85
23 3300031733 Ga0316577_10232815 Ga0316577_102328153 85
24 3300032133 Ga0316583_10009674 Ga0316583_100096743 85
25 3300032133 Ga0316583_10083355 Ga0316583_100833554 85
26 3300032133 Ga0316583_10278925 Ga0316583_102789251 85
27 3300032137 Ga0316585_10000029 Ga0316585_1000002912 85
28 3300032137 Ga0316585_10010856 Ga0316585_100108564 85
29 3300032137 Ga0316585_10099456 Ga0316585_100994562 85
30 3300032139 Ga0316580_10000016 Ga0316580_1000001628 85
31 3300032139 Ga0316580_10006329 Ga0316580_100063297 85
32 3300032168 Ga0316593_10000459 Ga0316593_100004595 85
33 3300032168 Ga0316593_10000468 Ga0316593_100004686 85
34 3300032168 Ga0316593_10000658 Ga0316593_100006585 85
35 3300032168 Ga0316593_10013401 Ga0316593_100134013 85
36 3300032168 Ga0316593_10092926 Ga0316593_100929261 85
37 3300032168 Ga0316593_10094272 Ga0316593_100942724 85
38 3300033524 Ga0316592_1000052 Ga0316592_100005211 85
39 3300033524 Ga0316592_1046117 Ga0316592_10461172 85
40 3300033524 Ga0316592_1093821 Ga0316592_10938212 85
41 3300033527 Ga0316586_1001114 Ga0316586_10011144 85
42 3300033527 Ga0316586_1006413 Ga0316586_10064133 85
43 3300033528 Ga0316588_1000195 Ga0316588_10001955 85
44 3300033528 Ga0316588_1000372 Ga0316588_10003723 85
45 3300033528 Ga0316588_1016607 Ga0316588_10166074 85
46 3300033528 Ga0316588_1064440 Ga0316588_10644402 85
47 3300033529 Ga0316587_1025920 Ga0316587_10259201 85
48 3300033541 Ga0316596_1000017 Ga0316596_100001719 85
49 3300033541 Ga0316596_1000038 Ga0316596_100003818 85
50 3300033541 Ga0316596_1001409 Ga0316596_100140910 85
51 3300033541 Ga0316596_1009066 Ga0316596_10090663 85
52 3300033541 Ga0316596_1022080 Ga0316596_10220804 85
53 3300033541 Ga0316596_1153301 Ga0316596_11533011 85
54 3300035398 Ga0316574_0000016 Ga0316574_0000016_2735_2995 85
55 3300035398 Ga0316574_0007928 Ga0316574_0007928_2716_2991 85
56 3300035398 Ga0316574_0837227 Ga0316574_0837227_268_525 85
57 3300036647 Ga0316582_0000015 Ga0316582_0000015_5922_6182 85
58 3300036647 Ga0316582_0019628 Ga0316582_0019628_2366_2641 85
59 3300036712 Ga0316584_0000487 Ga0316584_0000487_15808_16068 85
60 3300036712 Ga0316584_0004211 Ga0316584_0004211_1065_1340 85
61 3300036712 Ga0316584_0151736 Ga0316584_0151736_986_1261 85
62 3300036712 Ga0316584_1033160 Ga0316584_1033160_73_330 85
63 3300037588 Ga0316581_0012590 Ga0316581_0012590_1633_1908 85
64 3300038726 Ga0400490_03371 Ga0400490_03371_5043_5306 85
65 3300039062 Ga0400483_085385 Ga0400483_085385_368_628 85
66 3300049570 Ga0501033_0635592 Ga0501033_0635592_234_491 85
67 3300003322 rootL2_10004257 rootL2_100042574 87
68 3300003371 JGI26145J50221_1001595 JGI26145J50221_10015954 87
69 3300005327 Ga0070658_11906129 Ga0070658_119061291 87
70 3300005328 Ga0070676_10314916 Ga0070676_103149162 87
71 3300005329 Ga0070683_101221798 Ga0070683_1012217982 87
72 3300005336 Ga0070680_100612270 Ga0070680_1006122702 87
73 3300005337 Ga0070682_101792314 Ga0070682_1017923141 87
74 3300005339 Ga0070660_100590010 Ga0070660_1005900101 87
