F389978

General Info

Members Datasets Scaffolds Average Seq Length
290 218 580 278

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0000144|Ga0495670_0000144_29992_30954
Length 320
Sequence METFQYTDIRRCRLCALFQKPLQFTIHYLPATAKARSHMVNSRKFHQLDVFTDTPYKGNPLAVVHDAQGLSDEQMASFARWTNLSETTFLLPPTDAAADYRVRIFTPGSELPFAGHPTLGSCSAWLRAGGVARQGDTIVQECGVGLVSIRRDGERLAFAAPPLRRTGPVDQTSLEQIARALGLADDEIVAHQWVDNGPGWCALMLDSAERVLSVRPDMAALGDFRVGIVAPQPAGSDTDFEVRVFVPSFGIPEDPVTGSLNAGLGQWLIGAGMAADSYVATQGTALGRAGKVFIDRIGDDIWVGGEVVRCIEGTVDFPEA

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
127 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
128 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
129 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
130 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
134 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
195 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
208 2619618881 Frankia sp. ACN1ag Isolate Unclassified
209 2619619003 Frankia sp. CpI1-P Isolate Nodule
210 2626541554 Frankia sp. AvcI.1 Isolate Nodule
211 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
212 2643221585 Pelomonas sp. Root662 Isolate Unclassified
213 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
214 2643221656 Pelomonas sp. Root405 Isolate Unclassified
215 2643221660 Methylibium sp. Root1272 Isolate Unclassified
216 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
217 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
218 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 1.38
Rhizoplane 4.83
Rhizosphere 80.34
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0000144 3300046691 Bacteria 31081
2 rootL2_10033738 3300003322 Bacteria 2571
3 Ga0065707_10091040 3300005295 Bacteria 4017
4 Ga0070680_100036538 3300005336 Bacteria 3968
5 Ga0070691_10011107 3300005341 Bacteria 4110
6 Ga0070692_10007518 3300005345 Bacteria 4802
7 Ga0070674_100233008 3300005356 Bacteria 1438
8 Ga0070703_10058872 3300005406 Bacteria 1251
9 Ga0070709_10000542 3300005434 Bacteria 22119
10 Ga0070709_10000759 3300005434 Bacteria 18219
11 Ga0070709_10014082 3300005434 Bacteria 4515
12 Ga0070709_10052051 3300005434 Bacteria 2571
13 Ga0070714_100014422 3300005435 Bacteria 6348
14 Ga0070714_100074677 3300005435 Bacteria 2940
15 Ga0070713_100001573 3300005436 Bacteria 14603
16 Ga0070713_100057137 3300005436 Bacteria 3247
17 Ga0070713_100151569 3300005436 Bacteria 2063
18 Ga0070710_10000642 3300005437 Bacteria 16650
19 Ga0070710_10007769 3300005437 Bacteria 5204
20 Ga0070710_10029113 3300005437 Bacteria 2960
21 Ga0070710_10078972 3300005437 Bacteria 1916
22 Ga0070701_10009528 3300005438 Bacteria 4258
23 Ga0070711_100001693 3300005439 Bacteria 12214
24 Ga0070711_100021990 3300005439 Bacteria 4129
25 Ga0070711_100025420 3300005439 Bacteria 3874
26 Ga0070700_100151899 3300005441 Bacteria 1585
27 Ga0070694_100132409 3300005444 Bacteria 1803
28 Ga0070708_100134125 3300005445 Bacteria 2293
