F389879

General Info

Members Datasets Scaffolds Average Seq Length
290 139 290 153

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0270327|Ga0436364_0270327_92_589
Length 165
Sequence VTGGRRYRLGQTLREETMPVSRRDLAALALTASLLSHTASAASEEGGVGDAVEALRKAILGQNKAELEKLTAEKLSYGHSSAVVQDKAEFVNGVMTRKGTVKLIEFSEMKISLAGDVAIVRHLWHSEGEMDGKPQSVKIGVLGVWHRRGGEWKLLARQGYKLPAA

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 3.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 96.9
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1064145 3300003163 Unclassified 529
2 Ga0007409J51694_1055957 3300003575 Unclassified 647
3 Ga0007416J51690_1052693 3300003577 Unclassified 539
4 Ga0058861_11178504 3300004800 Bacteria 836
5 Ga0058862_10644631 3300004803 Bacteria 706
6 Ga0065712_10248643 3300005290 Bacteria 965
7 Ga0065712_10364567 3300005290 Bacteria 771
8 Ga0070683_101126801 3300005329 Bacteria 754
9 Ga0070690_100049559 3300005330 Bacteria 2678
10 Ga0070690_100664020 3300005330 Bacteria 797
11 Ga0070670_100495682 3300005331 Bacteria 1086
12 Ga0070670_101593650 3300005331 Unclassified 600
13 Ga0070677_10426865 3300005333 Bacteria 704
14 Ga0068869_100095928 3300005334 Bacteria 2238
15 Ga0070680_100010492 3300005336 Bacteria 7144
16 Ga0070689_100263500 3300005340 Bacteria 1425
17 Ga0070691_10667109 3300005341 Bacteria 621
18 Ga0070674_101310070 3300005356 Bacteria 646
19 Ga0070709_10104903 3300005434 Bacteria 1890
20 Ga0070714_100061258 3300005435 Bacteria 3231
21 Ga0070714_101014731 3300005435 Bacteria 807
22 Ga0070713_100123197 3300005436 Bacteria 2276
23 Ga0070713_100167372 3300005436 Bacteria 1966
24 Ga0070713_100194764 3300005436 Bacteria 1828
25 Ga0070713_100223669 3300005436 Bacteria 1708
26 Ga0070710_10168398 3300005437 Unclassified 1363
27 Ga0070710_10191704 3300005437 Bacteria 1286
28 Ga0070711_100337292 3300005439 Bacteria 1208
29 Ga0070711_100500764 3300005439 Unclassified 1001
30 Ga0070711_100905820 3300005439 Bacteria 753
31 Ga0070700_100486909 3300005441 Bacteria 946
32 Ga0070694_100124735 3300005444 Bacteria 1852
33 Ga0070694_100545438 3300005444 Unclassified 928
34 Ga0070708_100049978 3300005445 Bacteria 3701
35 Ga0070708_100095190 3300005445 Bacteria 2718
36 Ga0070708_100097375 3300005445 Bacteria 2689
37 Ga0070708_101059244 3300005445 Unclassified 760
38 Ga0070681_10064246 3300005458 Bacteria 3642
39 Ga0070681_10680411 3300005458 Unclassified 944
40 Ga0068867_101253109 3300005459 Bacteria 683
41 Ga0070706_100106971 3300005467 Bacteria 2602
42 Ga0070706_100634891 3300005467 Bacteria 992
43 Ga0070706_100973229 3300005467 Unclassified 783
44 Ga0070707_100009340 3300005468 Bacteria 9103
45 Ga0070707_100012064 3300005468 Bacteria 8066
46 Ga0070707_100091403 3300005468 Bacteria 2946
47 Ga0070707_100106628 3300005468 Unclassified 2718
48 Ga0070707_100112454 3300005468 Bacteria 2641
49 Ga0070707_100125370 3300005468 Bacteria 2494
50 Ga0070707_100918699 3300005468 Unclassified 840
51 Ga0070698_100120830 3300005471 Bacteria 2580
52 Ga0070698_100868760 3300005471 Bacteria 847
53 Ga0070698_101060113 3300005471 Unclassified 759
54 Ga0070699_100155829 3300005518 Bacteria 2021
55 Ga0070699_100252971 3300005518 Bacteria 1574
56 Ga0070699_100499808 3300005518 Bacteria 1104
57 Ga0070679_100144268 3300005530 Bacteria 2359
58 Ga0070697_100060085 3300005536 Bacteria 3097
59 Ga0070697_100383334 3300005536 Bacteria 1218
60 Ga0070697_100630335 3300005536 Bacteria 943
61 Ga0070697_100952327 3300005536 Unclassified 762
62 Ga0070686_100536646 3300005544 Bacteria 913
63 Ga0070695_100036924 3300005545 Bacteria 3077
64 Ga0070695_100486673 3300005545 Bacteria 952
65 Ga0070695_100564294 3300005545 Unclassified 889
66 Ga0070696_100573186 3300005546 Bacteria 907
67 Ga0070696_100613590 3300005546 Bacteria 878
68 Ga0070696_100772648 3300005546 Unclassified 789
69 Ga0070693_100117348 3300005547 Bacteria 1646
70 Ga0070704_100170668 3300005549 Bacteria 1730
71 Ga0070704_101345262 3300005549 Unclassified 654
72 Ga0068854_100983508 3300005578 Bacteria 746
73 Ga0070702_100083469 3300005615 Bacteria 1919
74 Ga0068859_100071804 3300005617 Bacteria 3497
75 Ga0068866_10238599 3300005718 Bacteria 1106
76 Ga0068861_101195448 3300005719 Bacteria 735
77 Ga0068863_101114537 3300005841 Bacteria 794
78 Ga0068860_100151776 3300005843 Bacteria 2231
79 Ga0068862_100127172 3300005844 Bacteria 2251
80 Ga0068862_100872625 3300005844 Bacteria 883
81 Ga0081540_1174316 3300005983 Bacteria 814
82 Ga0070717_10393017 3300006028 Unclassified 1245
83 Ga0070717_10696766 3300006028 Bacteria 923
84 Ga0070717_11080754 3300006028 Unclassified 731
85 Ga0070715_10152717 3300006163 Bacteria 1133
86 Ga0070715_10236678 3300006163 Bacteria 947
87 Ga0070715_10387368 3300006163 Bacteria 773
