F390036
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 197 | 290 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300049575|Ga0501039_0221820|Ga0501039_0221820_306_746 |
| Length | 146 |
| Sequence | MEPTIALSGQEIAIFRQEIEATVVSLLLDTNILIDYARGLPVAIAWLRSVPEPPYISIISLLELNVGARSQREERDIEAVCAKLRWLPITHEIAKHGGSFLRHFGKRHGIDIPDAIIAATAEHHGLRLATLNVKHFPMFPKLKRAY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 60 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 72 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 73 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 74 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 105 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 107 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 108 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 113 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 120 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 121 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 122 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 125 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 181 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 182 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 184 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 185 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 195 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.21 |
| Nodule | 0 |
| Rhizoplane | 2.76 |
| Rhizosphere | 88.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1000029 | 3300003792 | Bacteria | 179894 |
| 2 | Ga0070658_10992104 | 3300005327 | Bacteria | 730 |
| 3 | Ga0070676_10671226 | 3300005328 | Unclassified | 754 |
| 4 | Ga0070683_100069655 | 3300005329 | Bacteria | 3280 |
| 5 | Ga0070683_100289002 | 3300005329 | Bacteria | 1559 |
| 6 | Ga0070683_100769462 | 3300005329 | Bacteria | 922 |
| 7 | Ga0068869_100584529 | 3300005334 | Bacteria | 942 |
| 8 | Ga0070682_100563429 | 3300005337 | Bacteria | 894 |
| 9 | Ga0070691_10300605 | 3300005341 | Bacteria | 877 |
| 10 | Ga0070661_100335826 | 3300005344 | Bacteria | 1183 |
| 11 | Ga0070661_100451811 | 3300005344 | Bacteria | 1022 |
| 12 | Ga0070668_100567591 | 3300005347 | Bacteria | 989 |
| 13 | Ga0070667_101593932 | 3300005367 | Unclassified | 614 |
| 14 | Ga0070709_10026166 | 3300005434 | Bacteria | 3454 |
| 15 | Ga0070714_100775421 | 3300005435 | Unclassified | 928 |
| 16 | Ga0070714_101356679 | 3300005435 | Unclassified | 694 |
| 17 | Ga0070713_100174726 | 3300005436 | Bacteria | 1927 |
| 18 | Ga0070713_100518109 | 3300005436 | Bacteria | 1126 |
| 19 | Ga0070713_100557147 | 3300005436 | Bacteria | 1086 |
| 20 | Ga0070708_100565300 | 3300005445 | Unclassified | 1072 |
| 21 | Ga0070708_101414508 | 3300005445 | Unclassified | 649 |
| 22 | Ga0070663_100186143 | 3300005455 | Bacteria | 1613 |
| 23 | Ga0070678_100137321 | 3300005456 | Bacteria | 1951 |
| 24 | Ga0068867_100403701 | 3300005459 | Bacteria | 1153 |
| 25 | Ga0070706_100117398 | 3300005467 | Bacteria | 2479 |
| 26 | Ga0070679_101166369 | 3300005530 | Bacteria | 715 |
| 27 | Ga0070679_101183193 | 3300005530 | Bacteria | 710 |
| 28 | Ga0070684_100589056 | 3300005535 | Bacteria | 1034 |
| 29 | Ga0070695_100077632 | 3300005545 | Bacteria | 2189 |
| 30 | Ga0070665_100376640 | 3300005548 | Bacteria | 1426 |
| 31 | Ga0070664_100143718 | 3300005564 | Bacteria | 2102 |
| 32 | Ga0068857_100150033 | 3300005577 | Bacteria | 2111 |
| 33 | Ga0068854_100023654 | 3300005578 | Bacteria | 4198 |
| 34 | Ga0068856_101192931 | 3300005614 | Bacteria | 778 |
| 35 | Ga0068856_101381080 | 3300005614 | Bacteria | 719 |
| 36 | Ga0068852_101565415 | 3300005616 | Bacteria | 681 |
| 37 | Ga0068859_100661295 | 3300005617 | Bacteria | 1136 |
| 38 | Ga0068864_100520555 | 3300005618 | Bacteria | 1146 |
| 39 | Ga0068861_100269166 | 3300005719 | Bacteria | 1462 |
| 40 | Ga0068870_10122926 | 3300005840 | Bacteria | 1497 |
| 41 | Ga0068863_100423465 | 3300005841 | Bacteria | 1304 |
| 42 | Ga0068858_100747934 | 3300005842 | Bacteria | 952 |
| 43 | Ga0068860_100324740 | 3300005843 | Bacteria | 1511 |
| 44 | Ga0081538_10150710 | 3300005981 | Bacteria | 1053 |
| 45 | Ga0070717_10174669 | 3300006028 | Unclassified | 1870 |
| 46 | Ga0075365_10215506 | 3300006038 | Bacteria | 1346 |
| 47 | Ga0075368_10064798 | 3300006042 | Bacteria | 1468 |
| 48 | Ga0075363_100018577 | 3300006048 | Bacteria | 3467 |
| 49 | Ga0075364_10001020 | 3300006051 | Bacteria | 14868 |
| 50 | Ga0070716_100488319 | 3300006173 | Bacteria | 906 |
| 51 | Ga0070712_100446067 | 3300006175 | Unclassified | 1077 |
| 52 | Ga0075362_10476284 | 3300006177 | Bacteria | 636 |
| 53 | Ga0075367_10009075 | 3300006178 | Bacteria | 5180 |
| 54 | Ga0075428_100202369 | 3300006844 | Bacteria | 2146 |
| 55 | Ga0075428_100408720 | 3300006844 | Bacteria | 1454 |
| 56 | Ga0075428_100853964 | 3300006844 | Bacteria | 966 |
| 57 | Ga0075428_101142644 | 3300006844 | Unclassified | 822 |
| 58 | Ga0075430_100029193 | 3300006846 | Bacteria | 4681 |
| 59 | Ga0075430_100611844 | 3300006846 | Bacteria | 899 |
| 60 | Ga0075431_100045202 | 3300006847 | Bacteria | 4540 |
| 61 | Ga0075431_100324661 | 3300006847 | Bacteria | 1551 |
| 62 | Ga0075431_100606369 | 3300006847 | Unclassified | 1078 |
| 63 | Ga0075431_101014579 | 3300006847 | Unclassified | 796 |
