F389978
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 218 | 580 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0000144|Ga0495670_0000144_29992_30954 |
| Length | 320 |
| Sequence | METFQYTDIRRCRLCALFQKPLQFTIHYLPATAKARSHMVNSRKFHQLDVFTDTPYKGNPLAVVHDAQGLSDEQMASFARWTNLSETTFLLPPTDAAADYRVRIFTPGSELPFAGHPTLGSCSAWLRAGGVARQGDTIVQECGVGLVSIRRDGERLAFAAPPLRRTGPVDQTSLEQIARALGLADDEIVAHQWVDNGPGWCALMLDSAERVLSVRPDMAALGDFRVGIVAPQPAGSDTDFEVRVFVPSFGIPEDPVTGSLNAGLGQWLIGAGMAADSYVATQGTALGRAGKVFIDRIGDDIWVGGEVVRCIEGTVDFPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 101 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 104 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 111 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 112 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 122 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 125 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 126 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 127 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 128 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 129 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 130 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 131 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 132 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 133 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 134 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 135 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 136 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 195 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 196 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 197 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 200 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 201 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 202 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 203 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 204 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 205 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 206 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 207 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 208 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 209 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 210 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 211 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 212 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 213 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 214 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 215 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 216 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 217 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 218 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.86 |
| Metatranscriptomes | 0 |
| Isolates | 4.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.52 |
| Nodule | 1.38 |
| Rhizoplane | 4.83 |
| Rhizosphere | 80.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495670_0000144 | 3300046691 | Bacteria | 31081 |
| 2 | rootL2_10033738 | 3300003322 | Bacteria | 2571 |
| 3 | Ga0065707_10091040 | 3300005295 | Bacteria | 4017 |
| 4 | Ga0070680_100036538 | 3300005336 | Bacteria | 3968 |
| 5 | Ga0070691_10011107 | 3300005341 | Bacteria | 4110 |
| 6 | Ga0070692_10007518 | 3300005345 | Bacteria | 4802 |
| 7 | Ga0070674_100233008 | 3300005356 | Bacteria | 1438 |
| 8 | Ga0070703_10058872 | 3300005406 | Bacteria | 1251 |
| 9 | Ga0070709_10000542 | 3300005434 | Bacteria | 22119 |
| 10 | Ga0070709_10000759 | 3300005434 | Bacteria | 18219 |
| 11 | Ga0070709_10014082 | 3300005434 | Bacteria | 4515 |
| 12 | Ga0070709_10052051 | 3300005434 | Bacteria | 2571 |
| 13 | Ga0070714_100014422 | 3300005435 | Bacteria | 6348 |
| 14 | Ga0070714_100074677 | 3300005435 | Bacteria | 2940 |
| 15 | Ga0070713_100001573 | 3300005436 | Bacteria | 14603 |