75 3300005355 Ga0070671_100262166 Ga0070671_1002621664 87
76 3300005364 Ga0070673_100180192 Ga0070673_1001801924 87
77 3300005364 Ga0070673_100210052 Ga0070673_1002100522 87
78 3300005366 Ga0070659_100039243 Ga0070659_1000392435 87
79 3300005366 Ga0070659_100067710 Ga0070659_1000677104 87
80 3300005367 Ga0070667_100602303 Ga0070667_1006023033 87
81 3300005435 Ga0070714_100019109 Ga0070714_10001910911 87
82 3300005436 Ga0070713_101933339 Ga0070713_1019333391 87
83 3300005444 Ga0070694_100773875 Ga0070694_1007738751 87
84 3300005445 Ga0070708_100217706 Ga0070708_1002177064 87
85 3300005455 Ga0070663_101177775 Ga0070663_1011777751 87
86 3300005455 Ga0070663_102034917 Ga0070663_1020349171 87
87 3300005457 Ga0070662_100212947 Ga0070662_1002129473 87
88 3300005457 Ga0070662_100953139 Ga0070662_1009531392 87
89 3300005458 Ga0070681_10931101 Ga0070681_109311011 87
90 3300005458 Ga0070681_11405167 Ga0070681_114051673 87
91 3300005459 Ga0068867_100438530 Ga0068867_1004385302 87
92 3300005468 Ga0070707_100236261 Ga0070707_1002362612 87
93 3300005471 Ga0070698_100198051 Ga0070698_1001980514 87
94 3300005518 Ga0070699_100137776 Ga0070699_1001377764 87
95 3300005530 Ga0070679_100853212 Ga0070679_1008532123 87
96 3300005543 Ga0070672_100768039 Ga0070672_1007680393 87
97 3300005546 Ga0070696_101545687 Ga0070696_1015456871 87
98 3300005547 Ga0070693_101095488 Ga0070693_1010954883 87
99 3300005563 Ga0068855_101732945 Ga0068855_1017329452 87
100 3300005614 Ga0068856_100044462 Ga0068856_1000444627 87
101 3300005615 Ga0070702_100462353 Ga0070702_1004623532 87
102 3300005719 Ga0068861_101001687 Ga0068861_1010016871 87
103 3300005841 Ga0068863_101405454 Ga0068863_1014054543 87
104 3300006051 Ga0075364_10011108 Ga0075364_1001110811 87
105 3300006173 Ga0070716_101658742 Ga0070716_1016587421 87
106 3300006175 Ga0070712_101105915 Ga0070712_1011059152 87
107 3300006195 Ga0075366_10502310 Ga0075366_105023103 87
108 3300006353 Ga0075370_10126170 Ga0075370_101261704 87
109 3300006852 Ga0075433_10868857 Ga0075433_108688572 87
110 3300006871 Ga0075434_102024668 Ga0075434_1020246682 87
111 3300006931 Ga0097620_101006658 Ga0097620_1010066581 87
112 3300007076 Ga0075435_100100606 Ga0075435_1001006063 87
113 3300007076 Ga0075435_101084825 Ga0075435_1010848252 87
114 3300009093 Ga0105240_11445438 Ga0105240_114454382 87
115 3300009094 Ga0111539_10104296 Ga0111539_101042965 87
116 3300009174 Ga0105241_10601868 Ga0105241_106018683 87
117 3300009177 Ga0105248_10258530 Ga0105248_102585303 87
118 3300010375 Ga0105239_11657208 Ga0105239_116572081 87
119 3300013100 Ga0157373_10063367 Ga0157373_100633673 87
120 3300013104 Ga0157370_10003375 Ga0157370_1000337512 87
121 3300013104 Ga0157370_10758176 Ga0157370_107581762 87
122 3300013296 Ga0157374_10063292 Ga0157374_100632923 87
123 3300013297 Ga0157378_10290591 Ga0157378_102905914 87
124 3300013306 Ga0163162_12504835 Ga0163162_125048352 87
125 3300013307 Ga0157372_10126936 Ga0157372_101269362 87