| 64 | Ga0075434_101031916 | 3300006871 | Bacteria | 836 |
| 65 | Ga0075429_100153092 | 3300006880 | Bacteria | 2019 |
| 66 | Ga0075429_100411367 | 3300006880 | Bacteria | 1185 |
| 67 | Ga0075429_100964482 | 3300006880 | Bacteria | 746 |
| 68 | Ga0068865_100251231 | 3300006881 | Bacteria | 1396 |
| 69 | Ga0097620_100661263 | 3300006931 | Bacteria | 1136 |
| 70 | Ga0105240_10708467 | 3300009093 | Bacteria | 1098 |
| 71 | Ga0111539_10033237 | 3300009094 | Bacteria | 6263 |
| 72 | Ga0111539_10216168 | 3300009094 | Bacteria | 2233 |
| 73 | Ga0111539_10593028 | 3300009094 | Bacteria | 1290 |
| 74 | Ga0105247_10392799 | 3300009101 | Bacteria | 986 |
| 75 | Ga0114129_10028830 | 3300009147 | Bacteria | 7865 |
| 76 | Ga0114129_10106747 | 3300009147 | Bacteria | 3868 |
| 77 | Ga0114129_10342422 | 3300009147 | Bacteria | 1983 |
| 78 | Ga0114129_10777582 | 3300009147 | Bacteria | 1223 |
| 79 | Ga0114129_11699738 | 3300009147 | Unclassified | 770 |
| 80 | Ga0105248_11250579 | 3300009177 | Bacteria | 839 |
| 81 | Ga0105237_10829203 | 3300009545 | Unclassified | 932 |
| 82 | Ga0105249_10778236 | 3300009553 | Archaea | 1020 |
| 83 | Ga0105035_101510 | 3300009988 | Bacteria | 1620 |
| 84 | Ga0105028_101630 | 3300009993 | Bacteria | 2347 |
| 85 | Ga0105246_10287112 | 3300011119 | Bacteria | 1322 |
| 86 | Ga0157369_10240502 | 3300013105 | Bacteria | 1891 |
| 87 | Ga0157374_11095398 | 3300013296 | Bacteria | 817 |
| 88 | Ga0157375_10445058 | 3300013308 | Bacteria | 1461 |
| 89 | Ga0157375_10609650 | 3300013308 | Bacteria | 1250 |
| 90 | Ga0157375_12413045 | 3300013308 | Bacteria | 628 |
| 91 | Ga0163163_10190145 | 3300014325 | Bacteria | 2101 |
| 92 | Ga0157380_10978195 | 3300014326 | Bacteria | 878 |
| 93 | Ga0157377_10191024 | 3300014745 | Bacteria | 1294 |
| 94 | Ga0157379_10271421 | 3300014968 | Bacteria | 1542 |
| 95 | Ga0157379_11905932 | 3300014968 | Bacteria | 586 |
| 96 | Ga0157376_10737514 | 3300014969 | Bacteria | 993 |
| 97 | Ga0163161_10657426 | 3300017792 | Bacteria | 869 |
| 98 | Ga0213872_10289373 | 3300021361 | Bacteria | 682 |
| 99 | Ga0213875_10000309 | 3300021388 | Bacteria | 46706 |
| 100 | Ga0213875_10253391 | 3300021388 | Bacteria | 830 |
| 101 | Ga0224572_1067400 | 3300024225 | Bacteria | 662 |
| 102 | Ga0209051_1000042 | 3300025303 | Bacteria | 308486 |
| 103 | Ga0207653_10021028 | 3300025885 | Bacteria | 2068 |
| 104 | Ga0207643_10045577 | 3300025908 | Bacteria | 2477 |
| 105 | Ga0207705_10667629 | 3300025909 | Unclassified | 808 |
| 106 | Ga0207693_10530591 | 3300025915 | Bacteria | 918 |
| 107 | Ga0207693_10635612 | 3300025915 | Bacteria | 830 |
| 108 | Ga0207649_10517768 | 3300025920 | Bacteria | 909 |
| 109 | Ga0207650_11703355 | 3300025925 | Unclassified | 534 |
| 110 | Ga0207659_10331176 | 3300025926 | Bacteria | 1259 |
| 111 | Ga0207700_10181940 | 3300025928 | Bacteria | 1761 |
| 112 | Ga0207700_10339277 | 3300025928 | Bacteria | 1306 |
| 113 | Ga0207709_11055940 | 3300025935 | Unclassified | 666 |
| 114 | Ga0207669_10831268 | 3300025937 | Unclassified | 768 |
| 115 | Ga0207704_10064201 | 3300025938 | Bacteria | 2293 |
| 116 | Ga0207665_10287060 | 3300025939 | Bacteria | 1226 |
| 117 | Ga0207661_10586098 | 3300025944 | Bacteria | 1023 |
| 118 | Ga0207679_10541615 | 3300025945 | Bacteria | 1043 |
| 119 | Ga0207640_10253881 | 3300025981 | Bacteria | 1366 |
| 120 | Ga0207677_11693383 | 3300026023 | Unclassified | 586 |
| 121 | Ga0207703_10447799 | 3300026035 | Bacteria | 1206 |
| 122 | Ga0207678_10031327 | 3300026067 | Bacteria | 4639 |
| 123 | Ga0207708_10361414 | 3300026075 | Bacteria | 1193 |
| 124 | Ga0207702_10486030 | 3300026078 | Bacteria | 1202 |
| 125 | Ga0207702_11396798 | 3300026078 | Bacteria | 694 |
| 126 | Ga0207648_10790582 | 3300026089 | Bacteria | 883 |
| 127 | Ga0207676_10158995 | 3300026095 | Bacteria | 1955 |
| 128 | Ga0207674_10254090 | 3300026116 | Bacteria | 1704 |
| 129 | Ga0207675_100421980 | 3300026118 | Bacteria | 1317 |
| 130 | Ga0207675_102015198 | 3300026118 | Bacteria | 595 |
| 131 | Ga0207683_10278097 | 3300026121 | Bacteria | 1530 |
| 132 | Ga0209813_10003459 | 3300027866 | Bacteria | 3699 |
| 133 | Ga0207428_10002566 | 3300027907 | Bacteria | 18152 |
| 134 | Ga0207428_10378293 | 3300027907 | Bacteria | 1039 |
| 135 | Ga0268266_10246922 | 3300028379 | Bacteria | 1649 |
| 136 | Ga0268266_11833791 | 3300028379 | Bacteria | 581 |
| 137 | Ga0265338_10243249 | 3300028800 | Unclassified | 1331 |
| 138 | Ga0307511_10235102 | 3300030521 | Bacteria | 901 |
| 139 | Ga0265760_10059696 | 3300031090 | Bacteria | 1157 |
| 140 | Ga0307508_10483885 | 3300031616 | Unclassified | 832 |
| 141 | Ga0373926_0014148 | 3300035083 | Bacteria | 2709 |
| 142 | Ga0373945_0000090 | 3300035116 | Bacteria | 21258 |
| 143 | Ga0373953_0372114 | 3300035117 | Bacteria | 627 |
| 144 | Ga0373954_0306513 | 3300035118 | Archaea | 783 |
| 145 | Ga0373956_0241814 | 3300035119 | Unclassified | 858 |
| 146 | Ga0373957_0368638 | 3300035120 | Bacteria | 615 |
| 147 | Ga0373924_0004118 | 3300035410 | Bacteria | 5060 |
| 148 | Ga0373935_0406749 | 3300035692 | Bacteria | 978 |
| 149 | Ga0373935_0470641 | 3300035692 | Bacteria | 909 |
| 150 | Ga0373933_0565057 | 3300035724 | Archaea | 746 |
| 151 | Ga0373925_0950822 | 3300037068 | Bacteria | 708 |