| 16 | Ga0070713_100057137 | 3300005436 | Bacteria | 3247 |
| 17 | Ga0070713_100151569 | 3300005436 | Bacteria | 2063 |
| 18 | Ga0070710_10000642 | 3300005437 | Bacteria | 16650 |
| 19 | Ga0070710_10007769 | 3300005437 | Bacteria | 5204 |
| 20 | Ga0070710_10029113 | 3300005437 | Bacteria | 2960 |
| 21 | Ga0070710_10078972 | 3300005437 | Bacteria | 1916 |
| 22 | Ga0070701_10009528 | 3300005438 | Bacteria | 4258 |
| 23 | Ga0070711_100001693 | 3300005439 | Bacteria | 12214 |
| 24 | Ga0070711_100021990 | 3300005439 | Bacteria | 4129 |
| 25 | Ga0070711_100025420 | 3300005439 | Bacteria | 3874 |
| 26 | Ga0070700_100151899 | 3300005441 | Bacteria | 1585 |
| 27 | Ga0070694_100132409 | 3300005444 | Bacteria | 1803 |
| 28 | Ga0070708_100134125 | 3300005445 | Bacteria | 2293 |
| 29 | Ga0070678_100029953 | 3300005456 | Bacteria | 3734 |
| 30 | Ga0070678_100569303 | 3300005456 | Bacteria | 1008 |
| 31 | Ga0070681_10016302 | 3300005458 | Bacteria | 7414 |
| 32 | Ga0070706_100008899 | 3300005467 | Bacteria | 9349 |
| 33 | Ga0070707_100070011 | 3300005468 | Bacteria | 3379 |
| 34 | Ga0070679_100069266 | 3300005530 | Bacteria | 3519 |
| 35 | Ga0070672_100066235 | 3300005543 | Bacteria | 2860 |
| 36 | Ga0070672_100426315 | 3300005543 | Bacteria | 1140 |
| 37 | Ga0070686_100391097 | 3300005544 | Bacteria | 1055 |
| 38 | Ga0070695_100008563 | 3300005545 | Bacteria | 6075 |
| 39 | Ga0070695_100117789 | 3300005545 | Bacteria | 1813 |
| 40 | Ga0070695_100278712 | 3300005545 | Bacteria | 1228 |
| 41 | Ga0070704_100110314 | 3300005549 | Bacteria | 2092 |
| 42 | Ga0070704_100225237 | 3300005549 | Bacteria | 1527 |
| 43 | Ga0068855_100125524 | 3300005563 | Bacteria | 2935 |
| 44 | Ga0068857_100264116 | 3300005577 | Bacteria | 1581 |
| 45 | Ga0068856_100014667 | 3300005614 | Bacteria | 7564 |
| 46 | Ga0070702_100009046 | 3300005615 | Bacteria | 4855 |
| 47 | Ga0068859_100130041 | 3300005617 | Bacteria | 2589 |
| 48 | Ga0068861_100234619 | 3300005719 | Bacteria | 1557 |
| 49 | Ga0068860_100033675 | 3300005843 | Bacteria | 4915 |
| 50 | Ga0068860_100377480 | 3300005843 | Bacteria | 1399 |
| 51 | Ga0068860_100473072 | 3300005843 | Bacteria | 1248 |
| 52 | Ga0068862_100024260 | 3300005844 | Bacteria | 5088 |
| 53 | Ga0081540_1017537 | 3300005983 | Bacteria | 4428 |
| 54 | Ga0070717_10014565 | 3300006028 | Bacteria | 6053 |
| 55 | Ga0075368_10013931 | 3300006042 | Bacteria | 2960 |
| 56 | Ga0075368_10143446 | 3300006042 | Bacteria | 996 |
| 57 | Ga0075363_100033838 | 3300006048 | Bacteria | 2665 |
| 58 | Ga0075364_10000451 | 3300006051 | Bacteria | 20676 |
| 59 | Ga0070715_10000661 | 3300006163 | Bacteria | 9217 |
| 60 | Ga0070716_100000192 | 3300006173 | Bacteria | 24137 |
| 61 | Ga0070712_100001218 | 3300006175 | Bacteria | 15564 |
| 62 | Ga0070712_100013507 | 3300006175 | Bacteria | 5221 |
| 63 | Ga0070712_100015526 | 3300006175 | Bacteria | 4909 |
| 64 | Ga0075367_10062323 | 3300006178 | Bacteria | 2227 |
| 65 | Ga0097621_100109605 | 3300006237 | Bacteria | 2332 |
| 66 | Ga0068871_100005095 | 3300006358 | Bacteria | 9179 |
| 67 | Ga0075430_100183547 | 3300006846 | Bacteria | 1740 |
| 68 | Ga0075430_100313776 | 3300006846 | Bacteria | 1296 |
| 69 | Ga0075429_100295268 | 3300006880 | Bacteria | 1419 |
| 70 | Ga0097620_100130038 | 3300006931 | Bacteria | 2589 |
| 71 | Ga0105245_10382025 | 3300009098 | Bacteria | 1403 |
| 72 | Ga0105247_10019501 | 3300009101 | Bacteria | 4072 |
| 73 | Ga0105243_10079049 | 3300009148 | Bacteria | 2680 |
| 74 | Ga0105241_10010216 | 3300009174 | Bacteria | 6895 |
| 75 | Ga0105242_10153090 | 3300009176 | Bacteria | 2012 |
| 76 | Ga0105242_10389371 | 3300009176 | Bacteria | 1298 |
| 77 | Ga0105248_10027637 | 3300009177 | Bacteria | 6318 |
| 78 | Ga0105237_10249510 | 3300009545 | Bacteria | 1777 |
| 79 | Ga0105238_10132088 | 3300009551 | Bacteria | 2475 |
| 80 | Ga0105239_10351473 | 3300010375 | Bacteria | 1664 |
| 81 | Ga0157378_10046861 | 3300013297 | Bacteria | 3842 |