88 Ga0070716_100564207 3300006173 Bacteria 851
89 Ga0070716_100813282 3300006173 Unclassified 724
90 Ga0070712_100077355 3300006175 Bacteria 2398
91 Ga0075428_100004806 3300006844 Bacteria 14982
92 Ga0075428_100010571 3300006844 Bacteria 10257
93 Ga0075428_100012415 3300006844 Bacteria 9474
94 Ga0075428_100877907 3300006844 Unclassified 952
95 Ga0075430_100067481 3300006846 Unclassified 3003
96 Ga0075430_100448848 3300006846 Bacteria 1064
97 Ga0075431_100001919 3300006847 Bacteria 19764
98 Ga0075431_100152719 3300006847 Bacteria 2377
99 Ga0075431_100598673 3300006847 Bacteria 1086
100 Ga0075431_100712011 3300006847 Bacteria 981
101 Ga0075433_10007253 3300006852 Bacteria 8784
102 Ga0075433_10234086 3300006852 Bacteria 1631
103 Ga0075433_10261359 3300006852 Bacteria 1534
104 Ga0075433_10289525 3300006852 Bacteria 1451
105 Ga0075434_100028194 3300006871 Bacteria 5516
106 Ga0075434_100031291 3300006871 Bacteria 5246
107 Ga0075434_100234989 3300006871 Bacteria 1853
108 Ga0075434_100257048 3300006871 Bacteria 1765
109 Ga0075434_100427018 3300006871 Bacteria 1346
110 Ga0075434_100666246 3300006871 Unclassified 1059
111 Ga0075434_101359167 3300006871 Unclassified 721
112 Ga0075429_100034738 3300006880 Bacteria 4382
113 Ga0075429_100050476 3300006880 Bacteria 3619
114 Ga0075429_100058169 3300006880 Bacteria 3366
115 Ga0075429_100073033 3300006880 Bacteria 2988
116 Ga0075429_100226501 3300006880 Bacteria 1637
117 Ga0075436_100041814 3300006914 Bacteria 3162
118 Ga0075436_100116012 3300006914 Bacteria 1871
119 Ga0097620_100071804 3300006931 Bacteria 3497
120 Ga0075435_100006877 3300007076 Bacteria 8072
121 Ga0075435_100140428 3300007076 Bacteria 2026
122 Ga0075435_100263465 3300007076 Bacteria 1469
123 Ga0099794_10093437 3300007265 Bacteria 1495
124 Ga0099794_10148269 3300007265 Bacteria 1190
125 Ga0099795_10136871 3300007788 Unclassified 993
126 Ga0111539_10002743 3300009094 Bacteria 23376
127 Ga0111539_10006317 3300009094 Bacteria 15281
128 Ga0111539_10016190 3300009094 Bacteria 9252
129 Ga0111539_10242396 3300009094 Bacteria 2099
130 Ga0111539_10284745 3300009094 Bacteria 1923
131 Ga0111539_10321184 3300009094 Unclassified 1802
132 Ga0114129_10000736 3300009147 Bacteria 41657
133 Ga0114129_10051410 3300009147 Bacteria 5785
134 Ga0114129_10063079 3300009147 Bacteria 5176
135 Ga0114129_10091422 3300009147 Bacteria 4217
136 Ga0114129_10358559 3300009147 Bacteria 1930
137 Ga0114129_10536518 3300009147 Bacteria 1523
138 Ga0114129_10786738 3300009147 Bacteria 1215
139 Ga0114129_11291361 3300009147 Bacteria 905
140 Ga0105243_11153621 3300009148 Bacteria 786
141 Ga0105242_10466789 3300009176 Bacteria 1193
142 Ga0105249_10623571 3300009553 Bacteria 1134
143 Ga0105249_10980939 3300009553 Bacteria 913
144 Ga0099796_10030320 3300010159 Bacteria 1754
145 Ga0157378_10059002 3300013297 Bacteria 3423
146 Ga0197907_10570641 3300020069 Bacteria 591
147 Ga0206356_10768176 3300020070 Unclassified 671
148 Ga0206352_10322770 3300020078 Bacteria 890
149 Ga0213876_10097801 3300021384 Bacteria 1555
150 Ga0213876_10266102 3300021384 Bacteria 911
151 Ga0213875_10000132 3300021388 Bacteria 82929
152 Ga0224712_10190004 3300022467 Unclassified 929
153 Ga0207692_10046720 3300025898 Unclassified 2171
154 Ga0207692_10082704 3300025898 Bacteria 1721
155 Ga0207699_10675496 3300025906 Unclassified 755
156 Ga0207684_10110024 3300025910 Bacteria 2358
157 Ga0207684_10158271 3300025910 Bacteria 1950
158 Ga0207684_10164310 3300025910 Bacteria 1912
159 Ga0207684_10867373 3300025910 Bacteria 760
160 Ga0207707_10195209 3300025912 Bacteria 1766
161 Ga0207707_10595968 3300025912 Unclassified 936
162 Ga0207693_10015294 3300025915 Bacteria 6158
163 Ga0207693_10059890 3300025915 Bacteria 2983
164 Ga0207693_11118284 3300025915 Bacteria 598
165 Ga0207663_10275775 3300025916 Bacteria 1247
166 Ga0207660_10048123 3300025917 Bacteria 3017
167 Ga0207652_10114380 3300025921 Bacteria 2396
168 Ga0207646_10009634 3300025922 Bacteria 9528
169 Ga0207646_10095154 3300025922 Bacteria 2668
170 Ga0207646_10160023 3300025922 Unclassified 2031
171 Ga0207646_10526234 3300025922 Bacteria 1064
172 Ga0207646_10558223 3300025922 Bacteria 1029
173 Ga0207646_10778068 3300025922 Bacteria 853
174 Ga0207646_11054496 3300025922 Unclassified 717
175 Ga0207646_11324061 3300025922 Unclassified 628
176 Ga0207700_10055795 3300025928 Bacteria 2970
177 Ga0207700_10130593 3300025928 Bacteria 2050
178 Ga0207664_10098482 3300025929 Bacteria 2411
179 Ga0207686_10254927 3300025934 Bacteria 1284
180 Ga0207665_10477148 3300025939 Bacteria 960
181 Ga0207665_10783153 3300025939 Bacteria 753
182 Ga0207665_10988139 3300025939 Unclassified 669
183 Ga0207689_10289070 3300025942 Bacteria 1358