29 Ga0070678_100029953 3300005456 Bacteria 3734
30 Ga0070678_100569303 3300005456 Bacteria 1008
31 Ga0070681_10016302 3300005458 Bacteria 7414
32 Ga0070706_100008899 3300005467 Bacteria 9349
33 Ga0070707_100070011 3300005468 Bacteria 3379
34 Ga0070679_100069266 3300005530 Bacteria 3519
35 Ga0070672_100066235 3300005543 Bacteria 2860
36 Ga0070672_100426315 3300005543 Bacteria 1140
37 Ga0070686_100391097 3300005544 Bacteria 1055
38 Ga0070695_100008563 3300005545 Bacteria 6075
39 Ga0070695_100117789 3300005545 Bacteria 1813
40 Ga0070695_100278712 3300005545 Bacteria 1228
41 Ga0070704_100110314 3300005549 Bacteria 2092
42 Ga0070704_100225237 3300005549 Bacteria 1527
43 Ga0068855_100125524 3300005563 Bacteria 2935
44 Ga0068857_100264116 3300005577 Bacteria 1581
45 Ga0068856_100014667 3300005614 Bacteria 7564
46 Ga0070702_100009046 3300005615 Bacteria 4855
47 Ga0068859_100130041 3300005617 Bacteria 2589
48 Ga0068861_100234619 3300005719 Bacteria 1557
49 Ga0068860_100033675 3300005843 Bacteria 4915
50 Ga0068860_100377480 3300005843 Bacteria 1399
51 Ga0068860_100473072 3300005843 Bacteria 1248
52 Ga0068862_100024260 3300005844 Bacteria 5088
53 Ga0081540_1017537 3300005983 Bacteria 4428
54 Ga0070717_10014565 3300006028 Bacteria 6053
55 Ga0075368_10013931 3300006042 Bacteria 2960
56 Ga0075368_10143446 3300006042 Bacteria 996
57 Ga0075363_100033838 3300006048 Bacteria 2665
58 Ga0075364_10000451 3300006051 Bacteria 20676
59 Ga0070715_10000661 3300006163 Bacteria 9217
60 Ga0070716_100000192 3300006173 Bacteria 24137
61 Ga0070712_100001218 3300006175 Bacteria 15564
62 Ga0070712_100013507 3300006175 Bacteria 5221
63 Ga0070712_100015526 3300006175 Bacteria 4909
64 Ga0075367_10062323 3300006178 Bacteria 2227
65 Ga0097621_100109605 3300006237 Bacteria 2332
66 Ga0068871_100005095 3300006358 Bacteria 9179
67 Ga0075430_100183547 3300006846 Bacteria 1740
68 Ga0075430_100313776 3300006846 Bacteria 1296
69 Ga0075429_100295268 3300006880 Bacteria 1419
70 Ga0097620_100130038 3300006931 Bacteria 2589
71 Ga0105245_10382025 3300009098 Bacteria 1403
72 Ga0105247_10019501 3300009101 Bacteria 4072
73 Ga0105243_10079049 3300009148 Bacteria 2680
74 Ga0105241_10010216 3300009174 Bacteria 6895
75 Ga0105242_10153090 3300009176 Bacteria 2012
76 Ga0105242_10389371 3300009176 Bacteria 1298
77 Ga0105248_10027637 3300009177 Bacteria 6318
78 Ga0105237_10249510 3300009545 Bacteria 1777
79 Ga0105238_10132088 3300009551 Bacteria 2475
80 Ga0105239_10351473 3300010375 Bacteria 1664
81 Ga0157378_10046861 3300013297 Bacteria 3842
82 Ga0157375_10061452 3300013308 Bacteria 3730
83 Ga0157380_10001019 3300014326 Bacteria 17838
84 Ga0157380_10087563 3300014326 Bacteria 2561
85 Ga0157379_10049707 3300014968 Bacteria 3744
86 Ga0157376_10743714 3300014969 Bacteria 989
87 Ga0163161_10112657 3300017792 Bacteria 2035
88 Ga0213872_10000122 3300021361 Bacteria 73335
89 Ga0213876_10004130 3300021384 Bacteria 8156