| 82 | Ga0157375_10061452 | 3300013308 | Bacteria | 3730 |
| 83 | Ga0157380_10001019 | 3300014326 | Bacteria | 17838 |
| 84 | Ga0157380_10087563 | 3300014326 | Bacteria | 2561 |
| 85 | Ga0157379_10049707 | 3300014968 | Bacteria | 3744 |
| 86 | Ga0157376_10743714 | 3300014969 | Bacteria | 989 |
| 87 | Ga0163161_10112657 | 3300017792 | Bacteria | 2035 |
| 88 | Ga0213872_10000122 | 3300021361 | Bacteria | 73335 |
| 89 | Ga0213876_10004130 | 3300021384 | Bacteria | 8156 |
| 90 | Ga0207692_10000462 | 3300025898 | Bacteria | 14350 |
| 91 | Ga0207692_10119485 | 3300025898 | Bacteria | 1473 |
| 92 | Ga0207692_10176668 | 3300025898 | Bacteria | 1241 |
| 93 | Ga0207680_10184259 | 3300025903 | Bacteria | 1414 |
| 94 | Ga0207685_10002846 | 3300025905 | Bacteria | 4070 |
| 95 | Ga0207699_10001105 | 3300025906 | Bacteria | 12742 |
| 96 | Ga0207699_10007020 | 3300025906 | Bacteria | 5487 |
| 97 | Ga0207699_10017411 | 3300025906 | Bacteria | 3780 |
| 98 | Ga0207699_10195287 | 3300025906 | Bacteria | 1368 |
| 99 | Ga0207705_10196702 | 3300025909 | Bacteria | 1526 |
| 100 | Ga0207684_10009791 | 3300025910 | Bacteria | 8454 |
| 101 | Ga0207654_10079917 | 3300025911 | Bacteria | 1965 |
| 102 | Ga0207707_10001660 | 3300025912 | Bacteria | 20546 |
| 103 | Ga0207693_10000354 | 3300025915 | Bacteria | 42162 |
| 104 | Ga0207693_10002055 | 3300025915 | Bacteria | 17603 |
| 105 | Ga0207693_10071194 | 3300025915 | Bacteria | 2721 |
| 106 | Ga0207663_10006117 | 3300025916 | Bacteria | 6125 |
| 107 | Ga0207663_10024924 | 3300025916 | Bacteria | 3450 |
| 108 | Ga0207660_10039945 | 3300025917 | Bacteria | 3282 |
| 109 | Ga0207652_10010980 | 3300025921 | Bacteria | 7302 |
| 110 | Ga0207652_10375663 | 3300025921 | Bacteria | 1283 |
| 111 | Ga0207687_10312539 | 3300025927 | Bacteria | 1269 |
| 112 | Ga0207700_10001688 | 3300025928 | Bacteria | 12531 |
| 113 | Ga0207700_10129188 | 3300025928 | Bacteria | 2060 |
| 114 | Ga0207664_10002322 | 3300025929 | Bacteria | 12570 |
| 115 | Ga0207686_10317510 | 3300025934 | Bacteria | 1163 |
| 116 | Ga0207665_10000042 | 3300025939 | Bacteria | 82783 |
| 117 | Ga0207711_10082575 | 3300025941 | Bacteria | 2809 |
| 118 | Ga0207667_10195215 | 3300025949 | Bacteria | 2077 |
| 119 | Ga0207678_10035065 | 3300026067 | Bacteria | 4368 |
| 120 | Ga0207708_10008214 | 3300026075 | Bacteria | 7732 |
| 121 | Ga0207702_10022922 | 3300026078 | Bacteria | 5180 |
| 122 | Ga0207648_10293709 | 3300026089 | Bacteria | 1456 |
| 123 | Ga0207674_10204985 | 3300026116 | Bacteria | 1921 |
| 124 | Ga0207675_100010010 | 3300026118 | Bacteria | 8885 |
| 125 | Ga0207675_100054012 | 3300026118 | Bacteria | 3748 |
| 126 | Ga0207683_10007560 | 3300026121 | Bacteria | 9311 |
| 127 | Ga0207683_10600992 | 3300026121 | Bacteria | 1018 |
| 128 | Ga0268265_10032470 | 3300028380 | Bacteria | 3784 |
| 129 | Ga0268264_10070867 | 3300028381 | Bacteria | 2951 |
| 130 | Ga0268264_10544624 | 3300028381 | Bacteria | 1137 |
| 131 | Ga0265334_10007123 | 3300028573 | Bacteria | 4797 |
| 132 | Ga0265318_10009409 | 3300028577 | Bacteria | 4297 |
| 133 | Ga0265323_10003886 | 3300028653 | Bacteria | 6500 |
| 134 | Ga0307515_10156325 | 3300028794 | Bacteria | 2351 |
| 135 | Ga0265338_10002598 | 3300028800 | Bacteria | 26701 |
| 136 | Ga0265324_10017497 | 3300029957 | Bacteria | 2606 |
| 137 | Ga0265328_10027138 | 3300031239 | Bacteria | 2147 |
| 138 | Ga0265331_10005485 | 3300031250 | Bacteria | 7657 |
| 139 | Ga0265327_10000444 | 3300031251 | Bacteria | 74908 |
| 140 | Ga0307513_10119009 | 3300031456 | Bacteria | 2614 |
| 141 | Ga0307509_10019653 | 3300031507 | Bacteria | 7696 |
| 142 | Ga0307408_100129058 | 3300031548 | Bacteria | 1970 |
| 143 | Ga0307408_100158697 | 3300031548 | Bacteria | 1794 |
| 144 | Ga0307406_10136516 | 3300031901 | Bacteria | 1730 |
| 145 | Ga0307416_100151936 | 3300032002 | Bacteria | 2125 |
| 146 | Ga0373943_0230274 | 3300035170 | Bacteria | 1035 |