184 Ga0207712_10480773 3300025961 Bacteria 1059
185 Ga0207677_10582317 3300026023 Bacteria 980
186 Ga0207641_11697578 3300026088 Bacteria 633
187 Ga0207648_10072952 3300026089 Bacteria 2992
188 Ga0207648_11321954 3300026089 Bacteria 677
189 Ga0207428_10000069 3300027907 Bacteria 149507
190 Ga0207428_10006468 3300027907 Bacteria 10813
191 Ga0207428_10018385 3300027907 Bacteria 5972
192 Ga0207428_10155320 3300027907 Unclassified 1740
193 Ga0268265_10395514 3300028380 Bacteria 1276
194 Ga0268265_10419500 3300028380 Bacteria 1242
195 Ga0268265_12228453 3300028380 Bacteria 555
196 Ga0268264_12663685 3300028381 Unclassified 504
197 Ga0307408_100074090 3300031548 Bacteria 2525
198 Ga0307409_102408336 3300031995 Bacteria 555
199 Ga0307411_10128751 3300032005 Bacteria 1846
200 Ga0307415_100606228 3300032126 Bacteria 975
201 Ga0373926_0070081 3300035083 Bacteria 1287
202 Ga0373940_0006651 3300035088 Bacteria 2577
203 Ga0373932_0057084 3300035112 Bacteria 1176
204 Ga0373936_0125704 3300035113 Unclassified 1099
205 Ga0373939_0040317 3300035114 Bacteria 1402
206 Ga0373941_0036589 3300035115 Bacteria 1494
207 Ga0373943_0092544 3300035170 Bacteria 1568
208 Ga0373942_0018687 3300035207 Bacteria 1723
209 Ga0373931_0101656 3300035691 Bacteria 1617
210 Ga0373931_0122823 3300035691 Bacteria 1486
211 Ga0373935_0368892 3300035692 Unclassified 1026
212 Ga0373947_0168416 3300035725 Unclassified 1420
213 Ga0373925_0461168 3300037068 Bacteria 1041
214 Ga0373925_0826740 3300037068 Unclassified 763
215 Ga0395899_0032389 3300037312 Bacteria 3926
216 Ga0395899_0307138 3300037312 Bacteria 1072
217 Ga0395900_0001852 3300037418 Bacteria 24121
218 Ga0395898_0009827 3300037466 Bacteria 10029
219 Ga0436364_0270327 3300037853 Unclassified 1172
220 Ga0395901_0296881 3300038443 Bacteria 1675
221 Ga0436365_0631737 3300039437 Bacteria 7807
222 Ga0436365_1892597 3300039437 Bacteria 1730
223 Ga0436360_0459223 3300039438 Bacteria 716
224 Ga0436360_0641458 3300039438 Unclassified 749
225 Ga0436360_0950961 3300039438 Bacteria 2127
226 Ga0436360_1260172 3300039438 Bacteria 1232
227 Ga0436363_0864451 3300039450 Bacteria 3841
228 Ga0436362_0470345 3300039453 Bacteria 7991
229 Ga0451577_0071186 3300042876 Bacteria 3101
230 Ga0453683_0271082 3300044673 Bacteria 1083
231 Ga0453683_1129012 3300044673 Bacteria 523
232 Ga0451576_0182853 3300045051 Bacteria 2189
233 Ga0451576_0220906 3300045051 Bacteria 1978
234 Ga0495584_0070430 3300046491 Bacteria 1758
235 Ga0495659_0046992 3300046664 Bacteria 1560
236 Ga0495669_0045858 3300046684 Bacteria 1950
237 Ga0495636_0004675 3300047318 Bacteria 5371
238 Ga0496102_0124088 3300048905 Bacteria 2413
239 Ga0496105_0988356 3300048908 Bacteria 630
240 Ga0501042_0651838 3300049578 Unclassified 765
241 Ga0501067_0126525 3300049583 Bacteria 1422
242 nmdc:mga05p37_226912_c2 3300050507 Bacteria 1849
243 nmdc:mga05p37_249454_c1 3300050507 Bacteria 2130
244 nmdc:mga05p37_292684_c1 3300050507 Bacteria 1938
245 nmdc:mga05p37_32907_c1 3300050507 Bacteria 6347
246 nmdc:mga05p37_471356_c1 3300050507 Bacteria 1449
247 nmdc:mga05p37_6078_c1 3300050507 Bacteria 14217
248 nmdc:mga05p37_675640_c1 3300050507 Bacteria 1152
249 nmdc:mga05p37_684961_c1 3300050507 Unclassified 1142
250 nmdc:mga09592_23179_c1 3300050508 Bacteria 5125
251 nmdc:mga09592_323066_c1 3300050508 Bacteria 1337
252 nmdc:mga09592_41962_c1 3300050508 Bacteria 3849
253 nmdc:mga09592_46644_c1 3300050508 Bacteria 3650
254 nmdc:mga09592_579932_c1 3300050508 Bacteria 962
255 nmdc:mga09592_74867_c1 3300050508 Bacteria 2878
256 nmdc:mga0qj67_16961_c1 3300050509 Bacteria 5532
257 nmdc:mga0qj67_179022_c1 3300050509 Bacteria 1722
258 nmdc:mga0qj67_350569_c1 3300050509 Bacteria 1193
259 nmdc:mga06r32_5710_c1 3300050510 Bacteria 11204
260 nmdc:mga06r32_68291_c1 3300050510 Bacteria 3434
261 nmdc:mga06r32_847283_c1 3300050510 Bacteria 873
262 nmdc:mga08y16_17015_c1 3300050511 Bacteria 7657
263 nmdc:mga08y16_182_c1 3300050511 Bacteria 55595
264 nmdc:mga08y16_1921_c1 3300050511 Bacteria 21189
265 nmdc:mga08y16_76942_c1 3300050511 Bacteria 3478
266 nmdc:mga08y16_925554_c1 3300050511 Bacteria 856
267 nmdc:mga0n895_12943_c1 3300050512 Bacteria 7502
268 nmdc:mga0n895_13414_c1 3300050512 Bacteria 7391
269 nmdc:mga0n895_1818026_c1 3300050512 Unclassified 570
270 nmdc:mga0n895_195957_c1 3300050512 Bacteria 2051
271 nmdc:mga0n895_201905_c1 3300050512 Bacteria 2019
272 nmdc:mga0n895_355879_c1 3300050512 Unclassified 1483
273 nmdc:mga0n895_360521_c1 3300050512 Bacteria 1472
274 nmdc:mga0n895_5127_c1 3300050512 Bacteria 10888
275 nmdc:mga0n895_57308_c1 3300050512 Bacteria 3840
276 nmdc:mga0rr50_159858_c1 3300050513 Bacteria 1828
277 nmdc:mga0rr50_178088_c1 3300050513 Bacteria 1737