| 152 | Ga0395905_0198957 | 3300037471 | Bacteria | 1879 |
| 153 | Ga0436364_0156042 | 3300037853 | Bacteria | 23649 |
| 154 | Ga0436364_0423175 | 3300037853 | Archaea | 738 |
| 155 | Ga0436364_1208739 | 3300037853 | Unclassified | 1949 |
| 156 | Ga0436364_1386613 | 3300037853 | Unclassified | 1559 |
| 157 | Ga0436360_0285176 | 3300039438 | Bacteria | 826 |
| 158 | Ga0436360_0841721 | 3300039438 | Unclassified | 1005 |
| 159 | Ga0436361_0900277 | 3300039447 | Archaea | 1157 |
| 160 | Ga0436362_0345175 | 3300039453 | Bacteria | 1520 |
| 161 | Ga0439440_0062541 | 3300042993 | Bacteria | 953 |
| 162 | Ga0466969_0011555 | 3300044656 | Bacteria | 4674 |
| 163 | Ga0453684_0063529 | 3300044712 | Bacteria | 4722 |
| 164 | Ga0466970_0005447 | 3300044765 | Bacteria | 6315 |
| 165 | Ga0466957_1397107 | 3300044842 | Unclassified | 509 |
| 166 | Ga0495629_0708003 | 3300046459 | Unclassified | 668 |
| 167 | Ga0495651_0274648 | 3300046462 | Bacteria | 1141 |
| 168 | Ga0495608_0111454 | 3300046511 | Unclassified | 1759 |
| 169 | Ga0495652_0270253 | 3300046529 | Bacteria | 1250 |
| 170 | Ga0495665_0016505 | 3300046531 | Bacteria | 3978 |
| 171 | Ga0495640_0103114 | 3300046533 | Bacteria | 1871 |
| 172 | Ga0495640_0268919 | 3300046533 | Archaea | 1063 |
| 173 | Ga0495668_0130036 | 3300046616 | Bacteria | 1378 |
| 174 | Ga0495634_0582413 | 3300046642 | Unclassified | 650 |
| 175 | Ga0495634_0649016 | 3300046642 | Archaea | 610 |
| 176 | Ga0495625_0200855 | 3300046660 | Bacteria | 1316 |
| 177 | Ga0495635_0160584 | 3300046663 | Bacteria | 1529 |
| 178 | Ga0495635_0883074 | 3300046663 | Archaea | 573 |
| 179 | Ga0495658_0294554 | 3300046683 | Bacteria | 1026 |
| 180 | Ga0495613_0289603 | 3300046689 | Unclassified | 1136 |
| 181 | Ga0495624_0265827 | 3300046690 | Bacteria | 1036 |
| 182 | Ga0495600_0093062 | 3300046809 | Bacteria | 1966 |
| 183 | Ga0495674_0205340 | 3300047319 | Bacteria | 1633 |
| 184 | Ga0495680_0049794 | 3300047322 | Bacteria | 3279 |
| 185 | Ga0495684_0034632 | 3300047471 | Bacteria | 3874 |
| 186 | Ga0495593_0435539 | 3300047673 | Unclassified | 656 |
| 187 | Ga0495614_0246811 | 3300048089 | Bacteria | 816 |
| 188 | Ga0496104_0475729 | 3300048907 | Bacteria | 1161 |
| 189 | Ga0496108_0328526 | 3300048911 | Bacteria | 1333 |
| 190 | Ga0496109_0454084 | 3300048912 | Bacteria | 1210 |
| 191 | Ga0496111_0780451 | 3300048914 | Bacteria | 692 |
| 192 | Ga0496112_0301770 | 3300048915 | Bacteria | 1547 |
| 193 | Ga0496113_1222669 | 3300048916 | Bacteria | 586 |
| 194 | Ga0496114_0608000 | 3300048917 | Bacteria | 964 |
| 195 | Ga0496115_0808024 | 3300048918 | Bacteria | 729 |
| 196 | Ga0501031_0035599 | 3300049568 | Bacteria | 3248 |
| 197 | Ga0501031_0154652 | 3300049568 | Bacteria | 1499 |
| 198 | Ga0501031_0441002 | 3300049568 | Unclassified | 841 |
| 199 | Ga0501032_0003015 | 3300049569 | Bacteria | 13063 |
| 200 | Ga0501034_0013497 | 3300049571 | Bacteria | 8410 |
| 201 | Ga0501034_0062658 | 3300049571 | Bacteria | 3734 |
| 202 | Ga0501034_0066397 | 3300049571 | Bacteria | 3620 |
| 203 | Ga0501036_0023592 | 3300049572 | Bacteria | 5184 |
| 204 | Ga0501038_0002270 | 3300049574 | Bacteria | 17874 |
| 205 | Ga0501038_1169691 | 3300049574 | Unclassified | 559 |
| 206 | Ga0501039_0221820 | 3300049575 | Unclassified | 1486 |
| 207 | Ga0501039_0378692 | 3300049575 | Bacteria | 1112 |
| 208 | Ga0501039_0426311 | 3300049575 | Unclassified | 1042 |
| 209 | Ga0501039_0569329 | 3300049575 | Unclassified | 889 |
| 210 | Ga0501040_0354129 | 3300049576 | Bacteria | 1052 |
| 211 | Ga0501040_0834598 | 3300049576 | Bacteria | 667 |
| 212 | Ga0501040_0954454 | 3300049576 | Unclassified | 621 |
| 213 | Ga0501041_0409065 | 3300049577 | Bacteria | 860 |
| 214 | Ga0501042_0232119 | 3300049578 | Bacteria | 1331 |
| 215 | Ga0501042_0407151 | 3300049578 | Unclassified | 986 |
| 216 | Ga0501043_0031991 | 3300049579 | Bacteria | 4135 |
| 217 | Ga0501043_0234168 | 3300049579 | Bacteria | 1418 |
| 218 | Ga0501046_0009396 | 3300049580 | Bacteria | 8452 |
| 219 | Ga0501046_0054789 | 3300049580 | Bacteria | 3136 |
| 220 | Ga0501046_0813578 | 3300049580 | Unclassified | 654 |
| 221 | Ga0501047_0004211 | 3300049581 | Bacteria | 13548 |
| 222 | Ga0501047_0088849 | 3300049581 | Bacteria | 2967 |
| 223 | Ga0501048_0000449 | 3300049582 | Bacteria | 28924 |
| 224 | Ga0501069_0945375 | 3300049585 | Unclassified | 525 |
| 225 | Ga0501070_0008071 | 3300049586 | Bacteria | 8910 |
| 226 | Ga0501070_0264882 | 3300049586 | Bacteria | 1404 |
| 227 | Ga0501070_0596684 | 3300049586 | Bacteria | 881 |
| 228 | Ga0501071_0084444 | 3300049587 | Bacteria | 2327 |
| 229 | Ga0501072_0042220 | 3300049588 | Bacteria | 3583 |
| 230 | Ga0501072_0446200 | 3300049588 | Unclassified | 1025 |
| 231 | Ga0501072_0929875 | 3300049588 | Bacteria | 679 |
| 232 | Ga0501072_1006688 | 3300049588 | Unclassified | 649 |
| 233 | Ga0501074_0079445 | 3300049590 | Unclassified | 2354 |
| 234 | Ga0501074_1203455 | 3300049590 | Bacteria | 531 |
| 235 | Ga0501075_0402555 | 3300049591 | Bacteria | 1043 |
| 236 | Ga0501076_0095619 | 3300049592 | Unclassified | 2393 |
| 237 | Ga0501076_0374332 | 3300049592 | Unclassified | 1170 |
| 238 | Ga0501076_0589737 | 3300049592 | Bacteria | 917 |
| 239 | Ga0501077_1088198 | 3300049593 | Unclassified | 514 |