| 147 | Ga0373935_0006288 | 3300035692 | Bacteria | 7075 |
| 148 | Ga0373927_0013168 | 3300035695 | Bacteria | 5501 |
| 149 | Ga0373947_0075342 | 3300035725 | Bacteria | 2077 |
| 150 | Ga0373937_0092569 | 3300036401 | Bacteria | 2802 |
| 151 | Ga0373937_0519723 | 3300036401 | Bacteria | 1131 |
| 152 | Ga0373925_0152628 | 3300037068 | Bacteria | 1815 |
| 153 | Ga0373925_0229650 | 3300037068 | Bacteria | 1483 |
| 154 | Ga0395899_0009458 | 3300037312 | Bacteria | 7481 |
| 155 | Ga0395900_0054541 | 3300037418 | Bacteria | 4115 |
| 156 | Ga0395898_0031119 | 3300037466 | Bacteria | 5336 |
| 157 | Ga0395898_0210507 | 3300037466 | Bacteria | 1855 |
| 158 | Ga0395898_0289618 | 3300037466 | Bacteria | 1562 |
| 159 | Ga0395905_0021812 | 3300037471 | Bacteria | 6057 |
| 160 | Ga0436364_1261910 | 3300037853 | Bacteria | 1352 |
| 161 | Ga0395901_0048912 | 3300038443 | Bacteria | 4391 |
| 162 | Ga0395901_0291304 | 3300038443 | Bacteria | 1694 |
| 163 | Ga0395901_0870628 | 3300038443 | Bacteria | 885 |
| 164 | Ga0436365_0232459 | 3300039437 | Bacteria | 11864 |
| 165 | Ga0436365_1734604 | 3300039437 | Bacteria | 959 |
| 166 | Ga0436360_0464839 | 3300039438 | Unclassified | 1058 |
| 167 | Ga0436360_0700533 | 3300039438 | Bacteria | 932 |
| 168 | Ga0436361_0813098 | 3300039447 | Bacteria | 136133 |
| 169 | Ga0436363_0768201 | 3300039450 | Bacteria | 2125 |
| 170 | Ga0436362_0483728 | 3300039453 | Bacteria | 1992 |
| 171 | Ga0439455_0026745 | 3300042012 | Bacteria | 1410 |
| 172 | Ga0450890_001539 | 3300042127 | Bacteria | 3312 |
| 173 | Ga0450890_006473 | 3300042127 | Bacteria | 1498 |
| 174 | Ga0450891_000032 | 3300042129 | Bacteria | 9877 |
| 175 | Ga0450892_003605 | 3300042130 | Bacteria | 1271 |
| 176 | Ga0450898_006357 | 3300042134 | Bacteria | 1811 |
| 177 | Ga0450889_000706 | 3300042144 | Bacteria | 3613 |
| 178 | Ga0439434_0060973 | 3300042435 | Bacteria | 1179 |
| 179 | Ga0439464_0006270 | 3300042439 | Bacteria | 3095 |
| 180 | Ga0450916_005151 | 3300042530 | Bacteria | 1503 |
| 181 | Ga0450893_0001485 | 3300042532 | Bacteria | 3601 |
| 182 | Ga0451577_0147130 | 3300042876 | Bacteria | 2119 |
| 183 | Ga0453683_0000971 | 3300044673 | Bacteria | 27149 |
| 184 | Ga0466961_0143014 | 3300044693 | Bacteria | 1497 |
| 185 | Ga0453684_0321405 | 3300044712 | Bacteria | 1753 |
| 186 | Ga0466957_0071863 | 3300044842 | Bacteria | 2141 |
| 187 | Ga0451576_0006552 | 3300045051 | Bacteria | 14247 |
| 188 | Ga0451576_0397148 | 3300045051 | Bacteria | 1445 |
| 189 | Ga0495617_000600 | 3300046452 | Bacteria | 18290 |
| 190 | Ga0495653_0031081 | 3300046463 | Bacteria | 4247 |
| 191 | Ga0495605_0008318 | 3300046474 | Bacteria | 5865 |
| 192 | Ga0495605_0020376 | 3300046474 | Bacteria | 3525 |
| 193 | Ga0495605_0058185 | 3300046474 | Bacteria | 1858 |
| 194 | Ga0495584_0000420 | 3300046491 | Bacteria | 29241 |
| 195 | Ga0495584_0003743 | 3300046491 | Bacteria | 8287 |
| 196 | Ga0495585_0000042 | 3300046492 | Bacteria | 125286 |
| 197 | Ga0495585_0022228 | 3300046492 | Bacteria | 3641 |
| 198 | Ga0495585_0028863 | 3300046492 | Bacteria | 3161 |
| 199 | Ga0495596_0003081 | 3300046500 | Bacteria | 8611 |
| 200 | Ga0495607_0011099 | 3300046501 | Bacteria | 6012 |
| 201 | Ga0495583_0000132 | 3300046506 | Bacteria | 125343 |
| 202 | Ga0495583_0000876 | 3300046506 | Bacteria | 36500 |
| 203 | Ga0495606_0017077 | 3300046507 | Bacteria | 5504 |
| 204 | Ga0495616_0007151 | 3300046513 | Bacteria | 6695 |
| 205 | Ga0495616_0007188 | 3300046513 | Bacteria | 6674 |
| 206 | Ga0495631_0014705 | 3300046518 | Bacteria | 3770 |
| 207 | Ga0495632_0000327 | 3300046519 | Bacteria | 45721 |
| 208 | Ga0495632_0003601 | 3300046519 | Bacteria | 10900 |
| 209 | Ga0495632_0020033 | 3300046519 | Bacteria | 3632 |
| 210 | Ga0495644_0001089 | 3300046523 | Bacteria | 11239 |
| 211 | Ga0495644_0059755 | 3300046523 | Bacteria | 1433 |
| 212 | Ga0495648_0000052 | 3300046524 | Bacteria | 162169 |
| 213 | Ga0495642_0000819 | 3300046528 | Bacteria | 14989 |