278 nmdc:mga0rr50_234601_c1 3300050513 Bacteria 1519
279 nmdc:mga0rr50_38317_c1 3300050513 Bacteria 3468
280 nmdc:mga0rr50_581570_c1 3300050513 Unclassified 954
281 nmdc:mga08x19_112610_c1 3300050514 Bacteria 1816
282 nmdc:mga08x19_270953_c1 3300050514 Bacteria 1175
283 nmdc:mga08x19_329764_c1 3300050514 Unclassified 1063
284 nmdc:mga0a205_242560_c1 3300050515 Bacteria 1683
285 nmdc:mga0a205_27222_c1 3300050515 Bacteria 5461
286 nmdc:mga0a205_272908_c1 3300050515 Bacteria 1568
287 nmdc:mga0a205_297053_c1 3300050515 Bacteria 1489
288 nmdc:mga0a205_485199_c1 3300050515 Unclassified 1094
289 nmdc:mga0a205_51786_c1 3300050515 Bacteria 3964
290 nmdc:mga0a205_648594_c1 3300050515 Bacteria 907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_13414_c1 nmdc:mga0n895_13414_c1_17_442 139
2 3300006847 Ga0075431_100152719 Ga0075431_1001527193 142
3 3300009147 Ga0114129_10358559 Ga0114129_103585592 144
4 3300035088 Ga0373940_0006651 Ga0373940_0006651_1406_1855 145
5 3300035112 Ga0373932_0057084 Ga0373932_0057084_107_556 145
6 3300035207 Ga0373942_0018687 Ga0373942_0018687_217_666 145
7 3300035691 Ga0373931_0122823 Ga0373931_0122823_695_1144 145
8 3300045051 Ga0451576_0220906 Ga0451576_0220906_542_991 145
9 3300050508 nmdc:mga09592_74867_c1 nmdc:mga09592_74867_c1_861_1310 145
10 3300050509 nmdc:mga0qj67_16961_c1 nmdc:mga0qj67_16961_c1_705_1154 145
11 3300050510 nmdc:mga06r32_68291_c1 nmdc:mga06r32_68291_c1_2157_2606 145
12 3300050515 nmdc:mga0a205_648594_c1 nmdc:mga0a205_648594_c1_15_464 145
13 3300037853 Ga0436364_0270327 Ga0436364_0270327_92_589 146
14 3300021384 Ga0213876_10266102 Ga0213876_102661022 149
15 3300039437 Ga0436365_1892597 Ga0436365_1892597_1175_1624 149
16 3300005330 Ga0070690_100049559 Ga0070690_1000495593 150
17 3300005334 Ga0068869_100095928 Ga0068869_1000959282 150
18 3300005436 Ga0070713_100223669 Ga0070713_1002236692 150
19 3300005544 Ga0070686_100536646 Ga0070686_1005366461 150
20 3300005545 Ga0070695_100036924 Ga0070695_1000369243 150
21 3300005546 Ga0070696_100573186 Ga0070696_1005731861 150
22 3300005547 Ga0070693_100117348 Ga0070693_1001173482 150
23 3300005615 Ga0070702_100083469 Ga0070702_1000834692 150
24 3300005718 Ga0068866_10238599 Ga0068866_102385992 150
25 3300009148 Ga0105243_11153621 Ga0105243_111536212 150
26 3300009176 Ga0105242_10466789 Ga0105242_104667892 150
27 3300013297 Ga0157378_10059002 Ga0157378_100590022 150
28 3300025934 Ga0207686_10254927 Ga0207686_102549271 150
29 3300025942 Ga0207689_10289070 Ga0207689_102890702 150
30 3300026023 Ga0207677_10582317 Ga0207677_105823171 150
31 3300026089 Ga0207648_10072952 Ga0207648_100729522 150
32 3300039438 Ga0436360_0459223 Ga0436360_0459223_201_656 150
33 3300050514 nmdc:mga08x19_329764_c1 nmdc:mga08x19_329764_c1_480_968 150
34 3300004800 Ga0058861_11178504 Ga0058861_111785042 151
35 3300004803 Ga0058862_10644631 Ga0058862_106446312 151
36 3300005458 Ga0070681_10680411 Ga0070681_106804111 151
37 3300005530 Ga0070679_100144268 Ga0070679_1001442681 151
38 3300005546 Ga0070696_100772648 Ga0070696_1007726481 151
39 3300006028 Ga0070717_10393017 Ga0070717_103930172 151
40 3300020069 Ga0197907_10570641 Ga0197907_105706411 151
41 3300020070 Ga0206356_10768176 Ga0206356_107681761 151
42 3300020078 Ga0206352_10322770 Ga0206352_103227701 151
43 3300022467 Ga0224712_10190004 Ga0224712_101900042 151
44 3300025912 Ga0207707_10595968 Ga0207707_105959681 151
45 3300025921 Ga0207652_10114380 Ga0207652_101143805 151
46 3300003163 Ga0006759J45824_1064145 Ga0006759J45824_10641451 152
47 3300003575 Ga0007409J51694_1055957 Ga0007409J51694_10559571 152
48 3300003577 Ga0007416J51690_1052693 Ga0007416J51690_10526931 152
49 3300005290 Ga0065712_10248643 Ga0065712_102486431 152
50 3300005290 Ga0065712_10364567 Ga0065712_103645672 152
51 3300005329 Ga0070683_101126801 Ga0070683_1011268011 152
52 3300005330 Ga0070690_100664020 Ga0070690_1006640201 152
53 3300005331 Ga0070670_100495682 Ga0070670_1004956821 152
54 3300005331 Ga0070670_101593650 Ga0070670_1015936501 152
55 3300005333 Ga0070677_10426865 Ga0070677_104268652 152
56 3300005336 Ga0070680_100010492 Ga0070680_10001049210 152
57 3300005340 Ga0070689_100263500 Ga0070689_1002635002 152
58 3300005341 Ga0070691_10667109 Ga0070691_106671091 152
59 3300005356 Ga0070674_101310070 Ga0070674_1013100701 152
60 3300005434 Ga0070709_10104903 Ga0070709_101049032 152
61 3300005435 Ga0070714_100061258 Ga0070714_1000612582 152
62 3300005435 Ga0070714_101014731 Ga0070714_1010147311 152
63 3300005436 Ga0070713_100123197 Ga0070713_1001231973 152
64 3300005436 Ga0070713_100167372 Ga0070713_1001673722 152
65 3300005436 Ga0070713_100194764 Ga0070713_1001947641 152
66 3300005437 Ga0070710_10168398 Ga0070710_101683982 152