90 Ga0207692_10000462 3300025898 Bacteria 14350
91 Ga0207692_10119485 3300025898 Bacteria 1473
92 Ga0207692_10176668 3300025898 Bacteria 1241
93 Ga0207680_10184259 3300025903 Bacteria 1414
94 Ga0207685_10002846 3300025905 Bacteria 4070
95 Ga0207699_10001105 3300025906 Bacteria 12742
96 Ga0207699_10007020 3300025906 Bacteria 5487
97 Ga0207699_10017411 3300025906 Bacteria 3780
98 Ga0207699_10195287 3300025906 Bacteria 1368
99 Ga0207705_10196702 3300025909 Bacteria 1526
100 Ga0207684_10009791 3300025910 Bacteria 8454
101 Ga0207654_10079917 3300025911 Bacteria 1965
102 Ga0207707_10001660 3300025912 Bacteria 20546
103 Ga0207693_10000354 3300025915 Bacteria 42162
104 Ga0207693_10002055 3300025915 Bacteria 17603
105 Ga0207693_10071194 3300025915 Bacteria 2721
106 Ga0207663_10006117 3300025916 Bacteria 6125
107 Ga0207663_10024924 3300025916 Bacteria 3450
108 Ga0207660_10039945 3300025917 Bacteria 3282
109 Ga0207652_10010980 3300025921 Bacteria 7302
110 Ga0207652_10375663 3300025921 Bacteria 1283
111 Ga0207687_10312539 3300025927 Bacteria 1269
112 Ga0207700_10001688 3300025928 Bacteria 12531
113 Ga0207700_10129188 3300025928 Bacteria 2060
114 Ga0207664_10002322 3300025929 Bacteria 12570
115 Ga0207686_10317510 3300025934 Bacteria 1163
116 Ga0207665_10000042 3300025939 Bacteria 82783
117 Ga0207711_10082575 3300025941 Bacteria 2809
118 Ga0207667_10195215 3300025949 Bacteria 2077
119 Ga0207678_10035065 3300026067 Bacteria 4368
120 Ga0207708_10008214 3300026075 Bacteria 7732
121 Ga0207702_10022922 3300026078 Bacteria 5180
122 Ga0207648_10293709 3300026089 Bacteria 1456
123 Ga0207674_10204985 3300026116 Bacteria 1921
124 Ga0207675_100010010 3300026118 Bacteria 8885
125 Ga0207675_100054012 3300026118 Bacteria 3748
126 Ga0207683_10007560 3300026121 Bacteria 9311
127 Ga0207683_10600992 3300026121 Bacteria 1018
128 Ga0268265_10032470 3300028380 Bacteria 3784
129 Ga0268264_10070867 3300028381 Bacteria 2951
130 Ga0268264_10544624 3300028381 Bacteria 1137
131 Ga0265334_10007123 3300028573 Bacteria 4797
132 Ga0265318_10009409 3300028577 Bacteria 4297
133 Ga0265323_10003886 3300028653 Bacteria 6500
134 Ga0307515_10156325 3300028794 Bacteria 2351
135 Ga0265338_10002598 3300028800 Bacteria 26701
136 Ga0265324_10017497 3300029957 Bacteria 2606
137 Ga0265328_10027138 3300031239 Bacteria 2147
138 Ga0265331_10005485 3300031250 Bacteria 7657
139 Ga0265327_10000444 3300031251 Bacteria 74908
140 Ga0307513_10119009 3300031456 Bacteria 2614
141 Ga0307509_10019653 3300031507 Bacteria 7696
142 Ga0307408_100129058 3300031548 Bacteria 1970
143 Ga0307408_100158697 3300031548 Bacteria 1794
144 Ga0307406_10136516 3300031901 Bacteria 1730
145 Ga0307416_100151936 3300032002 Bacteria 2125
146 Ga0373943_0230274 3300035170 Bacteria 1035
147 Ga0373935_0006288 3300035692 Bacteria 7075
148 Ga0373927_0013168 3300035695 Bacteria 5501
149 Ga0373947_0075342 3300035725 Bacteria 2077
150 Ga0373937_0092569 3300036401 Bacteria 2802