| 214 | Ga0495587_0054931 | 3300046536 | Bacteria | 2346 |
| 215 | Ga0495609_0034970 | 3300046538 | Bacteria | 2276 |
| 216 | Ga0495621_0007379 | 3300046539 | Bacteria | 3253 |
| 217 | Ga0495633_0009043 | 3300046558 | Bacteria | 5540 |
| 218 | Ga0495611_0015317 | 3300046648 | Bacteria | 3277 |
| 219 | Ga0495625_0199872 | 3300046660 | Bacteria | 1320 |
| 220 | Ga0495661_0032487 | 3300046665 | Bacteria | 3298 |
| 221 | Ga0495661_0106255 | 3300046665 | Bacteria | 1571 |
| 222 | Ga0495599_0160211 | 3300046678 | Bacteria | 1391 |
| 223 | Ga0495669_0003064 | 3300046684 | Bacteria | 6873 |
| 224 | Ga0495670_0029429 | 3300046691 | Bacteria | 2726 |
| 225 | Ga0495649_0001749 | 3300046694 | Bacteria | 16031 |
| 226 | Ga0495672_0024329 | 3300047320 | Bacteria | 3904 |
| 227 | Ga0495672_0107990 | 3300047320 | Bacteria | 1498 |
| 228 | Ga0495676_0359134 | 3300047321 | Bacteria | 973 |
| 229 | Ga0495680_0041094 | 3300047322 | Bacteria | 3678 |
| 230 | Ga0495683_0007512 | 3300047323 | Bacteria | 5885 |
| 231 | Ga0495679_055050 | 3300047446 | Unclassified | 1182 |
| 232 | Ga0495681_0014274 | 3300047470 | Bacteria | 4561 |
| 233 | Ga0495686_0013392 | 3300047472 | Bacteria | 5691 |
| 234 | Ga0495626_0002284 | 3300048091 | Bacteria | 13628 |
| 235 | Ga0495626_0008476 | 3300048091 | Bacteria | 5631 |
| 236 | Ga0495626_0023380 | 3300048091 | Unclassified | 3044 |
| 237 | Ga0496100_0016590 | 3300048903 | Bacteria | 4328 |
| 238 | Ga0496102_0137888 | 3300048905 | Bacteria | 2286 |
| 239 | Ga0496102_0166133 | 3300048905 | Bacteria | 2076 |
| 240 | Ga0496103_0017468 | 3300048906 | Bacteria | 4293 |
| 241 | Ga0496103_0117530 | 3300048906 | Bacteria | 1693 |
| 242 | Ga0496103_0272579 | 3300048906 | Bacteria | 1089 |
| 243 | Ga0496104_0157218 | 3300048907 | Bacteria | 2181 |
| 244 | Ga0496105_0068168 | 3300048908 | Bacteria | 2938 |
| 245 | Ga0496106_0330452 | 3300048909 | Bacteria | 1224 |
| 246 | Ga0496107_0019702 | 3300048910 | Bacteria | 4760 |
| 247 | Ga0496109_0018344 | 3300048912 | Bacteria | 6147 |
| 248 | Ga0496109_0808432 | 3300048912 | Bacteria | 875 |
| 249 | Ga0496114_0015404 | 3300048917 | Bacteria | 6149 |
| 250 | Ga0496115_0042425 | 3300048918 | Bacteria | 3624 |
| 251 | Ga0496121_0076460 | 3300048924 | Bacteria | 2669 |
| 252 | Ga0496124_0081684 | 3300048927 | Bacteria | 2655 |
| 253 | Ga0496126_0025844 | 3300048929 | Bacteria | 5641 |
| 254 | Ga0496126_0067061 | 3300048929 | Bacteria | 3207 |
| 255 | Ga0496126_0078583 | 3300048929 | Bacteria | 2923 |
| 256 | Ga0496126_0114123 | 3300048929 | Bacteria | 2351 |
| 257 | Ga0495678_004026 | 3300049459 | Bacteria | 8747 |
| 258 | Ga0501032_0246197 | 3300049569 | Bacteria | 1161 |
| 259 | Ga0501033_0047205 | 3300049570 | Bacteria | 3202 |
| 260 | Ga0501038_0152002 | 3300049574 | Bacteria | 1887 |
| 261 | Ga0501039_0217306 | 3300049575 | Bacteria | 1503 |
| 262 | Ga0501071_0055244 | 3300049587 | Bacteria | 2866 |
| 263 | Ga0501072_0056728 | 3300049588 | Bacteria | 3086 |
| 264 | Ga0501211_000894 | 3300049658 | Bacteria | 3119 |
| 265 | Ga0501221_001813 | 3300049704 | Bacteria | 3568 |
| 266 | nmdc:mga04h51_11508_c1 | 3300050495 | Bacteria | 2457 |
| 267 | nmdc:mga07m45_25871_c1 | 3300050496 | Bacteria | 3223 |
| 268 | nmdc:mga07m45_98547_c1 | 3300050496 | Bacteria | 1678 |
| 269 | nmdc:mga0qj67_328363_c1 | 3300050509 | Bacteria | 1238 |
| 270 | Ga0500562_004767 | 3300053108 | Bacteria | 3415 |
| 271 | Ga0500572_000343 | 3300053111 | Bacteria | 16647 |
| 272 | Ga0500559_0000552 | 3300053136 | Bacteria | 25939 |
| 273 | Ga0500616_0000304 | 3300053153 | Bacteria | 71131 |
| 274 | Ga0500622_0037821 | 3300053156 | Bacteria | 2520 |
| 275 | Ga0500645_004828 | 3300053730 | Bacteria | 5086 |
| 276 | Ga0500645_032684 | 3300053730 | Bacteria | 1559 |
| 277 | Ga0500596_000906 | 3300053735 | Bacteria | 5925 |
| 278 | Ga0590075_012502 | 3300059424 | Bacteria | 2063 |
| 279 | 2579856148 | 2579778521 | Bacteria | 7624758 |