126 3300013308 Ga0157375_11190902 Ga0157375_111909023 87
127 3300014326 Ga0157380_10799396 Ga0157380_107993963 87
128 3300014497 Ga0182008_10130948 Ga0182008_101309483 87
129 3300017792 Ga0163161_10223293 Ga0163161_102232931 87
130 3300021361 Ga0213872_10007356 Ga0213872_100073562 87
131 3300021361 Ga0213872_10062289 Ga0213872_100622894 87
132 3300021361 Ga0213872_10216070 Ga0213872_102160702 87
133 3300025907 Ga0207645_10469378 Ga0207645_104693783 87
134 3300025909 Ga0207705_10988363 Ga0207705_109883631 87
135 3300025911 Ga0207654_10983628 Ga0207654_109836281 87
136 3300025913 Ga0207695_10981324 Ga0207695_109813242 87
137 3300025915 Ga0207693_10271269 Ga0207693_102712691 87
138 3300025919 Ga0207657_10433103 Ga0207657_104331032 87
139 3300025921 Ga0207652_10591283 Ga0207652_105912831 87
140 3300025922 Ga0207646_10158398 Ga0207646_101583984 87
141 3300025928 Ga0207700_11463226 Ga0207700_114632261 87
142 3300025932 Ga0207690_10047030 Ga0207690_100470305 87
143 3300025932 Ga0207690_10149986 Ga0207690_101499862 87
144 3300025933 Ga0207706_10095885 Ga0207706_100958851 87
145 3300025933 Ga0207706_10271395 Ga0207706_102713954 87
146 3300025940 Ga0207691_10426527 Ga0207691_104265273 87
147 3300025940 Ga0207691_10519794 Ga0207691_105197941 87
148 3300025949 Ga0207667_12055444 Ga0207667_120554441 87
149 3300025960 Ga0207651_10733928 Ga0207651_107339282 87
150 3300025986 Ga0207658_10569036 Ga0207658_105690361 87
151 3300026067 Ga0207678_10798992 Ga0207678_107989922 87
152 3300026078 Ga0207702_10074732 Ga0207702_100747324 87
153 3300027360 Ga0209969_1000547 Ga0209969_10005473 87
154 3300027360 Ga0209969_1014255 Ga0209969_10142553 87
155 3300027364 Ga0209967_1002852 Ga0209967_10028523 87
156 3300027378 Ga0209981_1081912 Ga0209981_10819122 87
157 3300027395 Ga0209996_1071808 Ga0209996_10718082 87
158 3300027424 Ga0209984_1013538 Ga0209984_10135383 87
159 3300027462 Ga0210000_1006381 Ga0210000_10063814 87
160 3300027471 Ga0209995_1012354 Ga0209995_10123543 87
161 3300027526 Ga0209968_1012035 Ga0209968_10120352 87
162 3300027543 Ga0209999_1043024 Ga0209999_10430242 87
163 3300027552 Ga0209982_1015979 Ga0209982_10159792 87
164 3300027617 Ga0210002_1034197 Ga0210002_10341972 87
165 3300027665 Ga0209983_1003146 Ga0209983_10031464 87
166 3300027682 Ga0209971_1000807 Ga0209971_100080715 87
167 3300027682 Ga0209971_1125710 Ga0209971_11257102 87
168 3300027695 Ga0209966_1047485 Ga0209966_10474852 87
169 3300027876 Ga0209974_10000163 Ga0209974_1000016326 87
170 3300027876 Ga0209974_10037645 Ga0209974_100376452 87
171 3300027907 Ga0207428_10129594 Ga0207428_101295944 87
172 3300031239 Ga0265328_10156147 Ga0265328_101561471 87
173 3300031250 Ga0265331_10100416 Ga0265331_101004162 87
174 3300031251 Ga0265327_10003591 Ga0265327_1000359120 87
175 3300031507 Ga0307509_10000050 Ga0307509_1000005055 87
176 3300031548 Ga0307408_100992821 Ga0307408_1009928211 87
177 3300031616 Ga0307508_10349110 Ga0307508_103491102 87