| 240 | Ga0501079_0046857 | 3300049741 | Bacteria | 3336 |
| 241 | Ga0501079_0286377 | 3300049741 | Bacteria | 1288 |
| 242 | Ga0501079_0433295 | 3300049741 | Bacteria | 1032 |
| 243 | Ga0501081_0378977 | 3300049743 | Bacteria | 1045 |
| 244 | Ga0501081_0461772 | 3300049743 | Bacteria | 944 |
| 245 | Ga0501081_0556481 | 3300049743 | Bacteria | 857 |
| 246 | Ga0501035_0008532 | 3300049822 | Bacteria | 9541 |
| 247 | Ga0501035_0981119 | 3300049822 | Unclassified | 665 |
| 248 | Ga0501044_0021427 | 3300049823 | Bacteria | 6894 |
| 249 | Ga0501045_0306331 | 3300049824 | Bacteria | 1182 |
| 250 | Ga0501045_0310902 | 3300049824 | Bacteria | 1173 |
| 251 | Ga0501045_0575165 | 3300049824 | Unclassified | 835 |
| 252 | nmdc:mga03683_585518_c1 | 3300050489 | Unclassified | 545 |
| 253 | nmdc:mga03n38_459_c1 | 3300050490 | Bacteria | 10198 |
| 254 | nmdc:mga00v17_32307_c1 | 3300050491 | Bacteria | 3093 |
| 255 | nmdc:mga0yw44_1138781_c1 | 3300050492 | Unclassified | 527 |
| 256 | nmdc:mga0yw44_71525_c1 | 3300050492 | Bacteria | 2154 |
| 257 | nmdc:mga06z11_377_c1 | 3300050494 | Bacteria | 16781 |
| 258 | nmdc:mga04h51_9385_c1 | 3300050495 | Bacteria | 2651 |
| 259 | nmdc:mga05p37_1369580_c1 | 3300050507 | Bacteria | 715 |
| 260 | nmdc:mga05p37_8195_c1 | 3300050507 | Bacteria | 12353 |
| 261 | nmdc:mga09592_1552063_c1 | 3300050508 | Bacteria | 537 |
| 262 | nmdc:mga09592_47574_c1 | 3300050508 | Bacteria | 3615 |
| 263 | nmdc:mga09592_563652_c1 | 3300050508 | Bacteria | 978 |
| 264 | nmdc:mga09592_872338_c1 | 3300050508 | Bacteria | 758 |
| 265 | nmdc:mga0qj67_1117158_c1 | 3300050509 | Bacteria | 615 |
| 266 | nmdc:mga0qj67_242961_c1 | 3300050509 | Bacteria | 1461 |
| 267 | nmdc:mga0qj67_974842_c1 | 3300050509 | Bacteria | 666 |
| 268 | nmdc:mga06r32_1360079_c1 | 3300050510 | Bacteria | 653 |
| 269 | nmdc:mga06r32_22003_c1 | 3300050510 | Bacteria | 5889 |
| 270 | nmdc:mga06r32_612821_c1 | 3300050510 | Unclassified | 1059 |
| 271 | nmdc:mga06r32_7638_c1 | 3300050510 | Bacteria | 9724 |
| 272 | nmdc:mga08y16_170624_c1 | 3300050511 | Bacteria | 2260 |
| 273 | nmdc:mga08y16_24119_c1 | 3300050511 | Bacteria | 6423 |
| 274 | nmdc:mga08y16_649098_c1 | 3300050511 | Bacteria | 1060 |
| 275 | nmdc:mga0a205_183658_c1 | 3300050515 | Bacteria | 1985 |
| 276 | Ga0495601_0969002 | 3300053077 | Bacteria | 536 |
| 277 | Ga0500616_0324326 | 3300053153 | Bacteria | 633 |
| 278 | Ga0500611_103855 | 3300053727 | Bacteria | 739 |
| 279 | Ga0501084_0192588 | 3300054114 | Bacteria | 1720 |
| 280 | Ga0501084_0227232 | 3300054114 | Bacteria | 1575 |
| 281 | Ga0501084_0641884 | 3300054114 | Unclassified | 896 |
| 282 | Ga0501082_0181109 | 3300060353 | Unclassified | 1833 |
| 283 | Ga0501082_0309808 | 3300060353 | Bacteria | 1375 |
| 284 | Ga0501082_0338562 | 3300060353 | Unclassified | 1311 |
| 285 | Ga0501082_0842605 | 3300060353 | Bacteria | 802 |
| 286 | Ga0530510_0027581 | 3300061734 | Bacteria | 4069 |
| 287 | Ga0530510_0190192 | 3300061734 | Unclassified | 1524 |
| 288 | Ga0530510_0681309 | 3300061734 | Archaea | 783 |
| 289 | Ga0530510_1432266 | 3300061734 | Unclassified | 530 |
| 290 | Ga0530510_1509778 | 3300061734 | Unclassified | 516 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025885 | Ga0207653_10021028 | Ga0207653_100210281 | 103 |
| 2 | 3300005344 | Ga0070661_100335826 | Ga0070661_1003358262 | 117 |
| 3 | 3300005530 | Ga0070679_101183193 | Ga0070679_1011831932 | 117 |
| 4 | 3300013308 | Ga0157375_10445058 | Ga0157375_104450583 | 117 |
| 5 | 3300017792 | Ga0163161_10657426 | Ga0163161_106574261 | 117 |
| 6 | 3300009094 | Ga0111539_10216168 | Ga0111539_102161682 | 118 |
| 7 | 3300050511 | nmdc:mga08y16_170624_c1 | nmdc:mga08y16_170624_c1_537_899 | 118 |
| 8 | 3300005347 | Ga0070668_100567591 | Ga0070668_1005675912 | 119 |
| 9 | 3300005459 | Ga0068867_100403701 | Ga0068867_1004037012 | 119 |
| 10 | 3300005530 | Ga0070679_101166369 | Ga0070679_1011663691 | 119 |
| 11 | 3300005719 | Ga0068861_100269166 | Ga0068861_1002691661 | 119 |
| 12 | 3300014326 | Ga0157380_10978195 | Ga0157380_109781952 | 119 |
| 13 | 3300026089 | Ga0207648_10790582 | Ga0207648_107905822 | 119 |
| 14 | 3300026118 | Ga0207675_100421980 | Ga0207675_1004219803 | 119 |
| 15 | 3300046660 | Ga0495625_0200855 | Ga0495625_0200855_631_996 | 119 |
| 16 | 3300049586 | Ga0501070_0264882 | Ga0501070_0264882_812_1177 | 119 |
| 17 | 3300005843 | Ga0068860_100324740 | Ga0068860_1003247403 | 120 |
| 18 | 3300006038 | Ga0075365_10215506 | Ga0075365_102155063 | 120 |
| 19 | 3300006042 | Ga0075368_10064798 | Ga0075368_100647983 | 120 |
| 20 | 3300006048 | Ga0075363_100018577 | Ga0075363_1000185775 | 120 |
| 21 | 3300006051 | Ga0075364_10001020 | Ga0075364_100010208 | 120 |
| 22 | 3300006177 | Ga0075362_10476284 | Ga0075362_104762842 | 120 |
| 23 | 3300006178 | Ga0075367_10009075 | Ga0075367_100090754 | 120 |
| 24 | 3300006844 | Ga0075428_100202369 | Ga0075428_1002023695 | 120 |
| 25 | 3300006844 | Ga0075428_100408720 | Ga0075428_1004087203 | 120 |
| 26 | 3300006844 | Ga0075428_100853964 | Ga0075428_1008539642 | 120 |
| 27 | 3300006844 | Ga0075428_101142644 | Ga0075428_1011426442 | 120 |
| 28 | 3300006846 | Ga0075430_100029193 | Ga0075430_1000291932 | 120 |
| 29 | 3300006846 | Ga0075430_100611844 | Ga0075430_1006118442 | 120 |