151 Ga0373937_0519723 3300036401 Bacteria 1131
152 Ga0373925_0152628 3300037068 Bacteria 1815
153 Ga0373925_0229650 3300037068 Bacteria 1483
154 Ga0395899_0009458 3300037312 Bacteria 7481
155 Ga0395900_0054541 3300037418 Bacteria 4115
156 Ga0395898_0031119 3300037466 Bacteria 5336
157 Ga0395898_0210507 3300037466 Bacteria 1855
158 Ga0395898_0289618 3300037466 Bacteria 1562
159 Ga0395905_0021812 3300037471 Bacteria 6057
160 Ga0436364_1261910 3300037853 Bacteria 1352
161 Ga0395901_0048912 3300038443 Bacteria 4391
162 Ga0395901_0291304 3300038443 Bacteria 1694
163 Ga0395901_0870628 3300038443 Bacteria 885
164 Ga0436365_0232459 3300039437 Bacteria 11864
165 Ga0436365_1734604 3300039437 Bacteria 959
166 Ga0436360_0464839 3300039438 Unclassified 1058
167 Ga0436360_0700533 3300039438 Bacteria 932
168 Ga0436361_0813098 3300039447 Bacteria 136133
169 Ga0436363_0768201 3300039450 Bacteria 2125
170 Ga0436362_0483728 3300039453 Bacteria 1992
171 Ga0439455_0026745 3300042012 Bacteria 1410
172 Ga0450890_001539 3300042127 Bacteria 3312
173 Ga0450890_006473 3300042127 Bacteria 1498
174 Ga0450891_000032 3300042129 Bacteria 9877
175 Ga0450892_003605 3300042130 Bacteria 1271
176 Ga0450898_006357 3300042134 Bacteria 1811
177 Ga0450889_000706 3300042144 Bacteria 3613
178 Ga0439434_0060973 3300042435 Bacteria 1179
179 Ga0439464_0006270 3300042439 Bacteria 3095
180 Ga0450916_005151 3300042530 Bacteria 1503
181 Ga0450893_0001485 3300042532 Bacteria 3601
182 Ga0451577_0147130 3300042876 Bacteria 2119
183 Ga0453683_0000971 3300044673 Bacteria 27149
184 Ga0466961_0143014 3300044693 Bacteria 1497
185 Ga0453684_0321405 3300044712 Bacteria 1753
186 Ga0466957_0071863 3300044842 Bacteria 2141
187 Ga0451576_0006552 3300045051 Bacteria 14247
188 Ga0451576_0397148 3300045051 Bacteria 1445
189 Ga0495617_000600 3300046452 Bacteria 18290
190 Ga0495653_0031081 3300046463 Bacteria 4247
191 Ga0495605_0008318 3300046474 Bacteria 5865
192 Ga0495605_0020376 3300046474 Bacteria 3525
193 Ga0495605_0058185 3300046474 Bacteria 1858
194 Ga0495584_0000420 3300046491 Bacteria 29241
195 Ga0495584_0003743 3300046491 Bacteria 8287
196 Ga0495585_0000042 3300046492 Bacteria 125286
197 Ga0495585_0022228 3300046492 Bacteria 3641
198 Ga0495585_0028863 3300046492 Bacteria 3161
199 Ga0495596_0003081 3300046500 Bacteria 8611
200 Ga0495607_0011099 3300046501 Bacteria 6012
201 Ga0495583_0000132 3300046506 Bacteria 125343
202 Ga0495583_0000876 3300046506 Bacteria 36500
203 Ga0495606_0017077 3300046507 Bacteria 5504
204 Ga0495616_0007151 3300046513 Bacteria 6695
205 Ga0495616_0007188 3300046513 Bacteria 6674
206 Ga0495631_0014705 3300046518 Bacteria 3770
207 Ga0495632_0000327 3300046519 Bacteria 45721
208 Ga0495632_0003601 3300046519 Bacteria 10900
209 Ga0495632_0020033 3300046519 Bacteria 3632
210 Ga0495644_0001089 3300046523 Bacteria 11239
211 Ga0495644_0059755 3300046523 Bacteria 1433
212 Ga0495648_0000052 3300046524 Bacteria 162169