178 3300031911 Ga0307412_10605704 Ga0307412_106057042 87
179 3300031911 Ga0307412_12040513 Ga0307412_120405132 87
180 3300035114 Ga0373939_0274014 Ga0373939_0274014_115_387 87
181 3300035691 Ga0373931_0035587 Ga0373931_0035587_661_933 87
182 3300035724 Ga0373933_0430762 Ga0373933_0430762_13_327 87
183 3300037418 Ga0395900_0102763 Ga0395900_0102763_212_478 87
184 3300038443 Ga0395901_1217122 Ga0395901_1217122_272_538 87
185 3300039447 Ga0436361_0206489 Ga0436361_0206489_344_607 87
186 3300039447 Ga0436361_0687719 Ga0436361_0687719_1338_1601 87
187 3300044712 Ga0453684_0240501 Ga0453684_0240501_1806_2069 87
188 3300044712 Ga0453684_0266270 Ga0453684_0266270_924_1190 87
189 3300044712 Ga0453684_0734082 Ga0453684_0734082_733_996 87
190 3300044712 Ga0453684_1453507 Ga0453684_1453507_44_307 87
191 3300044719 Ga0466971_0690066 Ga0466971_0690066_158_427 87
192 3300044842 Ga0466957_0650074 Ga0466957_0650074_65_337 87
193 3300045051 Ga0451576_0091779 Ga0451576_0091779_1812_2075 87
194 3300045051 Ga0451576_0409789 Ga0451576_0409789_786_1055 87
195 3300045051 Ga0451576_0973319 Ga0451576_0973319_269_535 87
196 3300046501 Ga0495607_0000153 Ga0495607_0000153_66476_66739 87
197 3300048091 Ga0495626_0427112 Ga0495626_0427112_107_370 87
198 3300048903 Ga0496100_0064332 Ga0496100_0064332_817_1083 87
199 3300048907 Ga0496104_0551561 Ga0496104_0551561_76_342 87
200 3300048910 Ga0496107_1016596 Ga0496107_1016596_134_400 87
201 3300048911 Ga0496108_0607844 Ga0496108_0607844_112_378 87
202 3300048912 Ga0496109_0128868 Ga0496109_0128868_1985_2251 87
203 3300048914 Ga0496111_0464946 Ga0496111_0464946_83_349 87
204 3300048916 Ga0496113_0228299 Ga0496113_0228299_995_1267 87
205 3300048916 Ga0496113_0344565 Ga0496113_0344565_247_513 87
206 3300048917 Ga0496114_0005126 Ga0496114_0005126_2331_2597 87
207 3300048917 Ga0496114_0017760 Ga0496114_0017760_230_496 87
208 3300048918 Ga0496115_0227645 Ga0496115_0227645_510_776 87
209 3300049132 Ga0501343_008263 Ga0501343_008263_510_782 87
210 3300049161 Ga0501305_008053 Ga0501305_008053_165_437 87
211 3300049513 Ga0501290_001582 Ga0501290_001582_1239_1505 87
212 3300049523 Ga0501300_027263 Ga0501300_027263_337_606 87
213 3300049528 Ga0501312_009056 Ga0501312_009056_228_500 87
214 3300049550 Ga0501334_05452 Ga0501334_05452_268_537 87
215 3300049553 Ga0501337_010384 Ga0501337_010384_20_286 87
216 3300049568 Ga0501031_0003260 Ga0501031_0003260_4834_5100 87
217 3300049568 Ga0501031_0500020 Ga0501031_0500020_91_360 87
218 3300049568 Ga0501031_0764554 Ga0501031_0764554_211_480 87
219 3300049569 Ga0501032_0000036 Ga0501032_0000036_103737_104003 87
220 3300049569 Ga0501032_0298229 Ga0501032_0298229_584_853 87
221 3300049570 Ga0501033_0001817 Ga0501033_0001817_5332_5598 87
222 3300049570 Ga0501033_0016663 Ga0501033_0016663_3284_3550 87
223 3300049571 Ga0501034_0003361 Ga0501034_0003361_5332_5598 87
224 3300049571 Ga0501034_0115492 Ga0501034_0115492_1466_1732 87