| 30 | 3300006847 | Ga0075431_100045202 | Ga0075431_1000452024 | 120 |
| 31 | 3300006847 | Ga0075431_100324661 | Ga0075431_1003246613 | 120 |
| 32 | 3300006847 | Ga0075431_100606369 | Ga0075431_1006063692 | 120 |
| 33 | 3300006847 | Ga0075431_101014579 | Ga0075431_1010145792 | 120 |
| 34 | 3300006880 | Ga0075429_100153092 | Ga0075429_1001530924 | 120 |
| 35 | 3300006880 | Ga0075429_100411367 | Ga0075429_1004113672 | 120 |
| 36 | 3300006880 | Ga0075429_100964482 | Ga0075429_1009644822 | 120 |
| 37 | 3300009094 | Ga0111539_10033237 | Ga0111539_100332375 | 120 |
| 38 | 3300009094 | Ga0111539_10593028 | Ga0111539_105930283 | 120 |
| 39 | 3300009147 | Ga0114129_10028830 | Ga0114129_100288305 | 120 |
| 40 | 3300009147 | Ga0114129_10106747 | Ga0114129_101067477 | 120 |
| 41 | 3300009147 | Ga0114129_10342422 | Ga0114129_103424222 | 120 |
| 42 | 3300009147 | Ga0114129_10777582 | Ga0114129_107775823 | 120 |
| 43 | 3300009147 | Ga0114129_11699738 | Ga0114129_116997381 | 120 |
| 44 | 3300026075 | Ga0207708_10361414 | Ga0207708_103614141 | 120 |
| 45 | 3300026118 | Ga0207675_102015198 | Ga0207675_1020151981 | 120 |
| 46 | 3300027866 | Ga0209813_10003459 | Ga0209813_100034594 | 120 |
| 47 | 3300027907 | Ga0207428_10002566 | Ga0207428_100025668 | 120 |
| 48 | 3300027907 | Ga0207428_10378293 | Ga0207428_103782931 | 120 |
| 49 | 3300028379 | Ga0268266_11833791 | Ga0268266_118337912 | 120 |
| 50 | 3300046616 | Ga0495668_0130036 | Ga0495668_0130036_271_642 | 120 |
| 51 | 3300049574 | Ga0501038_1169691 | Ga0501038_1169691_140_508 | 120 |
| 52 | 3300049575 | Ga0501039_0221820 | Ga0501039_0221820_306_746 | 120 |
| 53 | 3300049575 | Ga0501039_0378692 | Ga0501039_0378692_72_446 | 120 |
| 54 | 3300049576 | Ga0501040_0954454 | Ga0501040_0954454_142_582 | 120 |
| 55 | 3300049577 | Ga0501041_0409065 | Ga0501041_0409065_260_700 | 120 |
| 56 | 3300049588 | Ga0501072_0042220 | Ga0501072_0042220_3098_3538 | 120 |
| 57 | 3300049592 | Ga0501076_0589737 | Ga0501076_0589737_270_641 | 120 |
| 58 | 3300049741 | Ga0501079_0046857 | Ga0501079_0046857_1909_2280 | 120 |
| 59 | 3300049824 | Ga0501045_0306331 | Ga0501045_0306331_65_436 | 120 |
| 60 | 3300049824 | Ga0501045_0575165 | Ga0501045_0575165_111_479 | 120 |
| 61 | 3300050489 | nmdc:mga03683_585518_c1 | nmdc:mga03683_585518_c1_47_418 | 120 |
| 62 | 3300050490 | nmdc:mga03n38_459_c1 | nmdc:mga03n38_459_c1_4029_4400 | 120 |
| 63 | 3300050491 | nmdc:mga00v17_32307_c1 | nmdc:mga00v17_32307_c1_1987_2358 | 120 |
| 64 | 3300050492 | nmdc:mga0yw44_1138781_c1 | nmdc:mga0yw44_1138781_c1_116_496 | 120 |
| 65 | 3300050492 | nmdc:mga0yw44_71525_c1 | nmdc:mga0yw44_71525_c1_931_1302 | 120 |
| 66 | 3300050494 | nmdc:mga06z11_377_c1 | nmdc:mga06z11_377_c1_10589_10960 | 120 |
| 67 | 3300050495 | nmdc:mga04h51_9385_c1 | nmdc:mga04h51_9385_c1_1365_1736 | 120 |
| 68 | 3300050507 | nmdc:mga05p37_1369580_c1 | nmdc:mga05p37_1369580_c1_248_619 | 120 |
| 69 | 3300050507 | nmdc:mga05p37_8195_c1 | nmdc:mga05p37_8195_c1_11105_11476 | 120 |
| 70 | 3300050508 | nmdc:mga09592_1552063_c1 | nmdc:mga09592_1552063_c1_61_429 | 120 |
| 71 | 3300050508 | nmdc:mga09592_47574_c1 | nmdc:mga09592_47574_c1_443_811 | 120 |
| 72 | 3300050508 | nmdc:mga09592_563652_c1 | nmdc:mga09592_563652_c1_350_718 | 120 |
| 73 | 3300050508 | nmdc:mga09592_872338_c1 | nmdc:mga09592_872338_c1_301_672 | 120 |
| 74 | 3300050509 | nmdc:mga0qj67_1117158_c1 | nmdc:mga0qj67_1117158_c1_101_472 | 120 |
| 75 | 3300050509 | nmdc:mga0qj67_242961_c1 | nmdc:mga0qj67_242961_c1_129_497 | 120 |
| 76 | 3300050509 | nmdc:mga0qj67_974842_c1 | nmdc:mga0qj67_974842_c1_15_386 | 120 |
| 77 | 3300050510 | nmdc:mga06r32_1360079_c1 | nmdc:mga06r32_1360079_c1_133_504 | 120 |
| 78 | 3300050510 | nmdc:mga06r32_22003_c1 | nmdc:mga06r32_22003_c1_4999_5367 | 120 |
| 79 | 3300050510 | nmdc:mga06r32_612821_c1 | nmdc:mga06r32_612821_c1_601_969 | 120 |
| 80 | 3300050510 | nmdc:mga06r32_7638_c1 | nmdc:mga06r32_7638_c1_5377_5748 | 120 |
| 81 | 3300050511 | nmdc:mga08y16_24119_c1 | nmdc:mga08y16_24119_c1_1882_2253 | 120 |
| 82 | 3300050511 | nmdc:mga08y16_649098_c1 | nmdc:mga08y16_649098_c1_41_412 | 120 |
| 83 | 3300050515 | nmdc:mga0a205_183658_c1 | nmdc:mga0a205_183658_c1_792_1163 | 120 |
| 84 | 3300053153 | Ga0500616_0324326 | Ga0500616_0324326_121_492 | 120 |
| 85 | 3300053727 | Ga0500611_103855 | Ga0500611_103855_316_687 | 120 |
| 86 | 3300054114 | Ga0501084_0192588 | Ga0501084_0192588_603_1043 | 120 |
| 87 | 3300060353 | Ga0501082_0309808 | Ga0501082_0309808_388_756 | 120 |
| 88 | 3300061734 | Ga0530510_0027581 | Ga0530510_0027581_1813_2184 | 120 |
| 89 | 3300061734 | Ga0530510_0681309 | Ga0530510_0681309_21_395 | 120 |
| 90 | 3300061734 | Ga0530510_1509778 | Ga0530510_1509778_101_469 | 120 |
| 91 | 3300009093 | Ga0105240_10708467 | Ga0105240_107084671 | 121 |
| 92 | 3300021361 | Ga0213872_10289373 | Ga0213872_102893732 | 121 |
| 93 | 3300039438 | Ga0436360_0285176 | Ga0436360_0285176_409_780 | 121 |
| 94 | 3300039438 | Ga0436360_0841721 | Ga0436360_0841721_125_496 | 121 |
| 95 | 3300039447 | Ga0436361_0900277 | Ga0436361_0900277_586_957 | 121 |
| 96 | 3300005436 | Ga0070713_100174726 | Ga0070713_1001747262 | 122 |
| 97 | 3300025928 | Ga0207700_10181940 | Ga0207700_101819402 | 122 |
| 98 | 3300044712 | Ga0453684_0063529 | Ga0453684_0063529_2922_3326 | 122 |