| 280 | 2619856821 | 2619618881 | Bacteria | 7521104 |
| 281 | 2620352283 | 2619619003 | Bacteria | 7619552 |
| 282 | 2626637688 | 2626541554 | Bacteria | 7741902 |
| 283 | 2643741968 | 2643221544 | Bacteria | 5886209 |
| 284 | 2643934112 | 2643221585 | Bacteria | 5812563 |
| 285 | 2644261207 | 2643221646 | Bacteria | 6433402 |
| 286 | 2644315599 | 2643221656 | Bacteria | 5809961 |
| 287 | 2644339707 | 2643221660 | Bacteria | 4208257 |
| 288 | 2854901896 | 2854896431 | Bacteria | 5869725 |
| 289 | 8054917965 | 8054913762 | Bacteria | 7713009 |
| 290 | 8054924924 | 8054920844 | Bacteria | 7068637 |
| 291 | Ga0495670_0000144 | |||
| 292 | rootL2_10033738 | |||
| 293 | Ga0065707_10091040 | |||
| 294 | Ga0070680_100036538 | |||
| 295 | Ga0070691_10011107 | |||
| 296 | Ga0070692_10007518 | |||
| 297 | Ga0070674_100233008 | |||
| 298 | Ga0070703_10058872 | |||
| 299 | Ga0070709_10000542 | |||
| 300 | Ga0070709_10000759 | |||
| 301 | Ga0070709_10014082 | |||
| 302 | Ga0070709_10052051 | |||
| 303 | Ga0070714_100014422 | |||
| 304 | Ga0070714_100074677 | |||
| 305 | Ga0070713_100001573 | |||
| 306 | Ga0070713_100057137 | |||
| 307 | Ga0070713_100151569 | |||
| 308 | Ga0070710_10000642 | |||
| 309 | Ga0070710_10007769 | |||
| 310 | Ga0070710_10029113 | |||
| 311 | Ga0070710_10078972 | |||
| 312 | Ga0070701_10009528 | |||
| 313 | Ga0070711_100001693 | |||
| 314 | Ga0070711_100021990 | |||
| 315 | Ga0070711_100025420 | |||
| 316 | Ga0070700_100151899 | |||
| 317 | Ga0070694_100132409 | |||
| 318 | Ga0070708_100134125 | |||
| 319 | Ga0070678_100029953 | |||
| 320 | Ga0070678_100569303 | |||
| 321 | Ga0070681_10016302 | |||
| 322 | Ga0070706_100008899 | |||
| 323 | Ga0070707_100070011 | |||
| 324 | Ga0070679_100069266 | |||
| 325 | Ga0070672_100066235 | |||
| 326 | Ga0070672_100426315 | |||
| 327 | Ga0070686_100391097 | |||
| 328 | Ga0070695_100008563 | |||
| 329 | Ga0070695_100117789 | |||
| 330 | Ga0070695_100278712 | |||
| 331 | Ga0070704_100110314 | |||
| 332 | Ga0070704_100225237 | |||
| 333 | Ga0068855_100125524 | |||
| 334 | Ga0068857_100264116 | |||
| 335 | Ga0068856_100014667 | |||
| 336 | Ga0070702_100009046 | |||
| 337 | Ga0068859_100130041 | |||
| 338 | Ga0068861_100234619 | |||
| 339 | Ga0068860_100033675 | |||
| 340 | Ga0068860_100377480 | |||
| 341 | Ga0068860_100473072 | |||
| 342 | Ga0068862_100024260 | |||
| 343 | Ga0081540_1017537 | |||
| 344 | Ga0070717_10014565 | |||
| 345 | Ga0075368_10013931 | |||
| 346 | Ga0075368_10143446 | |||
| 347 | Ga0075363_100033838 | |||
| 348 | Ga0075364_10000451 | |||
| 349 | Ga0070715_10000661 | |||
| 350 | Ga0070716_100000192 | |||
| 351 | Ga0070712_100001218 | |||
| 352 | Ga0070712_100013507 | |||
| 353 | Ga0070712_100015526 | |||
| 354 | Ga0075367_10062323 | |||
| 355 | Ga0097621_100109605 | |||
| 356 | Ga0068871_100005095 | |||
| 357 | Ga0075430_100183547 | |||
| 358 | Ga0075430_100313776 | |||
| 359 | Ga0075429_100295268 | |||
| 360 | Ga0097620_100130038 | |||
| 361 | Ga0105245_10382025 | |||
| 362 | Ga0105247_10019501 | |||
| 363 | Ga0105243_10079049 | |||
| 364 | Ga0105241_10010216 | |||
| 365 | Ga0105242_10153090 | |||
| 366 | Ga0105242_10389371 | |||
| 367 | Ga0105248_10027637 | |||
| 368 | Ga0105237_10249510 | |||
| 369 | Ga0105238_10132088 | |||
| 370 | Ga0105239_10351473 | |||
| 371 | Ga0157378_10046861 | |||
| 372 | Ga0157375_10061452 | |||
| 373 | Ga0157380_10001019 | |||
| 374 | Ga0157380_10087563 | |||
| 375 | Ga0157379_10049707 | |||
| 376 | Ga0157376_10743714 | |||
| 377 | Ga0163161_10112657 | |||
| 378 | Ga0213872_10000122 | |||
| 379 | Ga0213876_10004130 | |||
| 380 | Ga0207692_10000462 | |||
| 381 | Ga0207692_10119485 | |||
| 382 | Ga0207692_10176668 | |||
| 383 | Ga0207680_10184259 | |||
| 384 | Ga0207685_10002846 | |||
| 385 | Ga0207699_10001105 | |||
| 386 | Ga0207699_10007020 | |||
| 387 | Ga0207699_10017411 | |||
| 388 | Ga0207699_10195287 | |||
| 389 | Ga0207705_10196702 | |||