213 Ga0495642_0000819 3300046528 Bacteria 14989
214 Ga0495587_0054931 3300046536 Bacteria 2346
215 Ga0495609_0034970 3300046538 Bacteria 2276
216 Ga0495621_0007379 3300046539 Bacteria 3253
217 Ga0495633_0009043 3300046558 Bacteria 5540
218 Ga0495611_0015317 3300046648 Bacteria 3277
219 Ga0495625_0199872 3300046660 Bacteria 1320
220 Ga0495661_0032487 3300046665 Bacteria 3298
221 Ga0495661_0106255 3300046665 Bacteria 1571
222 Ga0495599_0160211 3300046678 Bacteria 1391
223 Ga0495669_0003064 3300046684 Bacteria 6873
224 Ga0495670_0029429 3300046691 Bacteria 2726
225 Ga0495649_0001749 3300046694 Bacteria 16031
226 Ga0495672_0024329 3300047320 Bacteria 3904
227 Ga0495672_0107990 3300047320 Bacteria 1498
228 Ga0495676_0359134 3300047321 Bacteria 973
229 Ga0495680_0041094 3300047322 Bacteria 3678
230 Ga0495683_0007512 3300047323 Bacteria 5885
231 Ga0495679_055050 3300047446 Unclassified 1182
232 Ga0495681_0014274 3300047470 Bacteria 4561
233 Ga0495686_0013392 3300047472 Bacteria 5691
234 Ga0495626_0002284 3300048091 Bacteria 13628
235 Ga0495626_0008476 3300048091 Bacteria 5631
236 Ga0495626_0023380 3300048091 Unclassified 3044
237 Ga0496100_0016590 3300048903 Bacteria 4328
238 Ga0496102_0137888 3300048905 Bacteria 2286
239 Ga0496102_0166133 3300048905 Bacteria 2076
240 Ga0496103_0017468 3300048906 Bacteria 4293
241 Ga0496103_0117530 3300048906 Bacteria 1693
242 Ga0496103_0272579 3300048906 Bacteria 1089
243 Ga0496104_0157218 3300048907 Bacteria 2181
244 Ga0496105_0068168 3300048908 Bacteria 2938
245 Ga0496106_0330452 3300048909 Bacteria 1224
246 Ga0496107_0019702 3300048910 Bacteria 4760
247 Ga0496109_0018344 3300048912 Bacteria 6147
248 Ga0496109_0808432 3300048912 Bacteria 875
249 Ga0496114_0015404 3300048917 Bacteria 6149
250 Ga0496115_0042425 3300048918 Bacteria 3624
251 Ga0496121_0076460 3300048924 Bacteria 2669
252 Ga0496124_0081684 3300048927 Bacteria 2655
253 Ga0496126_0025844 3300048929 Bacteria 5641
254 Ga0496126_0067061 3300048929 Bacteria 3207
255 Ga0496126_0078583 3300048929 Bacteria 2923
256 Ga0496126_0114123 3300048929 Bacteria 2351
257 Ga0495678_004026 3300049459 Bacteria 8747
258 Ga0501032_0246197 3300049569 Bacteria 1161
259 Ga0501033_0047205 3300049570 Bacteria 3202
260 Ga0501038_0152002 3300049574 Bacteria 1887
261 Ga0501039_0217306 3300049575 Bacteria 1503
262 Ga0501071_0055244 3300049587 Bacteria 2866
263 Ga0501072_0056728 3300049588 Bacteria 3086
264 Ga0501211_000894 3300049658 Bacteria 3119
265 Ga0501221_001813 3300049704 Bacteria 3568
266 nmdc:mga04h51_11508_c1 3300050495 Bacteria 2457
267 nmdc:mga07m45_25871_c1 3300050496 Bacteria 3223
268 nmdc:mga07m45_98547_c1 3300050496 Bacteria 1678
269 nmdc:mga0qj67_328363_c1 3300050509 Bacteria 1238
270 Ga0500562_004767 3300053108 Bacteria 3415
271 Ga0500572_000343 3300053111 Bacteria 16647
272 Ga0500559_0000552 3300053136 Bacteria 25939
273 Ga0500616_0000304 3300053153 Bacteria 71131
274 Ga0500622_0037821 3300053156 Bacteria 2520
275 Ga0500645_004828 3300053730 Bacteria 5086
276 Ga0500645_032684 3300053730 Bacteria 1559
277 Ga0500596_000906 3300053735 Bacteria 5925
278 Ga0590075_012502 3300059424 Bacteria 2063
279 2579856148 2579778521 Bacteria 7624758
280 2619856821 2619618881 Bacteria 7521104
281 2620352283 2619619003 Bacteria 7619552
282 2626637688 2626541554 Bacteria 7741902
283 2643741968 2643221544 Bacteria 5886209
284 2643934112 2643221585 Bacteria 5812563
285 2644261207 2643221646 Bacteria 6433402
286 2644315599 2643221656 Bacteria 5809961
287 2644339707 2643221660 Bacteria 4208257
288 2854901896 2854896431 Bacteria 5869725
289 8054917965 8054913762 Bacteria 7713009
290 8054924924 8054920844 Bacteria 7068637
291 Ga0495670_0000144
292 rootL2_10033738
293 Ga0065707_10091040
294 Ga0070680_100036538
295 Ga0070691_10011107
296 Ga0070692_10007518
297 Ga0070674_100233008
298 Ga0070703_10058872
299 Ga0070709_10000542
300 Ga0070709_10000759
301 Ga0070709_10014082
302 Ga0070709_10052051
303 Ga0070714_100014422
304 Ga0070714_100074677
305 Ga0070713_100001573
306 Ga0070713_100057137
307 Ga0070713_100151569
308 Ga0070710_10000642
309 Ga0070710_10007769
310 Ga0070710_10029113
311 Ga0070710_10078972
312 Ga0070701_10009528
313 Ga0070711_100001693
314 Ga0070711_100021990
315 Ga0070711_100025420
316 Ga0070700_100151899
317 Ga0070694_100132409
318 Ga0070708_100134125
319 Ga0070678_100029953
320 Ga0070678_100569303
321 Ga0070681_10016302
322 Ga0070706_100008899
323 Ga0070707_100070011
324 Ga0070679_100069266
325 Ga0070672_100066235
326 Ga0070672_100426315
327 Ga0070686_100391097
328 Ga0070695_100008563
329 Ga0070695_100117789
330 Ga0070695_100278712
331 Ga0070704_100110314
332 Ga0070704_100225237
333 Ga0068855_100125524
334 Ga0068857_100264116
335 Ga0068856_100014667
336 Ga0070702_100009046
337 Ga0068859_100130041
338 Ga0068861_100234619
339 Ga0068860_100033675
340 Ga0068860_100377480
341 Ga0068860_100473072
342 Ga0068862_100024260
343 Ga0081540_1017537
344 Ga0070717_10014565
345 Ga0075368_10013931
346 Ga0075368_10143446
347 Ga0075363_100033838
348 Ga0075364_10000451
349 Ga0070715_10000661
350 Ga0070716_100000192
351 Ga0070712_100001218
352 Ga0070712_100013507
353 Ga0070712_100015526
354 Ga0075367_10062323
355 Ga0097621_100109605
356 Ga0068871_100005095
357 Ga0075430_100183547
358 Ga0075430_100313776
359 Ga0075429_100295268
360 Ga0097620_100130038
361 Ga0105245_10382025
362 Ga0105247_10019501
363 Ga0105243_10079049
364 Ga0105241_10010216
365 Ga0105242_10153090
366 Ga0105242_10389371
367 Ga0105248_10027637
368 Ga0105237_10249510
369 Ga0105238_10132088
370 Ga0105239_10351473
371 Ga0157378_10046861
372 Ga0157375_10061452
373 Ga0157380_10001019
374 Ga0157380_10087563
375 Ga0157379_10049707
376 Ga0157376_10743714
377 Ga0163161_10112657
378 Ga0213872_10000122
379 Ga0213876_10004130
380 Ga0207692_10000462
381 Ga0207692_10119485
382 Ga0207692_10176668
383 Ga0207680_10184259
384 Ga0207685_10002846
385 Ga0207699_10001105
386 Ga0207699_10007020
387 Ga0207699_10017411
388 Ga0207699_10195287
389 Ga0207705_10196702
390 Ga0207684_10009791
391 Ga0207654_10079917
392 Ga0207707_10001660
393 Ga0207693_10000354
394 Ga0207693_10002055
395 Ga0207693_10071194
396 Ga0207663_10006117
397 Ga0207663_10024924
398 Ga0207660_10039945
399 Ga0207652_10010980
400 Ga0207652_10375663
401 Ga0207687_10312539
402 Ga0207700_10001688
403 Ga0207700_10129188
404 Ga0207664_10002322
405 Ga0207686_10317510
406 Ga0207665_10000042
407 Ga0207711_10082575
408 Ga0207667_10195215
409 Ga0207678_10035065
410 Ga0207708_10008214
411 Ga0207702_10022922
412 Ga0207648_10293709
413 Ga0207674_10204985
414 Ga0207675_100010010
415 Ga0207675_100054012
416 Ga0207683_10007560
417 Ga0207683_10600992
418 Ga0268265_10032470
419 Ga0268264_10070867
420 Ga0268264_10544624
421 Ga0265334_10007123
422 Ga0265318_10009409
423 Ga0265323_10003886
424 Ga0307515_10156325
425 Ga0265338_10002598
426 Ga0265324_10017497
427 Ga0265328_10027138
428 Ga0265331_10005485
429 Ga0265327_10000444
430 Ga0307513_10119009
431 Ga0307509_10019653
432 Ga0307408_100129058
433 Ga0307408_100158697
434 Ga0307406_10136516
435 Ga0307416_100151936
436 Ga0373943_0230274
437 Ga0373935_0006288
438 Ga0373927_0013168
439 Ga0373947_0075342
440 Ga0373937_0092569
441 Ga0373937_0519723
442 Ga0373925_0152628
443 Ga0373925_0229650
444 Ga0395899_0009458
445 Ga0395900_0054541
446 Ga0395898_0031119
447 Ga0395898_0210507
448 Ga0395898_0289618
449 Ga0395905_0021812
450 Ga0436364_1261910
451 Ga0395901_0048912
452 Ga0395901_0291304
453 Ga0395901_0870628
454 Ga0436365_0232459
455 Ga0436365_1734604
456 Ga0436360_0464839
457 Ga0436360_0700533
458 Ga0436361_0813098
459 Ga0436363_0768201
460 Ga0436362_0483728
461 Ga0439455_0026745
462 Ga0450890_001539
463 Ga0450890_006473
464 Ga0450891_000032
465 Ga0450892_003605
466 Ga0450898_006357
467 Ga0450889_000706
468 Ga0439434_0060973
469 Ga0439464_0006270
470 Ga0450916_005151
471 Ga0450893_0001485
472 Ga0451577_0147130
473 Ga0453683_0000971
474 Ga0466961_0143014
475 Ga0453684_0321405
476 Ga0466957_0071863
477 Ga0451576_0006552
478 Ga0451576_0397148
479 Ga0495617_000600
480 Ga0495653_0031081
481 Ga0495605_0008318
482 Ga0495605_0020376
483 Ga0495605_0058185
484 Ga0495584_0000420
485 Ga0495584_0003743
486 Ga0495585_0000042
487 Ga0495585_0022228
488 Ga0495585_0028863
489 Ga0495596_0003081
490 Ga0495607_0011099
491 Ga0495583_0000132
492 Ga0495583_0000876
493 Ga0495606_0017077
494 Ga0495616_0007151
495 Ga0495616_0007188
496 Ga0495631_0014705
497 Ga0495632_0000327
498 Ga0495632_0003601
499 Ga0495632_0020033
500 Ga0495644_0001089
501 Ga0495644_0059755
502 Ga0495648_0000052
503 Ga0495642_0000819
504 Ga0495587_0054931
505 Ga0495609_0034970
506 Ga0495621_0007379
507 Ga0495633_0009043
508 Ga0495611_0015317
509 Ga0495625_0199872
510 Ga0495661_0032487
511 Ga0495661_0106255
512 Ga0495599_0160211
513 Ga0495669_0003064
514 Ga0495670_0029429
515 Ga0495649_0001749
516 Ga0495672_0024329
517 Ga0495672_0107990
518 Ga0495676_0359134
519 Ga0495680_0041094
520 Ga0495683_0007512
521 Ga0495679_055050
522 Ga0495681_0014274
523 Ga0495686_0013392
524 Ga0495626_0002284
525 Ga0495626_0008476
526 Ga0495626_0023380
527 Ga0496100_0016590
528 Ga0496102_0137888
529 Ga0496102_0166133
530 Ga0496103_0017468
531 Ga0496103_0117530
532 Ga0496103_0272579
533 Ga0496104_0157218
534 Ga0496105_0068168
535 Ga0496106_0330452
536 Ga0496107_0019702
537 Ga0496109_0018344
538 Ga0496109_0808432
539 Ga0496114_0015404
540 Ga0496115_0042425
541 Ga0496121_0076460
542 Ga0496124_0081684
543 Ga0496126_0025844
544 Ga0496126_0067061
545 Ga0496126_0078583
546 Ga0496126_0114123
547 Ga0495678_004026
548 Ga0501032_0246197
549 Ga0501033_0047205
550 Ga0501038_0152002
551 Ga0501039_0217306
552 Ga0501071_0055244
553 Ga0501072_0056728
554 Ga0501211_000894
555 Ga0501221_001813
556 nmdc:mga04h51_11508_c1
557 nmdc:mga07m45_25871_c1
558 nmdc:mga07m45_98547_c1
559 nmdc:mga0qj67_328363_c1
560 Ga0500562_004767
561 Ga0500572_000343
562 Ga0500559_0000552
563 Ga0500616_0000304
564 Ga0500622_0037821
565 Ga0500645_004828
566 Ga0500645_032684
567 Ga0500596_000906
568 Ga0590075_012502
569 2579856148
570 2619856821
571 2620352283
572 2626637688
573 2643741968
574 2643934112
575 2644261207
576 2644315599
577 2644339707
578 2854901896
579 8054917965
580 8054924924

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

48

313

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.8531 2 277
1ym5-assembly1.cif.gz_A-2 crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. 0.8525 1 277
1s7j-assembly2.cif.gz_B crystal structure of phenazine biosynthesis protein phzf family (enterococcus faecalis) 0.85 2 277
1ym5-assembly1.cif.gz_A-2 crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. 0.8497 1 277
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8453 4 277
ID Description Score Start End Superfamily
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9574 1 109 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9347 5 111 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9322 1 109 3.10.310.10
1s7jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9284 2 119 3.10.310.10
1sdjA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9198 4 111 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A848Y365-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9884 1 102 GO:0005737
GO:0009058
GO:0016853
AF-A0A4U9HFZ8-F1-model_v4 Trans-2,3-dihydro-3-hydroxyanthranilate isomerase (EC 5.3.3.17) 0.9882 1 111 GO:0005737
GO:0009058
GO:0102943
AF-A0A7X7G9G2-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9874 1 73 GO:0005737
GO:0009058
GO:0016853
AF-A0A4P5V4H8-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9855 1 95 GO:0005737
GO:0009058
GO:0016853
AF-A0A2H5YTQ5-F1-model_v4 Putative isomerase YddE (EC 5.1.-.-) 0.9832 37 277 GO:0005737
GO:0009058
GO:0016853

Map