| 99 | 3300046511 | Ga0495608_0111454 | Ga0495608_0111454_24_401 | 122 |
| 100 | 3300049568 | Ga0501031_0035599 | Ga0501031_0035599_2345_2722 | 122 |
| 101 | 3300049571 | Ga0501034_0062658 | Ga0501034_0062658_1917_2291 | 122 |
| 102 | 3300049571 | Ga0501034_0066397 | Ga0501034_0066397_1805_2179 | 122 |
| 103 | 3300049575 | Ga0501039_0569329 | Ga0501039_0569329_502_879 | 122 |
| 104 | 3300049576 | Ga0501040_0354129 | Ga0501040_0354129_79_456 | 122 |
| 105 | 3300049578 | Ga0501042_0232119 | Ga0501042_0232119_816_1193 | 122 |
| 106 | 3300049580 | Ga0501046_0054789 | Ga0501046_0054789_603_980 | 122 |
| 107 | 3300049581 | Ga0501047_0088849 | Ga0501047_0088849_287_661 | 122 |
| 108 | 3300049588 | Ga0501072_0446200 | Ga0501072_0446200_350_727 | 122 |
| 109 | 3300049590 | Ga0501074_0079445 | Ga0501074_0079445_61_438 | 122 |
| 110 | 3300049592 | Ga0501076_0095619 | Ga0501076_0095619_1162_1539 | 122 |
| 111 | 3300049593 | Ga0501077_1088198 | Ga0501077_1088198_20_397 | 122 |
| 112 | 3300049743 | Ga0501081_0378977 | Ga0501081_0378977_471_848 | 122 |
| 113 | 3300054114 | Ga0501084_0641884 | Ga0501084_0641884_403_780 | 122 |
| 114 | 3300060353 | Ga0501082_0338562 | Ga0501082_0338562_89_466 | 122 |
| 115 | 3300005445 | Ga0070708_101414508 | Ga0070708_1014145081 | 123 |
| 116 | 3300005981 | Ga0081538_10150710 | Ga0081538_101507102 | 123 |
| 117 | 3300037471 | Ga0395905_0198957 | Ga0395905_0198957_1069_1446 | 123 |
| 118 | 3300042993 | Ga0439440_0062541 | Ga0439440_0062541_160_552 | 123 |
| 119 | 3300049568 | Ga0501031_0154652 | Ga0501031_0154652_777_1157 | 123 |
| 120 | 3300049568 | Ga0501031_0441002 | Ga0501031_0441002_415_795 | 123 |
| 121 | 3300049575 | Ga0501039_0426311 | Ga0501039_0426311_13_393 | 123 |
| 122 | 3300049576 | Ga0501040_0834598 | Ga0501040_0834598_122_502 | 123 |
| 123 | 3300049578 | Ga0501042_0407151 | Ga0501042_0407151_301_681 | 123 |
| 124 | 3300049579 | Ga0501043_0234168 | Ga0501043_0234168_905_1285 | 123 |
| 125 | 3300049580 | Ga0501046_0813578 | Ga0501046_0813578_137_517 | 123 |
| 126 | 3300049585 | Ga0501069_0945375 | Ga0501069_0945375_77_457 | 123 |
| 127 | 3300049586 | Ga0501070_0596684 | Ga0501070_0596684_163_543 | 123 |
| 128 | 3300049587 | Ga0501071_0084444 | Ga0501071_0084444_1074_1454 | 123 |
| 129 | 3300049588 | Ga0501072_0929875 | Ga0501072_0929875_221_592 | 123 |
| 130 | 3300049588 | Ga0501072_1006688 | Ga0501072_1006688_107_487 | 123 |
| 131 | 3300049590 | Ga0501074_1203455 | Ga0501074_1203455_115_486 | 123 |
| 132 | 3300049591 | Ga0501075_0402555 | Ga0501075_0402555_336_716 | 123 |
| 133 | 3300049592 | Ga0501076_0374332 | Ga0501076_0374332_749_1129 | 123 |
| 134 | 3300049741 | Ga0501079_0286377 | Ga0501079_0286377_722_1102 | 123 |
| 135 | 3300049741 | Ga0501079_0433295 | Ga0501079_0433295_273_653 | 123 |
| 136 | 3300049743 | Ga0501081_0461772 | Ga0501081_0461772_302_673 | 123 |
| 137 | 3300049743 | Ga0501081_0556481 | Ga0501081_0556481_263_643 | 123 |
| 138 | 3300049822 | Ga0501035_0981119 | Ga0501035_0981119_163_543 | 123 |
| 139 | 3300049824 | Ga0501045_0310902 | Ga0501045_0310902_583_963 | 123 |
| 140 | 3300054114 | Ga0501084_0227232 | Ga0501084_0227232_54_434 | 123 |
| 141 | 3300060353 | Ga0501082_0181109 | Ga0501082_0181109_287_667 | 123 |
| 142 | 3300061734 | Ga0530510_0190192 | Ga0530510_0190192_790_1170 | 123 |
| 143 | 3300061734 | Ga0530510_1432266 | Ga0530510_1432266_140_520 | 123 |
| 144 | 3300005329 | Ga0070683_100069655 | Ga0070683_1000696553 | 124 |
| 145 | 3300005434 | Ga0070709_10026166 | Ga0070709_100261662 | 124 |
| 146 | 3300005436 | Ga0070713_100518109 | Ga0070713_1005181092 | 124 |
| 147 | 3300005445 | Ga0070708_100565300 | Ga0070708_1005653002 | 124 |
| 148 | 3300005614 | Ga0068856_101381080 | Ga0068856_1013810801 | 124 |
| 149 | 3300024225 | Ga0224572_1067400 | Ga0224572_10674002 | 124 |
| 150 | 3300025915 | Ga0207693_10530591 | Ga0207693_105305913 | 124 |
| 151 | 3300025928 | Ga0207700_10339277 | Ga0207700_103392772 | 124 |
| 152 | 3300026078 | Ga0207702_11396798 | Ga0207702_113967981 | 124 |
| 153 | 3300028800 | Ga0265338_10243249 | Ga0265338_102432492 | 124 |
| 154 | 3300031616 | Ga0307508_10483885 | Ga0307508_104838852 | 124 |
| 155 | 3300035116 | Ga0373945_0000090 | Ga0373945_0000090_1928_2305 | 124 |
| 156 | 3300035410 | Ga0373924_0004118 | Ga0373924_0004118_3165_3542 | 124 |
| 157 | 3300037853 | Ga0436364_1208739 | Ga0436364_1208739_1497_1874 | 124 |
| 158 | 3300044842 | Ga0466957_1397107 | Ga0466957_1397107_100_477 | 124 |
| 159 | 3300046531 | Ga0495665_0016505 | Ga0495665_0016505_601_978 | 124 |
| 160 | 3300048089 | Ga0495614_0246811 | Ga0495614_0246811_291_668 | 124 |
| 161 | 3300005327 | Ga0070658_10992104 | Ga0070658_109921042 | 126 |
| 162 | 3300005329 | Ga0070683_100289002 | Ga0070683_1002890022 | 126 |
| 163 | 3300005341 | Ga0070691_10300605 | Ga0070691_103006052 | 126 |
| 164 | 3300005435 | Ga0070714_100775421 | Ga0070714_1007754212 | 126 |
| 165 | 3300005435 | Ga0070714_101356679 | Ga0070714_1013566792 | 126 |
| 166 | 3300005436 | Ga0070713_100557147 | Ga0070713_1005571471 | 126 |
| 167 | 3300005467 | Ga0070706_100117398 | Ga0070706_1001173981 | 126 |
| 168 | 3300005545 | Ga0070695_100077632 | Ga0070695_1000776323 | 126 |
| 169 | 3300005578 | Ga0068854_100023654 | Ga0068854_1000236547 | 126 |