| 390 | Ga0207684_10009791 | |||
| 391 | Ga0207654_10079917 | |||
| 392 | Ga0207707_10001660 | |||
| 393 | Ga0207693_10000354 | |||
| 394 | Ga0207693_10002055 | |||
| 395 | Ga0207693_10071194 | |||
| 396 | Ga0207663_10006117 | |||
| 397 | Ga0207663_10024924 | |||
| 398 | Ga0207660_10039945 | |||
| 399 | Ga0207652_10010980 | |||
| 400 | Ga0207652_10375663 | |||
| 401 | Ga0207687_10312539 | |||
| 402 | Ga0207700_10001688 | |||
| 403 | Ga0207700_10129188 | |||
| 404 | Ga0207664_10002322 | |||
| 405 | Ga0207686_10317510 | |||
| 406 | Ga0207665_10000042 | |||
| 407 | Ga0207711_10082575 | |||
| 408 | Ga0207667_10195215 | |||
| 409 | Ga0207678_10035065 | |||
| 410 | Ga0207708_10008214 | |||
| 411 | Ga0207702_10022922 | |||
| 412 | Ga0207648_10293709 | |||
| 413 | Ga0207674_10204985 | |||
| 414 | Ga0207675_100010010 | |||
| 415 | Ga0207675_100054012 | |||
| 416 | Ga0207683_10007560 | |||
| 417 | Ga0207683_10600992 | |||
| 418 | Ga0268265_10032470 | |||
| 419 | Ga0268264_10070867 | |||
| 420 | Ga0268264_10544624 | |||
| 421 | Ga0265334_10007123 | |||
| 422 | Ga0265318_10009409 | |||
| 423 | Ga0265323_10003886 | |||
| 424 | Ga0307515_10156325 | |||
| 425 | Ga0265338_10002598 | |||
| 426 | Ga0265324_10017497 | |||
| 427 | Ga0265328_10027138 | |||
| 428 | Ga0265331_10005485 | |||
| 429 | Ga0265327_10000444 | |||
| 430 | Ga0307513_10119009 | |||
| 431 | Ga0307509_10019653 | |||
| 432 | Ga0307408_100129058 | |||
| 433 | Ga0307408_100158697 | |||
| 434 | Ga0307406_10136516 | |||
| 435 | Ga0307416_100151936 | |||
| 436 | Ga0373943_0230274 | |||
| 437 | Ga0373935_0006288 | |||
| 438 | Ga0373927_0013168 | |||
| 439 | Ga0373947_0075342 | |||
| 440 | Ga0373937_0092569 | |||
| 441 | Ga0373937_0519723 | |||
| 442 | Ga0373925_0152628 | |||
| 443 | Ga0373925_0229650 | |||
| 444 | Ga0395899_0009458 | |||
| 445 | Ga0395900_0054541 | |||
| 446 | Ga0395898_0031119 | |||
| 447 | Ga0395898_0210507 | |||
| 448 | Ga0395898_0289618 | |||
| 449 | Ga0395905_0021812 | |||
| 450 | Ga0436364_1261910 | |||
| 451 | Ga0395901_0048912 | |||
| 452 | Ga0395901_0291304 | |||
| 453 | Ga0395901_0870628 | |||
| 454 | Ga0436365_0232459 | |||
| 455 | Ga0436365_1734604 | |||
| 456 | Ga0436360_0464839 | |||
| 457 | Ga0436360_0700533 | |||
| 458 | Ga0436361_0813098 | |||
| 459 | Ga0436363_0768201 | |||
| 460 | Ga0436362_0483728 | |||
| 461 | Ga0439455_0026745 | |||
| 462 | Ga0450890_001539 | |||
| 463 | Ga0450890_006473 | |||
| 464 | Ga0450891_000032 | |||
| 465 | Ga0450892_003605 | |||
| 466 | Ga0450898_006357 | |||
| 467 | Ga0450889_000706 | |||
| 468 | Ga0439434_0060973 | |||
| 469 | Ga0439464_0006270 | |||
| 470 | Ga0450916_005151 | |||
| 471 | Ga0450893_0001485 | |||
| 472 | Ga0451577_0147130 | |||
| 473 | Ga0453683_0000971 | |||
| 474 | Ga0466961_0143014 | |||
| 475 | Ga0453684_0321405 | |||
| 476 | Ga0466957_0071863 | |||
| 477 | Ga0451576_0006552 | |||
| 478 | Ga0451576_0397148 | |||
| 479 | Ga0495617_000600 | |||
| 480 | Ga0495653_0031081 | |||
| 481 | Ga0495605_0008318 | |||
| 482 | Ga0495605_0020376 | |||
| 483 | Ga0495605_0058185 | |||
| 484 | Ga0495584_0000420 | |||
| 485 | Ga0495584_0003743 | |||
| 486 | Ga0495585_0000042 | |||
| 487 | Ga0495585_0022228 | |||
| 488 | Ga0495585_0028863 | |||
| 489 | Ga0495596_0003081 | |||
| 490 | Ga0495607_0011099 | |||
| 491 | Ga0495583_0000132 | |||
| 492 | Ga0495583_0000876 | |||
| 493 | Ga0495606_0017077 | |||
| 494 | Ga0495616_0007151 | |||
| 495 | Ga0495616_0007188 | |||
| 496 | Ga0495631_0014705 | |||
| 497 | Ga0495632_0000327 | |||
| 498 | Ga0495632_0003601 | |||
| 499 | Ga0495632_0020033 | |||
| 500 | Ga0495644_0001089 | |||
| 501 | Ga0495644_0059755 | |||
| 502 | Ga0495648_0000052 | |||
| 503 | Ga0495642_0000819 | |||
| 504 | Ga0495587_0054931 | |||
| 505 | Ga0495609_0034970 | |||
| 506 | Ga0495621_0007379 | |||
| 507 | Ga0495633_0009043 | |||
| 508 | Ga0495611_0015317 | |||
| 509 | Ga0495625_0199872 | |||
| 510 | Ga0495661_0032487 | |||
| 511 | Ga0495661_0106255 | |||