67 3300005437 Ga0070710_10191704 Ga0070710_101917042 152
68 3300005439 Ga0070711_100337292 Ga0070711_1003372922 152
69 3300005439 Ga0070711_100500764 Ga0070711_1005007642 152
70 3300005439 Ga0070711_100905820 Ga0070711_1009058201 152
71 3300005441 Ga0070700_100486909 Ga0070700_1004869092 152
72 3300005444 Ga0070694_100124735 Ga0070694_1001247352 152
73 3300005444 Ga0070694_100545438 Ga0070694_1005454382 152
74 3300005445 Ga0070708_100049978 Ga0070708_1000499784 152
75 3300005445 Ga0070708_100095190 Ga0070708_1000951905 152
76 3300005445 Ga0070708_100097375 Ga0070708_1000973754 152
77 3300005445 Ga0070708_101059244 Ga0070708_1010592442 152
78 3300005458 Ga0070681_10064246 Ga0070681_100642463 152
79 3300005459 Ga0068867_101253109 Ga0068867_1012531091 152
80 3300005467 Ga0070706_100106971 Ga0070706_1001069712 152
81 3300005467 Ga0070706_100634891 Ga0070706_1006348912 152
82 3300005467 Ga0070706_100973229 Ga0070706_1009732291 152
83 3300005468 Ga0070707_100009340 Ga0070707_1000093402 152
84 3300005468 Ga0070707_100012064 Ga0070707_1000120642 152
85 3300005468 Ga0070707_100091403 Ga0070707_1000914031 152
86 3300005468 Ga0070707_100106628 Ga0070707_1001066282 152
87 3300005468 Ga0070707_100112454 Ga0070707_1001124542 152
88 3300005468 Ga0070707_100125370 Ga0070707_1001253701 152
89 3300005468 Ga0070707_100918699 Ga0070707_1009186991 152
90 3300005471 Ga0070698_100120830 Ga0070698_1001208305 152
91 3300005471 Ga0070698_100868760 Ga0070698_1008687602 152
92 3300005471 Ga0070698_101060113 Ga0070698_1010601131 152
93 3300005518 Ga0070699_100155829 Ga0070699_1001558293 152
94 3300005518 Ga0070699_100252971 Ga0070699_1002529712 152
95 3300005518 Ga0070699_100499808 Ga0070699_1004998082 152
96 3300005536 Ga0070697_100060085 Ga0070697_1000600854 152
97 3300005536 Ga0070697_100383334 Ga0070697_1003833342 152
98 3300005536 Ga0070697_100630335 Ga0070697_1006303351 152
99 3300005536 Ga0070697_100952327 Ga0070697_1009523272 152
100 3300005545 Ga0070695_100486673 Ga0070695_1004866732 152
101 3300005545 Ga0070695_100564294 Ga0070695_1005642941 152
102 3300005546 Ga0070696_100613590 Ga0070696_1006135901 152
103 3300005549 Ga0070704_100170668 Ga0070704_1001706681 152
104 3300005549 Ga0070704_101345262 Ga0070704_1013452621 152
105 3300005578 Ga0068854_100983508 Ga0068854_1009835081 152
106 3300005617 Ga0068859_100071804 Ga0068859_1000718046 152
107 3300005719 Ga0068861_101195448 Ga0068861_1011954482 152
108 3300005841 Ga0068863_101114537 Ga0068863_1011145372 152
109 3300005843 Ga0068860_100151776 Ga0068860_1001517763 152
110 3300005844 Ga0068862_100127172 Ga0068862_1001271722 152
111 3300005844 Ga0068862_100872625 Ga0068862_1008726252 152
112 3300005983 Ga0081540_1174316 Ga0081540_11743161 152
113 3300006028 Ga0070717_10696766 Ga0070717_106967662 152
114 3300006028 Ga0070717_11080754 Ga0070717_110807541 152
115 3300006163 Ga0070715_10152717 Ga0070715_101527171 152
116 3300006163 Ga0070715_10236678 Ga0070715_102366781 152
117 3300006163 Ga0070715_10387368 Ga0070715_103873682 152
118 3300006173 Ga0070716_100564207 Ga0070716_1005642072 152
119 3300006173 Ga0070716_100813282 Ga0070716_1008132821 152
120 3300006175 Ga0070712_100077355 Ga0070712_1000773553 152
121 3300006844 Ga0075428_100004806 Ga0075428_10000480611 152
122 3300006844 Ga0075428_100010571 Ga0075428_1000105712 152
123 3300006844 Ga0075428_100012415 Ga0075428_1000124153 152
124 3300006844 Ga0075428_100877907 Ga0075428_1008779072 152
125 3300006846 Ga0075430_100067481 Ga0075430_1000674812 152
126 3300006846 Ga0075430_100448848 Ga0075430_1004488481 152
127 3300006847 Ga0075431_100001919 Ga0075431_1000019193 152
128 3300006847 Ga0075431_100598673 Ga0075431_1005986732 152
129 3300006847 Ga0075431_100712011 Ga0075431_1007120111 152
130 3300006852 Ga0075433_10007253 Ga0075433_1000725313 152
131 3300006852 Ga0075433_10234086 Ga0075433_102340862 152
132 3300006852 Ga0075433_10261359 Ga0075433_102613591 152
133 3300006852 Ga0075433_10289525 Ga0075433_102895251 152
134 3300006871 Ga0075434_100028194 Ga0075434_1000281942 152
135 3300006871 Ga0075434_100031291 Ga0075434_1000312915 152
136 3300006871 Ga0075434_100234989 Ga0075434_1002349892 152
137 3300006871 Ga0075434_100257048 Ga0075434_1002570482 152
138 3300006871 Ga0075434_100427018 Ga0075434_1004270182 152
139 3300006871 Ga0075434_100666246 Ga0075434_1006662462 152
140 3300006871 Ga0075434_101359167 Ga0075434_1013591671 152
141 3300006880 Ga0075429_100034738 Ga0075429_1000347383 152
142 3300006880 Ga0075429_100050476 Ga0075429_1000504763 152
143 3300006880 Ga0075429_100058169 Ga0075429_1000581692 152
144 3300006880 Ga0075429_100073033 Ga0075429_1000730332 152
145 3300006880 Ga0075429_100226501 Ga0075429_1002265012 152