| 170 | 3300005616 | Ga0068852_101565415 | Ga0068852_1015654152 | 126 |
| 171 | 3300006028 | Ga0070717_10174669 | Ga0070717_101746693 | 126 |
| 172 | 3300006173 | Ga0070716_100488319 | Ga0070716_1004883191 | 126 |
| 173 | 3300006175 | Ga0070712_100446067 | Ga0070712_1004460672 | 126 |
| 174 | 3300006871 | Ga0075434_101031916 | Ga0075434_1010319162 | 126 |
| 175 | 3300006881 | Ga0068865_100251231 | Ga0068865_1002512312 | 126 |
| 176 | 3300009545 | Ga0105237_10829203 | Ga0105237_108292032 | 126 |
| 177 | 3300009553 | Ga0105249_10778236 | Ga0105249_107782361 | 126 |
| 178 | 3300009988 | Ga0105035_101510 | Ga0105035_1015103 | 126 |
| 179 | 3300009993 | Ga0105028_101630 | Ga0105028_1016303 | 126 |
| 180 | 3300013296 | Ga0157374_11095398 | Ga0157374_110953982 | 126 |
| 181 | 3300013308 | Ga0157375_12413045 | Ga0157375_124130451 | 126 |
| 182 | 3300014968 | Ga0157379_11905932 | Ga0157379_119059321 | 126 |
| 183 | 3300025915 | Ga0207693_10635612 | Ga0207693_106356122 | 126 |
| 184 | 3300025935 | Ga0207709_11055940 | Ga0207709_110559401 | 126 |
| 185 | 3300025937 | Ga0207669_10831268 | Ga0207669_108312682 | 126 |
| 186 | 3300025938 | Ga0207704_10064201 | Ga0207704_100642013 | 126 |
| 187 | 3300025939 | Ga0207665_10287060 | Ga0207665_102870601 | 126 |
| 188 | 3300025944 | Ga0207661_10586098 | Ga0207661_105860983 | 126 |
| 189 | 3300025981 | Ga0207640_10253881 | Ga0207640_102538813 | 126 |
| 190 | 3300031090 | Ga0265760_10059696 | Ga0265760_100596962 | 126 |
| 191 | 3300035083 | Ga0373926_0014148 | Ga0373926_0014148_496_879 | 126 |
| 192 | 3300035117 | Ga0373953_0372114 | Ga0373953_0372114_222_605 | 126 |
| 193 | 3300035118 | Ga0373954_0306513 | Ga0373954_0306513_90_473 | 126 |
| 194 | 3300035119 | Ga0373956_0241814 | Ga0373956_0241814_81_464 | 126 |
| 195 | 3300035120 | Ga0373957_0368638 | Ga0373957_0368638_57_440 | 126 |
| 196 | 3300035692 | Ga0373935_0406749 | Ga0373935_0406749_478_861 | 126 |
| 197 | 3300035692 | Ga0373935_0470641 | Ga0373935_0470641_167_550 | 126 |
| 198 | 3300035724 | Ga0373933_0565057 | Ga0373933_0565057_122_505 | 126 |
| 199 | 3300037068 | Ga0373925_0950822 | Ga0373925_0950822_287_670 | 126 |
| 200 | 3300037853 | Ga0436364_0423175 | Ga0436364_0423175_286_669 | 126 |
| 201 | 3300037853 | Ga0436364_1386613 | Ga0436364_1386613_435_818 | 126 |
| 202 | 3300039453 | Ga0436362_0345175 | Ga0436362_0345175_351_734 | 126 |
| 203 | 3300044656 | Ga0466969_0011555 | Ga0466969_0011555_4207_4590 | 126 |
| 204 | 3300046459 | Ga0495629_0708003 | Ga0495629_0708003_196_579 | 126 |
| 205 | 3300046462 | Ga0495651_0274648 | Ga0495651_0274648_477_860 | 126 |
| 206 | 3300046529 | Ga0495652_0270253 | Ga0495652_0270253_765_1148 | 126 |
| 207 | 3300046533 | Ga0495640_0103114 | Ga0495640_0103114_470_853 | 126 |
| 208 | 3300046533 | Ga0495640_0268919 | Ga0495640_0268919_666_1049 | 126 |
| 209 | 3300046642 | Ga0495634_0582413 | Ga0495634_0582413_186_569 | 126 |
| 210 | 3300046642 | Ga0495634_0649016 | Ga0495634_0649016_12_395 | 126 |
| 211 | 3300046663 | Ga0495635_0160584 | Ga0495635_0160584_445_828 | 126 |
| 212 | 3300046663 | Ga0495635_0883074 | Ga0495635_0883074_102_485 | 126 |
| 213 | 3300046683 | Ga0495658_0294554 | Ga0495658_0294554_43_426 | 126 |
| 214 | 3300046689 | Ga0495613_0289603 | Ga0495613_0289603_107_490 | 126 |
| 215 | 3300046690 | Ga0495624_0265827 | Ga0495624_0265827_100_483 | 126 |
| 216 | 3300046809 | Ga0495600_0093062 | Ga0495600_0093062_970_1353 | 126 |
| 217 | 3300047319 | Ga0495674_0205340 | Ga0495674_0205340_458_841 | 126 |
| 218 | 3300047322 | Ga0495680_0049794 | Ga0495680_0049794_1773_2156 | 126 |
| 219 | 3300047471 | Ga0495684_0034632 | Ga0495684_0034632_1063_1446 | 126 |
| 220 | 3300047673 | Ga0495593_0435539 | Ga0495593_0435539_230_613 | 126 |
| 221 | 3300048917 | Ga0496114_0608000 | Ga0496114_0608000_365_748 | 126 |
| 222 | 3300048918 | Ga0496115_0808024 | Ga0496115_0808024_142_525 | 126 |
| 223 | 3300053077 | Ga0495601_0969002 | Ga0495601_0969002_101_484 | 126 |
| 224 | 3300005328 | Ga0070676_10671226 | Ga0070676_106712262 | 127 |
| 225 | 3300005329 | Ga0070683_100769462 | Ga0070683_1007694622 | 127 |
| 226 | 3300005334 | Ga0068869_100584529 | Ga0068869_1005845292 | 127 |
| 227 | 3300005337 | Ga0070682_100563429 | Ga0070682_1005634292 | 127 |
| 228 | 3300005344 | Ga0070661_100451811 | Ga0070661_1004518113 | 127 |
| 229 | 3300005367 | Ga0070667_101593932 | Ga0070667_1015939322 | 127 |
| 230 | 3300005455 | Ga0070663_100186143 | Ga0070663_1001861433 | 127 |
| 231 | 3300005456 | Ga0070678_100137321 | Ga0070678_1001373212 | 127 |
| 232 | 3300005535 | Ga0070684_100589056 | Ga0070684_1005890562 | 127 |
| 233 | 3300005548 | Ga0070665_100376640 | Ga0070665_1003766403 | 127 |
| 234 | 3300005564 | Ga0070664_100143718 | Ga0070664_1001437182 | 127 |
| 235 | 3300005577 | Ga0068857_100150033 | Ga0068857_1001500333 | 127 |
| 236 | 3300005614 | Ga0068856_101192931 | Ga0068856_1011929312 | 127 |
| 237 | 3300005617 | Ga0068859_100661295 | Ga0068859_1006612952 | 127 |
| 238 | 3300005618 | Ga0068864_100520555 | Ga0068864_1005205552 | 127 |
| 239 | 3300005840 | Ga0068870_10122926 | Ga0068870_101229263 | 127 |
| 240 | 3300005841 | Ga0068863_100423465 | Ga0068863_1004234653 | 127 |
| 241 | 3300005842 | Ga0068858_100747934 | Ga0068858_1007479341 | 127 |