225 3300049572 Ga0501036_0000512 Ga0501036_0000512_25547_25813 87
226 3300049572 Ga0501036_0001490 Ga0501036_0001490_7838_8107 87
227 3300049572 Ga0501036_0155706 Ga0501036_0155706_1185_1448 87
228 3300049572 Ga0501036_0958378 Ga0501036_0958378_351_617 87
229 3300049573 Ga0501037_0001263 Ga0501037_0001263_13042_13308 87
230 3300049574 Ga0501038_0003243 Ga0501038_0003243_13042_13308 87
231 3300049574 Ga0501038_0082883 Ga0501038_0082883_1252_1515 87
232 3300049574 Ga0501038_0104700 Ga0501038_0104700_1857_2123 87
233 3300049574 Ga0501038_0431340 Ga0501038_0431340_244_513 87
234 3300049575 Ga0501039_0011968 Ga0501039_0011968_3378_3644 87
235 3300049575 Ga0501039_0066388 Ga0501039_0066388_1513_1776 87
236 3300049576 Ga0501040_0000218 Ga0501040_0000218_24143_24409 87
237 3300049577 Ga0501041_0000437 Ga0501041_0000437_7366_7629 87
238 3300049578 Ga0501042_0000031 Ga0501042_0000031_13330_13596 87
239 3300049578 Ga0501042_0053887 Ga0501042_0053887_150_413 87
240 3300049579 Ga0501043_0000157 Ga0501043_0000157_48883_49149 87
241 3300049579 Ga0501043_0006833 Ga0501043_0006833_5330_5599 87
242 3300049579 Ga0501043_0293149 Ga0501043_0293149_238_501 87
243 3300049579 Ga0501043_0917166 Ga0501043_0917166_265_531 87
244 3300049580 Ga0501046_0002577 Ga0501046_0002577_5311_5577 87
245 3300049580 Ga0501046_0181001 Ga0501046_0181001_135_398 87
246 3300049581 Ga0501047_0002207 Ga0501047_0002207_13042_13308 87
247 3300049582 Ga0501048_0002716 Ga0501048_0002716_13013_13279 87
248 3300049582 Ga0501048_0794461 Ga0501048_0794461_309_572 87
249 3300049583 Ga0501067_0414298 Ga0501067_0414298_439_705 87
250 3300049584 Ga0501068_0001608 Ga0501068_0001608_8388_8654 87
251 3300049584 Ga0501068_0185450 Ga0501068_0185450_396_659 87
252 3300049587 Ga0501071_0133510 Ga0501071_0133510_1533_1796 87
253 3300049588 Ga0501072_0217347 Ga0501072_0217347_488_751 87
254 3300049590 Ga0501074_1204390 Ga0501074_1204390_203_508 87
255 3300049591 Ga0501075_0001690 Ga0501075_0001690_9479_9742 87
256 3300049666 Ga0501228_024033 Ga0501228_024033_322_588 87
257 3300049741 Ga0501079_0049598 Ga0501079_0049598_2221_2484 87
258 3300049741 Ga0501079_0081724 Ga0501079_0081724_428_691 87
259 3300049742 Ga0501080_0259274 Ga0501080_0259274_889_1152 87
260 3300049743 Ga0501081_0002862 Ga0501081_0002862_5234_5497 87
261 3300049743 Ga0501081_0677090 Ga0501081_0677090_437_700 87
262 3300049743 Ga0501081_0759496 Ga0501081_0759496_165_434 87
263 3300049744 Ga0501083_0124440 Ga0501083_0124440_305_619 87
264 3300049776 Ga0501280_000425 Ga0501280_000425_8865_9134 87
265 3300049822 Ga0501035_0008893 Ga0501035_0008893_5332_5598 87
266 3300049822 Ga0501035_0021868 Ga0501035_0021868_278_547 87
267 3300049822 Ga0501035_0143044 Ga0501035_0143044_31_297 87
268 3300049823 Ga0501044_0000389 Ga0501044_0000389_7045_7314 87
269 3300049823 Ga0501044_0000747 Ga0501044_0000747_27515_27781 87
270 3300049823 Ga0501044_0069788 Ga0501044_0069788_2777_3043 87
271 3300049823 Ga0501044_0114288 Ga0501044_0114288_1524_1790 87