| 512 | Ga0495599_0160211 | |||
| 513 | Ga0495669_0003064 | |||
| 514 | Ga0495670_0029429 | |||
| 515 | Ga0495649_0001749 | |||
| 516 | Ga0495672_0024329 | |||
| 517 | Ga0495672_0107990 | |||
| 518 | Ga0495676_0359134 | |||
| 519 | Ga0495680_0041094 | |||
| 520 | Ga0495683_0007512 | |||
| 521 | Ga0495679_055050 | |||
| 522 | Ga0495681_0014274 | |||
| 523 | Ga0495686_0013392 | |||
| 524 | Ga0495626_0002284 | |||
| 525 | Ga0495626_0008476 | |||
| 526 | Ga0495626_0023380 | |||
| 527 | Ga0496100_0016590 | |||
| 528 | Ga0496102_0137888 | |||
| 529 | Ga0496102_0166133 | |||
| 530 | Ga0496103_0017468 | |||
| 531 | Ga0496103_0117530 | |||
| 532 | Ga0496103_0272579 | |||
| 533 | Ga0496104_0157218 | |||
| 534 | Ga0496105_0068168 | |||
| 535 | Ga0496106_0330452 | |||
| 536 | Ga0496107_0019702 | |||
| 537 | Ga0496109_0018344 | |||
| 538 | Ga0496109_0808432 | |||
| 539 | Ga0496114_0015404 | |||
| 540 | Ga0496115_0042425 | |||
| 541 | Ga0496121_0076460 | |||
| 542 | Ga0496124_0081684 | |||
| 543 | Ga0496126_0025844 | |||
| 544 | Ga0496126_0067061 | |||
| 545 | Ga0496126_0078583 | |||
| 546 | Ga0496126_0114123 | |||
| 547 | Ga0495678_004026 | |||
| 548 | Ga0501032_0246197 | |||
| 549 | Ga0501033_0047205 | |||
| 550 | Ga0501038_0152002 | |||
| 551 | Ga0501039_0217306 | |||
| 552 | Ga0501071_0055244 | |||
| 553 | Ga0501072_0056728 | |||
| 554 | Ga0501211_000894 | |||
| 555 | Ga0501221_001813 | |||
| 556 | nmdc:mga04h51_11508_c1 | |||
| 557 | nmdc:mga07m45_25871_c1 | |||
| 558 | nmdc:mga07m45_98547_c1 | |||
| 559 | nmdc:mga0qj67_328363_c1 | |||
| 560 | Ga0500562_004767 | |||
| 561 | Ga0500572_000343 | |||
| 562 | Ga0500559_0000552 | |||
| 563 | Ga0500616_0000304 | |||
| 564 | Ga0500622_0037821 | |||
| 565 | Ga0500645_004828 | |||
| 566 | Ga0500645_032684 | |||
| 567 | Ga0500596_000906 | |||
| 568 | Ga0590075_012502 | |||
| 569 | 2579856148 | |||
| 570 | 2619856821 | |||
| 571 | 2620352283 | |||
| 572 | 2626637688 | |||
| 573 | 2643741968 | |||
| 574 | 2643934112 | |||
| 575 | 2644261207 | |||
| 576 | 2644315599 | |||
| 577 | 2644339707 | |||
| 578 | 2854901896 | |||
| 579 | 8054917965 | |||
| 580 | 8054924924 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7j-assembly2.cif.gz_B | crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) | 0.8531 | 2 | 277 |
| 1ym5-assembly1.cif.gz_A-2 | crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. | 0.8525 | 1 | 277 |
| 1s7j-assembly2.cif.gz_B | crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) | 0.85 | 2 | 277 |
| 1ym5-assembly1.cif.gz_A-2 | crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. | 0.8497 | 1 | 277 |
| 1xub-assembly1.cif.gz_A-2 | structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens | 0.8453 | 4 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8NIL3_2_111_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9574 | 1 | 109 | 3.10.310.10 |
| 1u1vA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9347 | 5 | 111 | 3.10.310.10 |
| af_Q8NIL3_2_111_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9322 | 1 | 109 | 3.10.310.10 |
| 1s7jA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9284 | 2 | 119 | 3.10.310.10 |
| 1sdjA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9198 | 4 | 111 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848Y365-F1-model_v4 | PhzF family phenazine biosynthesis protein | 0.9884 | 1 | 102 |
GO:0005737
GO:0009058 GO:0016853 |
| AF-A0A4U9HFZ8-F1-model_v4 | Trans-2,3-dihydro-3-hydroxyanthranilate isomerase (EC 5.3.3.17) | 0.9882 | 1 | 111 |
GO:0005737
GO:0009058 GO:0102943 |
| AF-A0A7X7G9G2-F1-model_v4 | PhzF family phenazine biosynthesis protein | 0.9874 | 1 | 73 |
GO:0005737
GO:0009058 GO:0016853 |
| AF-A0A4P5V4H8-F1-model_v4 | PhzF family phenazine biosynthesis protein | 0.9855 | 1 | 95 |
GO:0005737
GO:0009058 GO:0016853 |
| AF-A0A2H5YTQ5-F1-model_v4 | Putative isomerase YddE (EC 5.1.-.-) | 0.9832 | 37 | 277 |
GO:0005737
GO:0009058 GO:0016853 |