146 3300006914 Ga0075436_100041814 Ga0075436_1000418142 152
147 3300006914 Ga0075436_100116012 Ga0075436_1001160123 152
148 3300006931 Ga0097620_100071804 Ga0097620_1000718046 152
149 3300007076 Ga0075435_100006877 Ga0075435_1000068778 152
150 3300007076 Ga0075435_100140428 Ga0075435_1001404282 152
151 3300007076 Ga0075435_100263465 Ga0075435_1002634652 152
152 3300007265 Ga0099794_10093437 Ga0099794_100934372 152
153 3300007265 Ga0099794_10148269 Ga0099794_101482692 152
154 3300007788 Ga0099795_10136871 Ga0099795_101368712 152
155 3300009094 Ga0111539_10002743 Ga0111539_1000274320 152
156 3300009094 Ga0111539_10006317 Ga0111539_100063173 152
157 3300009094 Ga0111539_10016190 Ga0111539_100161908 152
158 3300009094 Ga0111539_10242396 Ga0111539_102423962 152
159 3300009094 Ga0111539_10284745 Ga0111539_102847452 152
160 3300009094 Ga0111539_10321184 Ga0111539_103211842 152
161 3300009147 Ga0114129_10000736 Ga0114129_1000073622 152
162 3300009147 Ga0114129_10051410 Ga0114129_100514103 152
163 3300009147 Ga0114129_10063079 Ga0114129_100630795 152
164 3300009147 Ga0114129_10091422 Ga0114129_100914224 152
165 3300009147 Ga0114129_10536518 Ga0114129_105365182 152
166 3300009147 Ga0114129_10786738 Ga0114129_107867382 152
167 3300009147 Ga0114129_11291361 Ga0114129_112913611 152
168 3300009553 Ga0105249_10623571 Ga0105249_106235711 152
169 3300009553 Ga0105249_10980939 Ga0105249_109809391 152
170 3300010159 Ga0099796_10030320 Ga0099796_100303202 152
171 3300021384 Ga0213876_10097801 Ga0213876_100978012 152
172 3300021388 Ga0213875_10000132 Ga0213875_1000013236 152
173 3300025898 Ga0207692_10046720 Ga0207692_100467203 152
174 3300025898 Ga0207692_10082704 Ga0207692_100827042 152
175 3300025906 Ga0207699_10675496 Ga0207699_106754961 152
176 3300025910 Ga0207684_10110024 Ga0207684_101100241 152
177 3300025910 Ga0207684_10158271 Ga0207684_101582712 152
178 3300025910 Ga0207684_10164310 Ga0207684_101643101 152
179 3300025910 Ga0207684_10867373 Ga0207684_108673732 152
180 3300025912 Ga0207707_10195209 Ga0207707_101952092 152
181 3300025915 Ga0207693_10015294 Ga0207693_100152944 152
182 3300025915 Ga0207693_10059890 Ga0207693_100598904 152
183 3300025915 Ga0207693_11118284 Ga0207693_111182841 152
184 3300025916 Ga0207663_10275775 Ga0207663_102757753 152
185 3300025917 Ga0207660_10048123 Ga0207660_100481232 152
186 3300025922 Ga0207646_10009634 Ga0207646_100096342 152
187 3300025922 Ga0207646_10095154 Ga0207646_100951542 152
188 3300025922 Ga0207646_10160023 Ga0207646_101600232 152
189 3300025922 Ga0207646_10526234 Ga0207646_105262341 152
190 3300025922 Ga0207646_10558223 Ga0207646_105582232 152
191 3300025922 Ga0207646_10778068 Ga0207646_107780682 152
192 3300025922 Ga0207646_11054496 Ga0207646_110544961 152
193 3300025922 Ga0207646_11324061 Ga0207646_113240612 152
194 3300025928 Ga0207700_10055795 Ga0207700_100557953 152
195 3300025928 Ga0207700_10130593 Ga0207700_101305933 152
196 3300025929 Ga0207664_10098482 Ga0207664_100984822 152
197 3300025939 Ga0207665_10477148 Ga0207665_104771481 152
198 3300025939 Ga0207665_10783153 Ga0207665_107831531 152
199 3300025939 Ga0207665_10988139 Ga0207665_109881391 152
200 3300025961 Ga0207712_10480773 Ga0207712_104807732 152
201 3300026088 Ga0207641_11697578 Ga0207641_116975781 152
202 3300026089 Ga0207648_11321954 Ga0207648_113219542 152
203 3300027907 Ga0207428_10000069 Ga0207428_1000006945 152
204 3300027907 Ga0207428_10006468 Ga0207428_100064688 152
205 3300027907 Ga0207428_10018385 Ga0207428_100183855 152
206 3300027907 Ga0207428_10155320 Ga0207428_101553202 152
207 3300028380 Ga0268265_10395514 Ga0268265_103955142 152
208 3300028380 Ga0268265_10419500 Ga0268265_104195001 152
209 3300028380 Ga0268265_12228453 Ga0268265_122284531 152
210 3300028381 Ga0268264_12663685 Ga0268264_126636851 152
211 3300031548 Ga0307408_100074090 Ga0307408_1000740902 152
212 3300031995 Ga0307409_102408336 Ga0307409_1024083361 152
213 3300032005 Ga0307411_10128751 Ga0307411_101287512 152
214 3300032126 Ga0307415_100606228 Ga0307415_1006062282 152
215 3300035083 Ga0373926_0070081 Ga0373926_0070081_76_549 152
216 3300035113 Ga0373936_0125704 Ga0373936_0125704_80_580 152
217 3300035114 Ga0373939_0040317 Ga0373939_0040317_508_1035 152
218 3300035115 Ga0373941_0036589 Ga0373941_0036589_158_619 152
219 3300035170 Ga0373943_0092544 Ga0373943_0092544_836_1336 152
220 3300035691 Ga0373931_0101656 Ga0373931_0101656_1031_1492 152
221 3300035692 Ga0373935_0368892 Ga0373935_0368892_136_636 152
222 3300035725 Ga0373947_0168416 Ga0373947_0168416_661_1161 152
223 3300037068 Ga0373925_0461168 Ga0373925_0461168_13_513 152
224 3300037068 Ga0373925_0826740 Ga0373925_0826740_205_678 152
225 3300037312 Ga0395899_0032389 Ga0395899_0032389_182_643 152