272 3300049824 Ga0501045_0006501 Ga0501045_0006501_5332_5598 87
273 3300049824 Ga0501045_0945479 Ga0501045_0945479_28_297 87
274 3300050491 nmdc:mga00v17_35453_c1 nmdc:mga00v17_35453_c1_1608_1892 87
275 3300050493 nmdc:mga0k408_560282_c1 nmdc:mga0k408_560282_c1_35_313 87
276 3300050496 nmdc:mga07m45_58156_c1 nmdc:mga07m45_58156_c1_367_645 87
277 3300050511 nmdc:mga08y16_199488_c1 nmdc:mga08y16_199488_c1_773_1039 87
278 3300050512 nmdc:mga0n895_1204233_c1 nmdc:mga0n895_1204233_c1_395_691 87
279 3300050513 nmdc:mga0rr50_72239_c1 nmdc:mga0rr50_72239_c1_1413_1709 87
280 3300050515 nmdc:mga0a205_664123_c1 nmdc:mga0a205_664123_c1_178_474 87
281 3300053121 Ga0500607_007545 Ga0500607_007545_5370_5651 87
282 3300053156 Ga0500622_0000002 Ga0500622_0000002_5015_5287 87
283 3300053177 Ga0500636_0017061 Ga0500636_0017061_2432_2713 87
284 3300053178 Ga0500637_0015290 Ga0500637_0015290_912_1193 87
285 3300053729 Ga0500625_052930 Ga0500625_052930_743_1024 87
286 3300054114 Ga0501084_0058903 Ga0501084_0058903_689_952 87
287 3300054114 Ga0501084_0344694 Ga0501084_0344694_30_344 87
288 3300060353 Ga0501082_0023114 Ga0501082_0023114_2236_2499 87
289 3300060353 Ga0501082_0782044 Ga0501082_0782044_91_354 87
290 3300061734 Ga0530510_0062355 Ga0530510_0062355_537_800 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

29

96

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i96-assembly1.cif.gz_Q crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) 0.9736 7 85
4v8c-assembly1.cif.gz_CT crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). 0.9696 7 85
4v4w-assembly1.cif.gz_AQ structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.9693 8 85
4v4b-assembly1.cif.gz_AQ structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. 0.9683 8 80
8fr8-assembly1.cif.gz_r structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.9671 7 84
ID Description Score Start End Superfamily
3ms0Q00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9613 7 85 2.40.50.140
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9577 8 85 2.40.50.140
af_Q03246_1_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9517 7 82 2.40.50.140
5xyuQ00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9502 7 84 2.40.50.140
af_Q8ID56_26_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9487 9 86 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0F2J2M8-F1-model_v4 deleted 0.9938 7 84
AF-A0A3E0KTF9-F1-model_v4 Small ribosomal subunit protein uS17 0.9878 7 83 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7Y8L3F6-F1-model_v4 Small ribosomal subunit protein uS17 0.9877 6 87 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A3M1XPH5-F1-model_v4 Small ribosomal subunit protein uS17 0.9868 7 85 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A5J6V8B7-F1-model_v4 Small ribosomal subunit protein uS17 0.9867 7 85 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
91.02 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map