| 242 | 3300006931 | Ga0097620_100661263 | Ga0097620_1006612632 | 127 |
| 243 | 3300009101 | Ga0105247_10392799 | Ga0105247_103927992 | 127 |
| 244 | 3300009177 | Ga0105248_11250579 | Ga0105248_112505792 | 127 |
| 245 | 3300011119 | Ga0105246_10287112 | Ga0105246_102871122 | 127 |
| 246 | 3300013105 | Ga0157369_10240502 | Ga0157369_102405023 | 127 |
| 247 | 3300013308 | Ga0157375_10609650 | Ga0157375_106096502 | 127 |
| 248 | 3300014325 | Ga0163163_10190145 | Ga0163163_101901453 | 127 |
| 249 | 3300014745 | Ga0157377_10191024 | Ga0157377_101910243 | 127 |
| 250 | 3300014968 | Ga0157379_10271421 | Ga0157379_102714213 | 127 |
| 251 | 3300014969 | Ga0157376_10737514 | Ga0157376_107375141 | 127 |
| 252 | 3300025908 | Ga0207643_10045577 | Ga0207643_100455772 | 127 |
| 253 | 3300025909 | Ga0207705_10667629 | Ga0207705_106676292 | 127 |
| 254 | 3300025920 | Ga0207649_10517768 | Ga0207649_105177683 | 127 |
| 255 | 3300025925 | Ga0207650_11703355 | Ga0207650_117033551 | 127 |
| 256 | 3300025926 | Ga0207659_10331176 | Ga0207659_103311762 | 127 |
| 257 | 3300025945 | Ga0207679_10541615 | Ga0207679_105416153 | 127 |
| 258 | 3300026023 | Ga0207677_11693383 | Ga0207677_116933831 | 127 |
| 259 | 3300026035 | Ga0207703_10447799 | Ga0207703_104477992 | 127 |
| 260 | 3300026067 | Ga0207678_10031327 | Ga0207678_100313273 | 127 |
| 261 | 3300026078 | Ga0207702_10486030 | Ga0207702_104860303 | 127 |
| 262 | 3300026095 | Ga0207676_10158995 | Ga0207676_101589952 | 127 |
| 263 | 3300026116 | Ga0207674_10254090 | Ga0207674_102540903 | 127 |
| 264 | 3300026121 | Ga0207683_10278097 | Ga0207683_102780973 | 127 |
| 265 | 3300028379 | Ga0268266_10246922 | Ga0268266_102469222 | 127 |
| 266 | 3300048907 | Ga0496104_0475729 | Ga0496104_0475729_411_797 | 127 |
| 267 | 3300048911 | Ga0496108_0328526 | Ga0496108_0328526_815_1201 | 127 |
| 268 | 3300048912 | Ga0496109_0454084 | Ga0496109_0454084_389_775 | 127 |
| 269 | 3300048914 | Ga0496111_0780451 | Ga0496111_0780451_44_430 | 127 |
| 270 | 3300048915 | Ga0496112_0301770 | Ga0496112_0301770_976_1362 | 127 |
| 271 | 3300048916 | Ga0496113_1222669 | Ga0496113_1222669_10_396 | 127 |
| 272 | 3300021388 | Ga0213875_10000309 | Ga0213875_1000030915 | 129 |
| 273 | 3300049569 | Ga0501032_0003015 | Ga0501032_0003015_4539_4931 | 129 |
| 274 | 3300049571 | Ga0501034_0013497 | Ga0501034_0013497_342_734 | 129 |
| 275 | 3300049572 | Ga0501036_0023592 | Ga0501036_0023592_4356_4748 | 129 |
| 276 | 3300049574 | Ga0501038_0002270 | Ga0501038_0002270_3415_3807 | 129 |
| 277 | 3300049579 | Ga0501043_0031991 | Ga0501043_0031991_1512_1904 | 129 |
| 278 | 3300049580 | Ga0501046_0009396 | Ga0501046_0009396_735_1127 | 129 |
| 279 | 3300049581 | Ga0501047_0004211 | Ga0501047_0004211_9166_9558 | 129 |
| 280 | 3300049582 | Ga0501048_0000449 | Ga0501048_0000449_20226_20618 | 129 |
| 281 | 3300049586 | Ga0501070_0008071 | Ga0501070_0008071_4268_4660 | 129 |
| 282 | 3300049822 | Ga0501035_0008532 | Ga0501035_0008532_2716_3108 | 129 |
| 283 | 3300049823 | Ga0501044_0021427 | Ga0501044_0021427_1261_1653 | 129 |
| 284 | 3300060353 | Ga0501082_0842605 | Ga0501082_0842605_182_574 | 129 |
| 285 | 3300044765 | Ga0466970_0005447 | Ga0466970_0005447_4073_4468 | 130 |
| 286 | 3300003792 | Ga0055540_1000029 | Ga0055540_100002959 | 131 |
| 287 | 3300021388 | Ga0213875_10253391 | Ga0213875_102533911 | 131 |
| 288 | 3300025303 | Ga0209051_1000042 | Ga0209051_1000042205 | 131 |
| 289 | 3300030521 | Ga0307511_10235102 | Ga0307511_102351022 | 131 |
| 290 | 3300037853 | Ga0436364_0156042 | Ga0436364_0156042_5407_5805 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7by2-assembly1.cif.gz_B-2 | toxin-antitoxin complex from klebsiella pneumoniae | 0.8612 | 1 | 126 |
| 7by2-assembly1.cif.gz_B-2 | toxin-antitoxin complex from klebsiella pneumoniae | 0.8546 | 1 | 126 |
| 5ed0-assembly2.cif.gz_B | structure of the shigella flexneri vapc mutant d7n | 0.8392 | 2 | 122 |
| 4chg-assembly3.cif.gz_E | crystal structure of vapbc15 complex from mycobacterium tuberculosis | 0.8377 | 1 | 124 |
| 5ecw-assembly1.cif.gz_A | structure of the shigella flexneri vapc mutant d7a | 0.8369 | 2 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFA7_1_124_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 1 | 1 | 124 | 3.40.50.1010 |
| af_P9WFA7_1_124_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9924 | 1 | 124 | 3.40.50.1010 |
| af_P9WF93_1_123_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9799 | 1 | 121 | 3.40.50.1010 |
| af_P9WF93_1_123_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9564 | 1 | 121 | 3.40.50.1010 |
| af_L0T5V6_2_136_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.875 | 2 | 112 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5ES54-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9968 | 1 | 126 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A654U895-F1-model_v4 | Toxin (EC 3.1.-.-) | 0.9961 | 37 | 126 |
GO:0004518
GO:0046872 |
| AF-A0A7I7MP51-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9908 | 1 | 130 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A6L5ES54-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.989 | 1 | 126 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A7K0JSH2-F1-model_v4 | deleted | 0.9878 | 1 | 124 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar