F390036

General Info

Members Datasets Scaffolds Average Seq Length
290 197 290 126

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0221820|Ga0501039_0221820_306_746
Length 146
Sequence MEPTIALSGQEIAIFRQEIEATVVSLLLDTNILIDYARGLPVAIAWLRSVPEPPYISIISLLELNVGARSQREERDIEAVCAKLRWLPITHEIAKHGGSFLRHFGKRHGIDIPDAIIAATAEHHGLRLATLNVKHFPMFPKLKRAY

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
60 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 2.76
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000029 3300003792 Bacteria 179894
2 Ga0070658_10992104 3300005327 Bacteria 730
3 Ga0070676_10671226 3300005328 Unclassified 754
4 Ga0070683_100069655 3300005329 Bacteria 3280
5 Ga0070683_100289002 3300005329 Bacteria 1559
6 Ga0070683_100769462 3300005329 Bacteria 922
7 Ga0068869_100584529 3300005334 Bacteria 942
8 Ga0070682_100563429 3300005337 Bacteria 894
9 Ga0070691_10300605 3300005341 Bacteria 877
10 Ga0070661_100335826 3300005344 Bacteria 1183
11 Ga0070661_100451811 3300005344 Bacteria 1022
12 Ga0070668_100567591 3300005347 Bacteria 989
13 Ga0070667_101593932 3300005367 Unclassified 614
14 Ga0070709_10026166 3300005434 Bacteria 3454
15 Ga0070714_100775421 3300005435 Unclassified 928
16 Ga0070714_101356679 3300005435 Unclassified 694
17 Ga0070713_100174726 3300005436 Bacteria 1927
18 Ga0070713_100518109 3300005436 Bacteria 1126
19 Ga0070713_100557147 3300005436 Bacteria 1086
20 Ga0070708_100565300 3300005445 Unclassified 1072
21 Ga0070708_101414508 3300005445 Unclassified 649
22 Ga0070663_100186143 3300005455 Bacteria 1613
23 Ga0070678_100137321 3300005456 Bacteria 1951
24 Ga0068867_100403701 3300005459 Bacteria 1153
25 Ga0070706_100117398 3300005467 Bacteria 2479
26 Ga0070679_101166369 3300005530 Bacteria 715
27 Ga0070679_101183193 3300005530 Bacteria 710
28 Ga0070684_100589056 3300005535 Bacteria 1034
29 Ga0070695_100077632 3300005545 Bacteria 2189
30 Ga0070665_100376640 3300005548 Bacteria 1426
31 Ga0070664_100143718 3300005564 Bacteria 2102
32 Ga0068857_100150033 3300005577 Bacteria 2111
33 Ga0068854_100023654 3300005578 Bacteria 4198
34 Ga0068856_101192931 3300005614 Bacteria 778
35 Ga0068856_101381080 3300005614 Bacteria 719
36 Ga0068852_101565415 3300005616 Bacteria 681
37 Ga0068859_100661295 3300005617 Bacteria 1136
38 Ga0068864_100520555 3300005618 Bacteria 1146
39 Ga0068861_100269166 3300005719 Bacteria 1462
40 Ga0068870_10122926 3300005840 Bacteria 1497
41 Ga0068863_100423465 3300005841 Bacteria 1304
42 Ga0068858_100747934 3300005842 Bacteria 952
43 Ga0068860_100324740 3300005843 Bacteria 1511
44 Ga0081538_10150710 3300005981 Bacteria 1053
45 Ga0070717_10174669 3300006028 Unclassified 1870
46 Ga0075365_10215506 3300006038 Bacteria 1346
47 Ga0075368_10064798 3300006042 Bacteria 1468
48 Ga0075363_100018577 3300006048 Bacteria 3467
49 Ga0075364_10001020 3300006051 Bacteria 14868
50 Ga0070716_100488319 3300006173 Bacteria 906
51 Ga0070712_100446067 3300006175 Unclassified 1077
52 Ga0075362_10476284 3300006177 Bacteria 636
53 Ga0075367_10009075 3300006178 Bacteria 5180
54 Ga0075428_100202369 3300006844 Bacteria 2146
55 Ga0075428_100408720 3300006844 Bacteria 1454
56 Ga0075428_100853964 3300006844 Bacteria 966
57 Ga0075428_101142644 3300006844 Unclassified 822
58 Ga0075430_100029193 3300006846 Bacteria 4681
59 Ga0075430_100611844 3300006846 Bacteria 899
60 Ga0075431_100045202 3300006847 Bacteria 4540
61 Ga0075431_100324661 3300006847 Bacteria 1551
62 Ga0075431_100606369 3300006847 Unclassified 1078
63 Ga0075431_101014579 3300006847 Unclassified 796
64 Ga0075434_101031916 3300006871 Bacteria 836
65 Ga0075429_100153092 3300006880 Bacteria 2019
66 Ga0075429_100411367 3300006880 Bacteria 1185
67 Ga0075429_100964482 3300006880 Bacteria 746
68 Ga0068865_100251231 3300006881 Bacteria 1396
69 Ga0097620_100661263 3300006931 Bacteria 1136
70 Ga0105240_10708467 3300009093 Bacteria 1098
71 Ga0111539_10033237 3300009094 Bacteria 6263
72 Ga0111539_10216168 3300009094 Bacteria 2233
73 Ga0111539_10593028 3300009094 Bacteria 1290
74 Ga0105247_10392799 3300009101 Bacteria 986
75 Ga0114129_10028830 3300009147 Bacteria 7865
76 Ga0114129_10106747 3300009147 Bacteria 3868
77 Ga0114129_10342422 3300009147 Bacteria 1983
78 Ga0114129_10777582 3300009147 Bacteria 1223
79 Ga0114129_11699738 3300009147 Unclassified 770
80 Ga0105248_11250579 3300009177 Bacteria 839
81 Ga0105237_10829203 3300009545 Unclassified 932
82 Ga0105249_10778236 3300009553 Archaea 1020
83 Ga0105035_101510 3300009988 Bacteria 1620
84 Ga0105028_101630 3300009993 Bacteria 2347
85 Ga0105246_10287112 3300011119 Bacteria 1322
86 Ga0157369_10240502 3300013105 Bacteria 1891
87 Ga0157374_11095398 3300013296 Bacteria 817
88 Ga0157375_10445058 3300013308 Bacteria 1461
89 Ga0157375_10609650 3300013308 Bacteria 1250
90 Ga0157375_12413045 3300013308 Bacteria 628
91 Ga0163163_10190145 3300014325 Bacteria 2101
92 Ga0157380_10978195 3300014326 Bacteria 878
93 Ga0157377_10191024 3300014745 Bacteria 1294
94 Ga0157379_10271421 3300014968 Bacteria 1542
95 Ga0157379_11905932 3300014968 Bacteria 586
96 Ga0157376_10737514 3300014969 Bacteria 993
97 Ga0163161_10657426 3300017792 Bacteria 869
98 Ga0213872_10289373 3300021361 Bacteria 682
99 Ga0213875_10000309 3300021388 Bacteria 46706
100 Ga0213875_10253391 3300021388 Bacteria 830
101 Ga0224572_1067400 3300024225 Bacteria 662
102 Ga0209051_1000042 3300025303 Bacteria 308486
103 Ga0207653_10021028 3300025885 Bacteria 2068
104 Ga0207643_10045577 3300025908 Bacteria 2477
105 Ga0207705_10667629 3300025909 Unclassified 808
106 Ga0207693_10530591 3300025915 Bacteria 918
107 Ga0207693_10635612 3300025915 Bacteria 830
108 Ga0207649_10517768 3300025920 Bacteria 909
109 Ga0207650_11703355 3300025925 Unclassified 534
110 Ga0207659_10331176 3300025926 Bacteria 1259
111 Ga0207700_10181940 3300025928 Bacteria 1761
112 Ga0207700_10339277 3300025928 Bacteria 1306
113 Ga0207709_11055940 3300025935 Unclassified 666
114 Ga0207669_10831268 3300025937 Unclassified 768
115 Ga0207704_10064201 3300025938 Bacteria 2293
116 Ga0207665_10287060 3300025939 Bacteria 1226
117 Ga0207661_10586098 3300025944 Bacteria 1023
118 Ga0207679_10541615 3300025945 Bacteria 1043
119 Ga0207640_10253881 3300025981 Bacteria 1366
120 Ga0207677_11693383 3300026023 Unclassified 586
121 Ga0207703_10447799 3300026035 Bacteria 1206
122 Ga0207678_10031327 3300026067 Bacteria 4639
123 Ga0207708_10361414 3300026075 Bacteria 1193
124 Ga0207702_10486030 3300026078 Bacteria 1202
125 Ga0207702_11396798 3300026078 Bacteria 694
126 Ga0207648_10790582 3300026089 Bacteria 883
127 Ga0207676_10158995 3300026095 Bacteria 1955
128 Ga0207674_10254090 3300026116 Bacteria 1704
129 Ga0207675_100421980 3300026118 Bacteria 1317
130 Ga0207675_102015198 3300026118 Bacteria 595
131 Ga0207683_10278097 3300026121 Bacteria 1530
132 Ga0209813_10003459 3300027866 Bacteria 3699
133 Ga0207428_10002566 3300027907 Bacteria 18152
134 Ga0207428_10378293 3300027907 Bacteria 1039
135 Ga0268266_10246922 3300028379 Bacteria 1649
136 Ga0268266_11833791 3300028379 Bacteria 581
137 Ga0265338_10243249 3300028800 Unclassified 1331
138 Ga0307511_10235102 3300030521 Bacteria 901
139 Ga0265760_10059696 3300031090 Bacteria 1157
140 Ga0307508_10483885 3300031616 Unclassified 832
141 Ga0373926_0014148 3300035083 Bacteria 2709
142 Ga0373945_0000090 3300035116 Bacteria 21258
143 Ga0373953_0372114 3300035117 Bacteria 627
144 Ga0373954_0306513 3300035118 Archaea 783
145 Ga0373956_0241814 3300035119 Unclassified 858
146 Ga0373957_0368638 3300035120 Bacteria 615
147 Ga0373924_0004118 3300035410 Bacteria 5060
148 Ga0373935_0406749 3300035692 Bacteria 978
149 Ga0373935_0470641 3300035692 Bacteria 909
150 Ga0373933_0565057 3300035724 Archaea 746
151 Ga0373925_0950822 3300037068 Bacteria 708
152 Ga0395905_0198957 3300037471 Bacteria 1879
153 Ga0436364_0156042 3300037853 Bacteria 23649
154 Ga0436364_0423175 3300037853 Archaea 738
155 Ga0436364_1208739 3300037853 Unclassified 1949
156 Ga0436364_1386613 3300037853 Unclassified 1559
157 Ga0436360_0285176 3300039438 Bacteria 826
158 Ga0436360_0841721 3300039438 Unclassified 1005
159 Ga0436361_0900277 3300039447 Archaea 1157
160 Ga0436362_0345175 3300039453 Bacteria 1520
161 Ga0439440_0062541 3300042993 Bacteria 953
162 Ga0466969_0011555 3300044656 Bacteria 4674
163 Ga0453684_0063529 3300044712 Bacteria 4722
164 Ga0466970_0005447 3300044765 Bacteria 6315
165 Ga0466957_1397107 3300044842 Unclassified 509
166 Ga0495629_0708003 3300046459 Unclassified 668
167 Ga0495651_0274648 3300046462 Bacteria 1141
168 Ga0495608_0111454 3300046511 Unclassified 1759
169 Ga0495652_0270253 3300046529 Bacteria 1250
170 Ga0495665_0016505 3300046531 Bacteria 3978
171 Ga0495640_0103114 3300046533 Bacteria 1871
172 Ga0495640_0268919 3300046533 Archaea 1063
173 Ga0495668_0130036 3300046616 Bacteria 1378
174 Ga0495634_0582413 3300046642 Unclassified 650
175 Ga0495634_0649016 3300046642 Archaea 610
176 Ga0495625_0200855 3300046660 Bacteria 1316
177 Ga0495635_0160584 3300046663 Bacteria 1529
178 Ga0495635_0883074 3300046663 Archaea 573
179 Ga0495658_0294554 3300046683 Bacteria 1026
180 Ga0495613_0289603 3300046689 Unclassified 1136
181 Ga0495624_0265827 3300046690 Bacteria 1036
182 Ga0495600_0093062 3300046809 Bacteria 1966
183 Ga0495674_0205340 3300047319 Bacteria 1633
184 Ga0495680_0049794 3300047322 Bacteria 3279
185 Ga0495684_0034632 3300047471 Bacteria 3874
186 Ga0495593_0435539 3300047673 Unclassified 656
187 Ga0495614_0246811 3300048089 Bacteria 816
188 Ga0496104_0475729 3300048907 Bacteria 1161
189 Ga0496108_0328526 3300048911 Bacteria 1333
190 Ga0496109_0454084 3300048912 Bacteria 1210
191 Ga0496111_0780451 3300048914 Bacteria 692
192 Ga0496112_0301770 3300048915 Bacteria 1547
193 Ga0496113_1222669 3300048916 Bacteria 586
194 Ga0496114_0608000 3300048917 Bacteria 964
195 Ga0496115_0808024 3300048918 Bacteria 729
196 Ga0501031_0035599 3300049568 Bacteria 3248
197 Ga0501031_0154652 3300049568 Bacteria 1499
198 Ga0501031_0441002 3300049568 Unclassified 841
199 Ga0501032_0003015 3300049569 Bacteria 13063
200 Ga0501034_0013497 3300049571 Bacteria 8410
201 Ga0501034_0062658 3300049571 Bacteria 3734
202 Ga0501034_0066397 3300049571 Bacteria 3620
203 Ga0501036_0023592 3300049572 Bacteria 5184
204 Ga0501038_0002270 3300049574 Bacteria 17874
205 Ga0501038_1169691 3300049574 Unclassified 559
206 Ga0501039_0221820 3300049575 Unclassified 1486
207 Ga0501039_0378692 3300049575 Bacteria 1112
208 Ga0501039_0426311 3300049575 Unclassified 1042
209 Ga0501039_0569329 3300049575 Unclassified 889
210 Ga0501040_0354129 3300049576 Bacteria 1052
211 Ga0501040_0834598 3300049576 Bacteria 667
212 Ga0501040_0954454 3300049576 Unclassified 621
213 Ga0501041_0409065 3300049577 Bacteria 860
214 Ga0501042_0232119 3300049578 Bacteria 1331
215 Ga0501042_0407151 3300049578 Unclassified 986
216 Ga0501043_0031991 3300049579 Bacteria 4135
217 Ga0501043_0234168 3300049579 Bacteria 1418
218 Ga0501046_0009396 3300049580 Bacteria 8452
219 Ga0501046_0054789 3300049580 Bacteria 3136
220 Ga0501046_0813578 3300049580 Unclassified 654
221 Ga0501047_0004211 3300049581 Bacteria 13548
222 Ga0501047_0088849 3300049581 Bacteria 2967
223 Ga0501048_0000449 3300049582 Bacteria 28924
224 Ga0501069_0945375 3300049585 Unclassified 525
225 Ga0501070_0008071 3300049586 Bacteria 8910
226 Ga0501070_0264882 3300049586 Bacteria 1404
227 Ga0501070_0596684 3300049586 Bacteria 881
228 Ga0501071_0084444 3300049587 Bacteria 2327
229 Ga0501072_0042220 3300049588 Bacteria 3583
230 Ga0501072_0446200 3300049588 Unclassified 1025
231 Ga0501072_0929875 3300049588 Bacteria 679
232 Ga0501072_1006688 3300049588 Unclassified 649
233 Ga0501074_0079445 3300049590 Unclassified 2354
234 Ga0501074_1203455 3300049590 Bacteria 531
235 Ga0501075_0402555 3300049591 Bacteria 1043
236 Ga0501076_0095619 3300049592 Unclassified 2393
237 Ga0501076_0374332 3300049592 Unclassified 1170
238 Ga0501076_0589737 3300049592 Bacteria 917
239 Ga0501077_1088198 3300049593 Unclassified 514
240 Ga0501079_0046857 3300049741 Bacteria 3336
241 Ga0501079_0286377 3300049741 Bacteria 1288
242 Ga0501079_0433295 3300049741 Bacteria 1032
243 Ga0501081_0378977 3300049743 Bacteria 1045
244 Ga0501081_0461772 3300049743 Bacteria 944
245 Ga0501081_0556481 3300049743 Bacteria 857
246 Ga0501035_0008532 3300049822 Bacteria 9541
247 Ga0501035_0981119 3300049822 Unclassified 665
248 Ga0501044_0021427 3300049823 Bacteria 6894
249 Ga0501045_0306331 3300049824 Bacteria 1182
250 Ga0501045_0310902 3300049824 Bacteria 1173
251 Ga0501045_0575165 3300049824 Unclassified 835
252 nmdc:mga03683_585518_c1 3300050489 Unclassified 545
253 nmdc:mga03n38_459_c1 3300050490 Bacteria 10198
254 nmdc:mga00v17_32307_c1 3300050491 Bacteria 3093
255 nmdc:mga0yw44_1138781_c1 3300050492 Unclassified 527
256 nmdc:mga0yw44_71525_c1 3300050492 Bacteria 2154
257 nmdc:mga06z11_377_c1 3300050494 Bacteria 16781
258 nmdc:mga04h51_9385_c1 3300050495 Bacteria 2651
259 nmdc:mga05p37_1369580_c1 3300050507 Bacteria 715
260 nmdc:mga05p37_8195_c1 3300050507 Bacteria 12353
261 nmdc:mga09592_1552063_c1 3300050508 Bacteria 537
262 nmdc:mga09592_47574_c1 3300050508 Bacteria 3615
263 nmdc:mga09592_563652_c1 3300050508 Bacteria 978
264 nmdc:mga09592_872338_c1 3300050508 Bacteria 758
265 nmdc:mga0qj67_1117158_c1 3300050509 Bacteria 615
266 nmdc:mga0qj67_242961_c1 3300050509 Bacteria 1461
267 nmdc:mga0qj67_974842_c1 3300050509 Bacteria 666
268 nmdc:mga06r32_1360079_c1 3300050510 Bacteria 653
269 nmdc:mga06r32_22003_c1 3300050510 Bacteria 5889
270 nmdc:mga06r32_612821_c1 3300050510 Unclassified 1059
271 nmdc:mga06r32_7638_c1 3300050510 Bacteria 9724
272 nmdc:mga08y16_170624_c1 3300050511 Bacteria 2260
273 nmdc:mga08y16_24119_c1 3300050511 Bacteria 6423
274 nmdc:mga08y16_649098_c1 3300050511 Bacteria 1060
275 nmdc:mga0a205_183658_c1 3300050515 Bacteria 1985
276 Ga0495601_0969002 3300053077 Bacteria 536
277 Ga0500616_0324326 3300053153 Bacteria 633
278 Ga0500611_103855 3300053727 Bacteria 739
279 Ga0501084_0192588 3300054114 Bacteria 1720
280 Ga0501084_0227232 3300054114 Bacteria 1575
281 Ga0501084_0641884 3300054114 Unclassified 896
282 Ga0501082_0181109 3300060353 Unclassified 1833
283 Ga0501082_0309808 3300060353 Bacteria 1375
284 Ga0501082_0338562 3300060353 Unclassified 1311
285 Ga0501082_0842605 3300060353 Bacteria 802
286 Ga0530510_0027581 3300061734 Bacteria 4069
287 Ga0530510_0190192 3300061734 Unclassified 1524
288 Ga0530510_0681309 3300061734 Archaea 783
289 Ga0530510_1432266 3300061734 Unclassified 530
290 Ga0530510_1509778 3300061734 Unclassified 516

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025885 Ga0207653_10021028 Ga0207653_100210281 103
2 3300005344 Ga0070661_100335826 Ga0070661_1003358262 117
3 3300005530 Ga0070679_101183193 Ga0070679_1011831932 117
4 3300013308 Ga0157375_10445058 Ga0157375_104450583 117
5 3300017792 Ga0163161_10657426 Ga0163161_106574261 117
6 3300009094 Ga0111539_10216168 Ga0111539_102161682 118
7 3300050511 nmdc:mga08y16_170624_c1 nmdc:mga08y16_170624_c1_537_899 118
8 3300005347 Ga0070668_100567591 Ga0070668_1005675912 119
9 3300005459 Ga0068867_100403701 Ga0068867_1004037012 119
10 3300005530 Ga0070679_101166369 Ga0070679_1011663691 119
11 3300005719 Ga0068861_100269166 Ga0068861_1002691661 119
12 3300014326 Ga0157380_10978195 Ga0157380_109781952 119
13 3300026089 Ga0207648_10790582 Ga0207648_107905822 119
14 3300026118 Ga0207675_100421980 Ga0207675_1004219803 119
15 3300046660 Ga0495625_0200855 Ga0495625_0200855_631_996 119
16 3300049586 Ga0501070_0264882 Ga0501070_0264882_812_1177 119
17 3300005843 Ga0068860_100324740 Ga0068860_1003247403 120
18 3300006038 Ga0075365_10215506 Ga0075365_102155063 120
19 3300006042 Ga0075368_10064798 Ga0075368_100647983 120
20 3300006048 Ga0075363_100018577 Ga0075363_1000185775 120
21 3300006051 Ga0075364_10001020 Ga0075364_100010208 120
22 3300006177 Ga0075362_10476284 Ga0075362_104762842 120
23 3300006178 Ga0075367_10009075 Ga0075367_100090754 120
24 3300006844 Ga0075428_100202369 Ga0075428_1002023695 120
25 3300006844 Ga0075428_100408720 Ga0075428_1004087203 120
26 3300006844 Ga0075428_100853964 Ga0075428_1008539642 120
27 3300006844 Ga0075428_101142644 Ga0075428_1011426442 120
28 3300006846 Ga0075430_100029193 Ga0075430_1000291932 120
29 3300006846 Ga0075430_100611844 Ga0075430_1006118442 120
30 3300006847 Ga0075431_100045202 Ga0075431_1000452024 120
31 3300006847 Ga0075431_100324661 Ga0075431_1003246613 120
32 3300006847 Ga0075431_100606369 Ga0075431_1006063692 120
33 3300006847 Ga0075431_101014579 Ga0075431_1010145792 120
34 3300006880 Ga0075429_100153092 Ga0075429_1001530924 120
35 3300006880 Ga0075429_100411367 Ga0075429_1004113672 120
36 3300006880 Ga0075429_100964482 Ga0075429_1009644822 120
37 3300009094 Ga0111539_10033237 Ga0111539_100332375 120
38 3300009094 Ga0111539_10593028 Ga0111539_105930283 120
39 3300009147 Ga0114129_10028830 Ga0114129_100288305 120
40 3300009147 Ga0114129_10106747 Ga0114129_101067477 120
41 3300009147 Ga0114129_10342422 Ga0114129_103424222 120
42 3300009147 Ga0114129_10777582 Ga0114129_107775823 120
43 3300009147 Ga0114129_11699738 Ga0114129_116997381 120
44 3300026075 Ga0207708_10361414 Ga0207708_103614141 120
45 3300026118 Ga0207675_102015198 Ga0207675_1020151981 120
46 3300027866 Ga0209813_10003459 Ga0209813_100034594 120
47 3300027907 Ga0207428_10002566 Ga0207428_100025668 120
48 3300027907 Ga0207428_10378293 Ga0207428_103782931 120
49 3300028379 Ga0268266_11833791 Ga0268266_118337912 120
50 3300046616 Ga0495668_0130036 Ga0495668_0130036_271_642 120
51 3300049574 Ga0501038_1169691 Ga0501038_1169691_140_508 120
52 3300049575 Ga0501039_0221820 Ga0501039_0221820_306_746 120
53 3300049575 Ga0501039_0378692 Ga0501039_0378692_72_446 120
54 3300049576 Ga0501040_0954454 Ga0501040_0954454_142_582 120
55 3300049577 Ga0501041_0409065 Ga0501041_0409065_260_700 120
56 3300049588 Ga0501072_0042220 Ga0501072_0042220_3098_3538 120
57 3300049592 Ga0501076_0589737 Ga0501076_0589737_270_641 120
58 3300049741 Ga0501079_0046857 Ga0501079_0046857_1909_2280 120
59 3300049824 Ga0501045_0306331 Ga0501045_0306331_65_436 120
60 3300049824 Ga0501045_0575165 Ga0501045_0575165_111_479 120
61 3300050489 nmdc:mga03683_585518_c1 nmdc:mga03683_585518_c1_47_418 120
62 3300050490 nmdc:mga03n38_459_c1 nmdc:mga03n38_459_c1_4029_4400 120
63 3300050491 nmdc:mga00v17_32307_c1 nmdc:mga00v17_32307_c1_1987_2358 120
64 3300050492 nmdc:mga0yw44_1138781_c1 nmdc:mga0yw44_1138781_c1_116_496 120
65 3300050492 nmdc:mga0yw44_71525_c1 nmdc:mga0yw44_71525_c1_931_1302 120
66 3300050494 nmdc:mga06z11_377_c1 nmdc:mga06z11_377_c1_10589_10960 120
67 3300050495 nmdc:mga04h51_9385_c1 nmdc:mga04h51_9385_c1_1365_1736 120
68 3300050507 nmdc:mga05p37_1369580_c1 nmdc:mga05p37_1369580_c1_248_619 120
69 3300050507 nmdc:mga05p37_8195_c1 nmdc:mga05p37_8195_c1_11105_11476 120
70 3300050508 nmdc:mga09592_1552063_c1 nmdc:mga09592_1552063_c1_61_429 120
71 3300050508 nmdc:mga09592_47574_c1 nmdc:mga09592_47574_c1_443_811 120
72 3300050508 nmdc:mga09592_563652_c1 nmdc:mga09592_563652_c1_350_718 120
73 3300050508 nmdc:mga09592_872338_c1 nmdc:mga09592_872338_c1_301_672 120
74 3300050509 nmdc:mga0qj67_1117158_c1 nmdc:mga0qj67_1117158_c1_101_472 120
75 3300050509 nmdc:mga0qj67_242961_c1 nmdc:mga0qj67_242961_c1_129_497 120
76 3300050509 nmdc:mga0qj67_974842_c1 nmdc:mga0qj67_974842_c1_15_386 120
77 3300050510 nmdc:mga06r32_1360079_c1 nmdc:mga06r32_1360079_c1_133_504 120
78 3300050510 nmdc:mga06r32_22003_c1 nmdc:mga06r32_22003_c1_4999_5367 120
79 3300050510 nmdc:mga06r32_612821_c1 nmdc:mga06r32_612821_c1_601_969 120
80 3300050510 nmdc:mga06r32_7638_c1 nmdc:mga06r32_7638_c1_5377_5748 120
81 3300050511 nmdc:mga08y16_24119_c1 nmdc:mga08y16_24119_c1_1882_2253 120
82 3300050511 nmdc:mga08y16_649098_c1 nmdc:mga08y16_649098_c1_41_412 120
83 3300050515 nmdc:mga0a205_183658_c1 nmdc:mga0a205_183658_c1_792_1163 120
84 3300053153 Ga0500616_0324326 Ga0500616_0324326_121_492 120
85 3300053727 Ga0500611_103855 Ga0500611_103855_316_687 120
86 3300054114 Ga0501084_0192588 Ga0501084_0192588_603_1043 120
87 3300060353 Ga0501082_0309808 Ga0501082_0309808_388_756 120
88 3300061734 Ga0530510_0027581 Ga0530510_0027581_1813_2184 120
89 3300061734 Ga0530510_0681309 Ga0530510_0681309_21_395 120
90 3300061734 Ga0530510_1509778 Ga0530510_1509778_101_469 120
91 3300009093 Ga0105240_10708467 Ga0105240_107084671 121
92 3300021361 Ga0213872_10289373 Ga0213872_102893732 121
93 3300039438 Ga0436360_0285176 Ga0436360_0285176_409_780 121
94 3300039438 Ga0436360_0841721 Ga0436360_0841721_125_496 121
95 3300039447 Ga0436361_0900277 Ga0436361_0900277_586_957 121
96 3300005436 Ga0070713_100174726 Ga0070713_1001747262 122
97 3300025928 Ga0207700_10181940 Ga0207700_101819402 122
98 3300044712 Ga0453684_0063529 Ga0453684_0063529_2922_3326 122
99 3300046511 Ga0495608_0111454 Ga0495608_0111454_24_401 122
100 3300049568 Ga0501031_0035599 Ga0501031_0035599_2345_2722 122
101 3300049571 Ga0501034_0062658 Ga0501034_0062658_1917_2291 122
102 3300049571 Ga0501034_0066397 Ga0501034_0066397_1805_2179 122
103 3300049575 Ga0501039_0569329 Ga0501039_0569329_502_879 122
104 3300049576 Ga0501040_0354129 Ga0501040_0354129_79_456 122
105 3300049578 Ga0501042_0232119 Ga0501042_0232119_816_1193 122
106 3300049580 Ga0501046_0054789 Ga0501046_0054789_603_980 122
107 3300049581 Ga0501047_0088849 Ga0501047_0088849_287_661 122
108 3300049588 Ga0501072_0446200 Ga0501072_0446200_350_727 122
109 3300049590 Ga0501074_0079445 Ga0501074_0079445_61_438 122
110 3300049592 Ga0501076_0095619 Ga0501076_0095619_1162_1539 122
111 3300049593 Ga0501077_1088198 Ga0501077_1088198_20_397 122
112 3300049743 Ga0501081_0378977 Ga0501081_0378977_471_848 122
113 3300054114 Ga0501084_0641884 Ga0501084_0641884_403_780 122
114 3300060353 Ga0501082_0338562 Ga0501082_0338562_89_466 122
115 3300005445 Ga0070708_101414508 Ga0070708_1014145081 123
116 3300005981 Ga0081538_10150710 Ga0081538_101507102 123
117 3300037471 Ga0395905_0198957 Ga0395905_0198957_1069_1446 123
118 3300042993 Ga0439440_0062541 Ga0439440_0062541_160_552 123
119 3300049568 Ga0501031_0154652 Ga0501031_0154652_777_1157 123
120 3300049568 Ga0501031_0441002 Ga0501031_0441002_415_795 123
121 3300049575 Ga0501039_0426311 Ga0501039_0426311_13_393 123
122 3300049576 Ga0501040_0834598 Ga0501040_0834598_122_502 123
123 3300049578 Ga0501042_0407151 Ga0501042_0407151_301_681 123
124 3300049579 Ga0501043_0234168 Ga0501043_0234168_905_1285 123
125 3300049580 Ga0501046_0813578 Ga0501046_0813578_137_517 123
126 3300049585 Ga0501069_0945375 Ga0501069_0945375_77_457 123
127 3300049586 Ga0501070_0596684 Ga0501070_0596684_163_543 123
128 3300049587 Ga0501071_0084444 Ga0501071_0084444_1074_1454 123
129 3300049588 Ga0501072_0929875 Ga0501072_0929875_221_592 123
130 3300049588 Ga0501072_1006688 Ga0501072_1006688_107_487 123
131 3300049590 Ga0501074_1203455 Ga0501074_1203455_115_486 123
132 3300049591 Ga0501075_0402555 Ga0501075_0402555_336_716 123
133 3300049592 Ga0501076_0374332 Ga0501076_0374332_749_1129 123
134 3300049741 Ga0501079_0286377 Ga0501079_0286377_722_1102 123
135 3300049741 Ga0501079_0433295 Ga0501079_0433295_273_653 123
136 3300049743 Ga0501081_0461772 Ga0501081_0461772_302_673 123
137 3300049743 Ga0501081_0556481 Ga0501081_0556481_263_643 123
138 3300049822 Ga0501035_0981119 Ga0501035_0981119_163_543 123
139 3300049824 Ga0501045_0310902 Ga0501045_0310902_583_963 123
140 3300054114 Ga0501084_0227232 Ga0501084_0227232_54_434 123
141 3300060353 Ga0501082_0181109 Ga0501082_0181109_287_667 123
142 3300061734 Ga0530510_0190192 Ga0530510_0190192_790_1170 123
143 3300061734 Ga0530510_1432266 Ga0530510_1432266_140_520 123
144 3300005329 Ga0070683_100069655 Ga0070683_1000696553 124
145 3300005434 Ga0070709_10026166 Ga0070709_100261662 124
146 3300005436 Ga0070713_100518109 Ga0070713_1005181092 124
147 3300005445 Ga0070708_100565300 Ga0070708_1005653002 124
148 3300005614 Ga0068856_101381080 Ga0068856_1013810801 124
149 3300024225 Ga0224572_1067400 Ga0224572_10674002 124
150 3300025915 Ga0207693_10530591 Ga0207693_105305913 124
151 3300025928 Ga0207700_10339277 Ga0207700_103392772 124
152 3300026078 Ga0207702_11396798 Ga0207702_113967981 124
153 3300028800 Ga0265338_10243249 Ga0265338_102432492 124
154 3300031616 Ga0307508_10483885 Ga0307508_104838852 124
155 3300035116 Ga0373945_0000090 Ga0373945_0000090_1928_2305 124
156 3300035410 Ga0373924_0004118 Ga0373924_0004118_3165_3542 124
157 3300037853 Ga0436364_1208739 Ga0436364_1208739_1497_1874 124
158 3300044842 Ga0466957_1397107 Ga0466957_1397107_100_477 124
159 3300046531 Ga0495665_0016505 Ga0495665_0016505_601_978 124
160 3300048089 Ga0495614_0246811 Ga0495614_0246811_291_668 124
161 3300005327 Ga0070658_10992104 Ga0070658_109921042 126
162 3300005329 Ga0070683_100289002 Ga0070683_1002890022 126
163 3300005341 Ga0070691_10300605 Ga0070691_103006052 126
164 3300005435 Ga0070714_100775421 Ga0070714_1007754212 126
165 3300005435 Ga0070714_101356679 Ga0070714_1013566792 126
166 3300005436 Ga0070713_100557147 Ga0070713_1005571471 126
167 3300005467 Ga0070706_100117398 Ga0070706_1001173981 126
168 3300005545 Ga0070695_100077632 Ga0070695_1000776323 126
169 3300005578 Ga0068854_100023654 Ga0068854_1000236547 126
170 3300005616 Ga0068852_101565415 Ga0068852_1015654152 126
171 3300006028 Ga0070717_10174669 Ga0070717_101746693 126
172 3300006173 Ga0070716_100488319 Ga0070716_1004883191 126
173 3300006175 Ga0070712_100446067 Ga0070712_1004460672 126
174 3300006871 Ga0075434_101031916 Ga0075434_1010319162 126
175 3300006881 Ga0068865_100251231 Ga0068865_1002512312 126
176 3300009545 Ga0105237_10829203 Ga0105237_108292032 126
177 3300009553 Ga0105249_10778236 Ga0105249_107782361 126
178 3300009988 Ga0105035_101510 Ga0105035_1015103 126
179 3300009993 Ga0105028_101630 Ga0105028_1016303 126
180 3300013296 Ga0157374_11095398 Ga0157374_110953982 126
181 3300013308 Ga0157375_12413045 Ga0157375_124130451 126
182 3300014968 Ga0157379_11905932 Ga0157379_119059321 126
183 3300025915 Ga0207693_10635612 Ga0207693_106356122 126
184 3300025935 Ga0207709_11055940 Ga0207709_110559401 126
185 3300025937 Ga0207669_10831268 Ga0207669_108312682 126
186 3300025938 Ga0207704_10064201 Ga0207704_100642013 126
187 3300025939 Ga0207665_10287060 Ga0207665_102870601 126
188 3300025944 Ga0207661_10586098 Ga0207661_105860983 126
189 3300025981 Ga0207640_10253881 Ga0207640_102538813 126
190 3300031090 Ga0265760_10059696 Ga0265760_100596962 126
191 3300035083 Ga0373926_0014148 Ga0373926_0014148_496_879 126
192 3300035117 Ga0373953_0372114 Ga0373953_0372114_222_605 126
193 3300035118 Ga0373954_0306513 Ga0373954_0306513_90_473 126
194 3300035119 Ga0373956_0241814 Ga0373956_0241814_81_464 126
195 3300035120 Ga0373957_0368638 Ga0373957_0368638_57_440 126
196 3300035692 Ga0373935_0406749 Ga0373935_0406749_478_861 126
197 3300035692 Ga0373935_0470641 Ga0373935_0470641_167_550 126
198 3300035724 Ga0373933_0565057 Ga0373933_0565057_122_505 126
199 3300037068 Ga0373925_0950822 Ga0373925_0950822_287_670 126
200 3300037853 Ga0436364_0423175 Ga0436364_0423175_286_669 126
201 3300037853 Ga0436364_1386613 Ga0436364_1386613_435_818 126
202 3300039453 Ga0436362_0345175 Ga0436362_0345175_351_734 126
203 3300044656 Ga0466969_0011555 Ga0466969_0011555_4207_4590 126
204 3300046459 Ga0495629_0708003 Ga0495629_0708003_196_579 126
205 3300046462 Ga0495651_0274648 Ga0495651_0274648_477_860 126
206 3300046529 Ga0495652_0270253 Ga0495652_0270253_765_1148 126
207 3300046533 Ga0495640_0103114 Ga0495640_0103114_470_853 126
208 3300046533 Ga0495640_0268919 Ga0495640_0268919_666_1049 126
209 3300046642 Ga0495634_0582413 Ga0495634_0582413_186_569 126
210 3300046642 Ga0495634_0649016 Ga0495634_0649016_12_395 126
211 3300046663 Ga0495635_0160584 Ga0495635_0160584_445_828 126
212 3300046663 Ga0495635_0883074 Ga0495635_0883074_102_485 126
213 3300046683 Ga0495658_0294554 Ga0495658_0294554_43_426 126
214 3300046689 Ga0495613_0289603 Ga0495613_0289603_107_490 126
215 3300046690 Ga0495624_0265827 Ga0495624_0265827_100_483 126
216 3300046809 Ga0495600_0093062 Ga0495600_0093062_970_1353 126
217 3300047319 Ga0495674_0205340 Ga0495674_0205340_458_841 126
218 3300047322 Ga0495680_0049794 Ga0495680_0049794_1773_2156 126
219 3300047471 Ga0495684_0034632 Ga0495684_0034632_1063_1446 126
220 3300047673 Ga0495593_0435539 Ga0495593_0435539_230_613 126
221 3300048917 Ga0496114_0608000 Ga0496114_0608000_365_748 126
222 3300048918 Ga0496115_0808024 Ga0496115_0808024_142_525 126
223 3300053077 Ga0495601_0969002 Ga0495601_0969002_101_484 126
224 3300005328 Ga0070676_10671226 Ga0070676_106712262 127
225 3300005329 Ga0070683_100769462 Ga0070683_1007694622 127
226 3300005334 Ga0068869_100584529 Ga0068869_1005845292 127
227 3300005337 Ga0070682_100563429 Ga0070682_1005634292 127
228 3300005344 Ga0070661_100451811 Ga0070661_1004518113 127
229 3300005367 Ga0070667_101593932 Ga0070667_1015939322 127
230 3300005455 Ga0070663_100186143 Ga0070663_1001861433 127
231 3300005456 Ga0070678_100137321 Ga0070678_1001373212 127
232 3300005535 Ga0070684_100589056 Ga0070684_1005890562 127
233 3300005548 Ga0070665_100376640 Ga0070665_1003766403 127
234 3300005564 Ga0070664_100143718 Ga0070664_1001437182 127
235 3300005577 Ga0068857_100150033 Ga0068857_1001500333 127
236 3300005614 Ga0068856_101192931 Ga0068856_1011929312 127
237 3300005617 Ga0068859_100661295 Ga0068859_1006612952 127
238 3300005618 Ga0068864_100520555 Ga0068864_1005205552 127
239 3300005840 Ga0068870_10122926 Ga0068870_101229263 127
240 3300005841 Ga0068863_100423465 Ga0068863_1004234653 127
241 3300005842 Ga0068858_100747934 Ga0068858_1007479341 127
242 3300006931 Ga0097620_100661263 Ga0097620_1006612632 127
243 3300009101 Ga0105247_10392799 Ga0105247_103927992 127
244 3300009177 Ga0105248_11250579 Ga0105248_112505792 127
245 3300011119 Ga0105246_10287112 Ga0105246_102871122 127
246 3300013105 Ga0157369_10240502 Ga0157369_102405023 127
247 3300013308 Ga0157375_10609650 Ga0157375_106096502 127
248 3300014325 Ga0163163_10190145 Ga0163163_101901453 127
249 3300014745 Ga0157377_10191024 Ga0157377_101910243 127
250 3300014968 Ga0157379_10271421 Ga0157379_102714213 127
251 3300014969 Ga0157376_10737514 Ga0157376_107375141 127
252 3300025908 Ga0207643_10045577 Ga0207643_100455772 127
253 3300025909 Ga0207705_10667629 Ga0207705_106676292 127
254 3300025920 Ga0207649_10517768 Ga0207649_105177683 127
255 3300025925 Ga0207650_11703355 Ga0207650_117033551 127
256 3300025926 Ga0207659_10331176 Ga0207659_103311762 127
257 3300025945 Ga0207679_10541615 Ga0207679_105416153 127
258 3300026023 Ga0207677_11693383 Ga0207677_116933831 127
259 3300026035 Ga0207703_10447799 Ga0207703_104477992 127
260 3300026067 Ga0207678_10031327 Ga0207678_100313273 127
261 3300026078 Ga0207702_10486030 Ga0207702_104860303 127
262 3300026095 Ga0207676_10158995 Ga0207676_101589952 127
263 3300026116 Ga0207674_10254090 Ga0207674_102540903 127
264 3300026121 Ga0207683_10278097 Ga0207683_102780973 127
265 3300028379 Ga0268266_10246922 Ga0268266_102469222 127
266 3300048907 Ga0496104_0475729 Ga0496104_0475729_411_797 127
267 3300048911 Ga0496108_0328526 Ga0496108_0328526_815_1201 127
268 3300048912 Ga0496109_0454084 Ga0496109_0454084_389_775 127
269 3300048914 Ga0496111_0780451 Ga0496111_0780451_44_430 127
270 3300048915 Ga0496112_0301770 Ga0496112_0301770_976_1362 127
271 3300048916 Ga0496113_1222669 Ga0496113_1222669_10_396 127
272 3300021388 Ga0213875_10000309 Ga0213875_1000030915 129
273 3300049569 Ga0501032_0003015 Ga0501032_0003015_4539_4931 129
274 3300049571 Ga0501034_0013497 Ga0501034_0013497_342_734 129
275 3300049572 Ga0501036_0023592 Ga0501036_0023592_4356_4748 129
276 3300049574 Ga0501038_0002270 Ga0501038_0002270_3415_3807 129
277 3300049579 Ga0501043_0031991 Ga0501043_0031991_1512_1904 129
278 3300049580 Ga0501046_0009396 Ga0501046_0009396_735_1127 129
279 3300049581 Ga0501047_0004211 Ga0501047_0004211_9166_9558 129
280 3300049582 Ga0501048_0000449 Ga0501048_0000449_20226_20618 129
281 3300049586 Ga0501070_0008071 Ga0501070_0008071_4268_4660 129
282 3300049822 Ga0501035_0008532 Ga0501035_0008532_2716_3108 129
283 3300049823 Ga0501044_0021427 Ga0501044_0021427_1261_1653 129
284 3300060353 Ga0501082_0842605 Ga0501082_0842605_182_574 129
285 3300044765 Ga0466970_0005447 Ga0466970_0005447_4073_4468 130
286 3300003792 Ga0055540_1000029 Ga0055540_100002959 131
287 3300021388 Ga0213875_10253391 Ga0213875_102533911 131
288 3300025303 Ga0209051_1000042 Ga0209051_1000042205 131
289 3300030521 Ga0307511_10235102 Ga0307511_102351022 131
290 3300037853 Ga0436364_0156042 Ga0436364_0156042_5407_5805 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

26

140

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.8612 1 126
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.8546 1 126
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.8392 2 122
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8377 1 124
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.8369 2 122
ID Description Score Start End Superfamily
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 1 1 124 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9924 1 124 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9799 1 121 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9564 1 121 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.875 2 112 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A6L5ES54-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9968 1 126 GO:0000287
GO:0004540
GO:0090729
AF-A0A654U895-F1-model_v4 Toxin (EC 3.1.-.-) 0.9961 37 126 GO:0004518
GO:0046872
AF-A0A7I7MP51-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9908 1 130 GO:0000287
GO:0004540
GO:0090729
AF-A0A6L5ES54-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.989 1 126 GO:0000287
GO:0004540
GO:0090729
AF-A0A7K0JSH2-F1-model_v4 deleted 0.9878 1 124

Feature Viewer

pLDDT pTM Quality
94.11 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map