226 3300037312 Ga0395899_0307138 Ga0395899_0307138_381_842 152
227 3300037418 Ga0395900_0001852 Ga0395900_0001852_8920_9381 152
228 3300037466 Ga0395898_0009827 Ga0395898_0009827_2754_3215 152
229 3300038443 Ga0395901_0296881 Ga0395901_0296881_750_1211 152
230 3300039437 Ga0436365_0631737 Ga0436365_0631737_62_523 152
231 3300039438 Ga0436360_0641458 Ga0436360_0641458_156_614 152
232 3300039438 Ga0436360_0950961 Ga0436360_0950961_58_516 152
233 3300039438 Ga0436360_1260172 Ga0436360_1260172_257_715 152
234 3300039450 Ga0436363_0864451 Ga0436363_0864451_1766_2224 152
235 3300039453 Ga0436362_0470345 Ga0436362_0470345_1154_1615 152
236 3300042876 Ga0451577_0071186 Ga0451577_0071186_977_1438 152
237 3300044673 Ga0453683_0271082 Ga0453683_0271082_230_691 152
238 3300044673 Ga0453683_1129012 Ga0453683_1129012_47_508 152
239 3300045051 Ga0451576_0182853 Ga0451576_0182853_623_1084 152
240 3300046491 Ga0495584_0070430 Ga0495584_0070430_1271_1735 152
241 3300046664 Ga0495659_0046992 Ga0495659_0046992_48_509 152
242 3300046684 Ga0495669_0045858 Ga0495669_0045858_1469_1930 152
243 3300047318 Ga0495636_0004675 Ga0495636_0004675_3657_4124 152
244 3300048905 Ga0496102_0124088 Ga0496102_0124088_429_890 152
245 3300048908 Ga0496105_0988356 Ga0496105_0988356_148_609 152
246 3300049578 Ga0501042_0651838 Ga0501042_0651838_126_587 152
247 3300049583 Ga0501067_0126525 Ga0501067_0126525_757_1218 152
248 3300050507 nmdc:mga05p37_226912_c2 nmdc:mga05p37_226912_c2_371_832 152
249 3300050507 nmdc:mga05p37_249454_c1 nmdc:mga05p37_249454_c1_387_848 152
250 3300050507 nmdc:mga05p37_292684_c1 nmdc:mga05p37_292684_c1_1089_1556 152
251 3300050507 nmdc:mga05p37_32907_c1 nmdc:mga05p37_32907_c1_1016_1483 152
252 3300050507 nmdc:mga05p37_471356_c1 nmdc:mga05p37_471356_c1_243_710 152
253 3300050507 nmdc:mga05p37_6078_c1 nmdc:mga05p37_6078_c1_1995_2456 152
254 3300050507 nmdc:mga05p37_675640_c1 nmdc:mga05p37_675640_c1_249_710 152
255 3300050507 nmdc:mga05p37_684961_c1 nmdc:mga05p37_684961_c1_49_513 152
256 3300050508 nmdc:mga09592_23179_c1 nmdc:mga09592_23179_c1_632_1099 152
257 3300050508 nmdc:mga09592_323066_c1 nmdc:mga09592_323066_c1_11_478 152
258 3300050508 nmdc:mga09592_41962_c1 nmdc:mga09592_41962_c1_1321_1791 152
259 3300050508 nmdc:mga09592_46644_c1 nmdc:mga09592_46644_c1_2055_2516 152
260 3300050508 nmdc:mga09592_579932_c1 nmdc:mga09592_579932_c1_82_543 152
261 3300050509 nmdc:mga0qj67_179022_c1 nmdc:mga0qj67_179022_c1_585_1052 152
262 3300050509 nmdc:mga0qj67_350569_c1 nmdc:mga0qj67_350569_c1_94_561 152
263 3300050510 nmdc:mga06r32_5710_c1 nmdc:mga06r32_5710_c1_7525_7986 152
264 3300050510 nmdc:mga06r32_847283_c1 nmdc:mga06r32_847283_c1_239_709 152
265 3300050511 nmdc:mga08y16_17015_c1 nmdc:mga08y16_17015_c1_4541_5011 152
266 3300050511 nmdc:mga08y16_182_c1 nmdc:mga08y16_182_c1_8390_8860 152
267 3300050511 nmdc:mga08y16_1921_c1 nmdc:mga08y16_1921_c1_7245_7706 152
268 3300050511 nmdc:mga08y16_76942_c1 nmdc:mga08y16_76942_c1_158_619 152
269 3300050511 nmdc:mga08y16_925554_c1 nmdc:mga08y16_925554_c1_236_763 152
270 3300050512 nmdc:mga0n895_12943_c1 nmdc:mga0n895_12943_c1_4199_4666 152
271 3300050512 nmdc:mga0n895_1818026_c1 nmdc:mga0n895_1818026_c1_50_517 152
272 3300050512 nmdc:mga0n895_195957_c1 nmdc:mga0n895_195957_c1_826_1287 152
273 3300050512 nmdc:mga0n895_201905_c1 nmdc:mga0n895_201905_c1_1465_1926 152
274 3300050512 nmdc:mga0n895_355879_c1 nmdc:mga0n895_355879_c1_600_1061 152
275 3300050512 nmdc:mga0n895_360521_c1 nmdc:mga0n895_360521_c1_214_675 152
276 3300050512 nmdc:mga0n895_5127_c1 nmdc:mga0n895_5127_c1_1496_1963 152
277 3300050512 nmdc:mga0n895_57308_c1 nmdc:mga0n895_57308_c1_2383_2847 152
278 3300050513 nmdc:mga0rr50_159858_c1 nmdc:mga0rr50_159858_c1_12_479 152
279 3300050513 nmdc:mga0rr50_178088_c1 nmdc:mga0rr50_178088_c1_995_1459 152
280 3300050513 nmdc:mga0rr50_234601_c1 nmdc:mga0rr50_234601_c1_375_836 152
281 3300050513 nmdc:mga0rr50_38317_c1 nmdc:mga0rr50_38317_c1_1086_1553 152
282 3300050513 nmdc:mga0rr50_581570_c1 nmdc:mga0rr50_581570_c1_160_627 152
283 3300050514 nmdc:mga08x19_112610_c1 nmdc:mga08x19_112610_c1_789_1256 152
284 3300050514 nmdc:mga08x19_270953_c1 nmdc:mga08x19_270953_c1_302_766 152
285 3300050515 nmdc:mga0a205_242560_c1 nmdc:mga0a205_242560_c1_190_654 152
286 3300050515 nmdc:mga0a205_27222_c1 nmdc:mga0a205_27222_c1_4483_4950 152
287 3300050515 nmdc:mga0a205_272908_c1 nmdc:mga0a205_272908_c1_891_1352 152
288 3300050515 nmdc:mga0a205_297053_c1 nmdc:mga0a205_297053_c1_304_771 152
289 3300050515 nmdc:mga0a205_485199_c1 nmdc:mga0a205_485199_c1_45_506 152
290 3300050515 nmdc:mga0a205_51786_c1 nmdc:mga0a205_51786_c1_3485_3952 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

48

154

0.98

PF13474

SnoaL_3

SnoaL-like domain

48

159

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.9014 31 151
3fsd-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution 0.9001 37 152
3ksp-assembly1.cif.gz_A-2 crystal structure of a putative ca/calmodulin-dependent kinase ii association domain (exig_1688) from exiguobacterium sibiricum 255-15 at 2.59 a resolution 0.8977 31 152
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8944 31 151
3cnx-assembly1.cif.gz_A crystal structure of a putative dehydratase from the ntf2-like family (sav_4671) from streptomyces avermitilis at 2.10 a resolution 0.8817 35 152
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9134 35 151 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8852 37 152 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8846 35 151 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.88 33 152 3.10.450.50
3kspA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8747 31 152 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A537R2P2-F1-model_v4 Nuclear transport factor 2 family protein 0.9923 45 152
AF-A0A537R2P2-F1-model_v4 Nuclear transport factor 2 family protein 0.9744 45 152
AF-F8C8P6-F1-model_v4 DUF4440 domain-containing protein 0.9565 35 152
AF-A0A5C8K9H6-F1-model_v4 Nuclear transport factor 2 family protein 0.9497 34 151
AF-A0A2V8PMI7-F1-model_v4 DUF4440 domain-containing protein 0.9479 32 152

Feature Viewer

pLDDT pTM Quality
85.52 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map