F389786

General Info

Members Datasets Scaffolds Average Seq Length
290 174 580 161

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10690393|Ga0163163_106903932
Length 164
Sequence MRLGIISDTHGLLRPEVFDAFKDVDHILHAGDVGDYDLITALEAIAPVTAVYGNTDDGEVRAKLPRVAKLELDGFEIVLTHGHQFGHGVTPLQLHDAFADADIIIYGHTHRPLLEIVDVVVTVMNPGGAGRRRFDIPASVGIMELEAGIPPRARLVPLTAADED

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
105 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
140 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
141 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
142 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
145 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
148 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
149 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
150 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
151 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
152 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
157 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
158 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
159 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
160 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.83
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 25.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10690393 3300014325 Bacteria 1084
2 rootH1_10114471 3300003316 Unclassified 2398
3 rootL2_10059286 3300003322 Bacteria 1841
4 rootL2_10248080 3300003322 Bacteria 3399
5 Ga0065715_10304290 3300005293 Bacteria 1022
6 Ga0070676_10096671 3300005328 Bacteria 1818
7 Ga0070677_10085911 3300005333 Bacteria 1358
8 Ga0070691_10339862 3300005341 Unclassified 831
9 Ga0070661_101258107 3300005344 Unclassified 620
10 Ga0070668_100018459 3300005347 Bacteria 5236
11 Ga0070669_100328646 3300005353 Bacteria 1236
12 Ga0070675_100134678 3300005354 Unclassified 2108
13 Ga0070671_100010635 3300005355 Bacteria 7384
14 Ga0070674_100407674 3300005356 Bacteria 1112
15 Ga0070673_100123784 3300005364 Bacteria 2161
16 Ga0070673_101540902 3300005364 Unclassified 627
17 Ga0070703_10144800 3300005406 Bacteria 887
18 Ga0070711_100001164 3300005439 Bacteria 14168
19 Ga0070700_100538278 3300005441 Unclassified 905
20 Ga0070694_100049441 3300005444 Bacteria 2832
21 Ga0070708_100090191 3300005445 Bacteria 2790
22 Ga0070708_100290546 3300005445 Bacteria 1539
23 Ga0070662_100196215 3300005457 Bacteria 1599
24 Ga0068867_100158664 3300005459 Bacteria 1782
25 Ga0070698_100551942 3300005471 Bacteria 1091
26 Ga0070699_100009241 3300005518 Bacteria 8544
27 Ga0070699_100030732 3300005518 Bacteria 4637
28 Ga0070699_101036292 3300005518 Bacteria 752
29 Ga0070684_100883384 3300005535 Bacteria 837
30 Ga0070697_100008858 3300005536 Bacteria 7854
31 Ga0070697_100039101 3300005536 Bacteria 3835
32 Ga0070672_100048631 3300005543 Bacteria 3296
33 Ga0070672_100074477 3300005543 Bacteria 2708
34 Ga0070695_100062330 3300005545 Bacteria 2421
35 Ga0070696_100000463 3300005546 Bacteria 25421
36 Ga0070696_100171921 3300005546 Bacteria 1602
37 Ga0070696_100176021 3300005546 Bacteria 1585
38 Ga0070693_100134326 3300005547 Bacteria 1550
39 Ga0070665_100515035 3300005548 Bacteria 1208
40 Ga0070704_100018540 3300005549 Bacteria 4453
41 Ga0070704_100206051 3300005549 Bacteria 1591
42 Ga0070704_100395930 3300005549 Bacteria 1177
43 Ga0070664_100030527 3300005564 Bacteria 4497
44 Ga0070664_100724041 3300005564 Bacteria 928
45 Ga0068854_100444295 3300005578 Bacteria 1082
46 Ga0068861_100493764 3300005719 Bacteria 1105
47 Ga0068863_100214102 3300005841 Bacteria 1856
48 Ga0068858_100195033 3300005842 Bacteria 1914
49 Ga0068860_101160888 3300005843 Bacteria 792
50 Ga0081455_10095636 3300005937 Bacteria 2397
51 Ga0070716_100001273 3300006173 Bacteria 11121
52 Ga0070712_100165407 3300006175 Bacteria 1712
53 Ga0097621_100269012 3300006237 Bacteria 1497
54 Ga0075430_100147857 3300006846 Bacteria 1957
55 Ga0075430_101061532 3300006846 Bacteria 667
56 Ga0075431_100004058 3300006847 Bacteria 14269
57 Ga0075431_100149579 3300006847 Bacteria 2405
58 Ga0075433_10009053 3300006852 Bacteria 7953
59 Ga0075433_10028826 3300006852 Bacteria 4723
60 Ga0075433_10029097 3300006852 Bacteria 4704
61 Ga0075434_100000281 3300006871 Bacteria 36197
62 Ga0075434_100013844 3300006871 Bacteria 7693
63 Ga0075434_100272678 3300006871 Unclassified 1711
64 Ga0068865_100881291 3300006881 Unclassified 777
65 Ga0075436_100023251 3300006914 Unclassified 4257
66 Ga0099794_10006761 3300007265 Bacteria 4664
67 Ga0114129_10054037 3300009147 Bacteria 5632
68 Ga0114129_10156080 3300009147 Unclassified 3120
69 Ga0105241_10400795 3300009174 Bacteria 1203
70 Ga0105248_10029500 3300009177 Bacteria 6119
71 Ga0105248_10121393 3300009177 Bacteria 2948
72 Ga0105239_10720965 3300010375 Unclassified 1141
73 Ga0157371_10273763 3300013102 Bacteria 1219
74 Ga0157375_11348213 3300013308 Bacteria 840
75 Ga0157380_10055447 3300014326 Bacteria 3148
76 Ga0157380_11119921 3300014326 Bacteria 827
77 Ga0182008_10297192 3300014497 Unclassified 844
78 Ga0157379_10013011 3300014968 Bacteria 7283
79 Ga0157376_10282705 3300014969 Bacteria 1563
80 Ga0207653_10042970 3300025885 Bacteria 1487
81 Ga0207682_10079833 3300025893 Bacteria 1400
82 Ga0207684_10186566 3300025910 Bacteria 1788
83 Ga0207654_10506028 3300025911 Bacteria 853
84 Ga0207707_10012198 3300025912 Bacteria 7472
85 Ga0207693_10136997 3300025915 Bacteria 1925
86 Ga0207663_10244734 3300025916 Bacteria 1317
87 Ga0207660_10649277 3300025917 Bacteria 860
88 Ga0207649_11012426 3300025920 Unclassified 654
89 Ga0207652_10010930 3300025921 Bacteria 7317
90 Ga0207646_10113578 3300025922 Bacteria 2432
91 Ga0207646_10206059 3300025922 Bacteria 1776
92 Ga0207644_10135754 3300025931 Bacteria 1888
93 Ga0207690_10186369 3300025932 Unclassified 1566
94 Ga0207706_10186675 3300025933 Bacteria 1820
95 Ga0207704_10829974 3300025938 Unclassified 774
96 Ga0207665_10000846 3300025939 Bacteria 20679
97 Ga0207691_10035495 3300025940 Bacteria 4626
98 Ga0207691_11515062 3300025940 Bacteria 548
99 Ga0207711_10537115 3300025941 Bacteria 1090
100 Ga0207679_10106752 3300025945 Bacteria 2202
101 Ga0207679_10684360 3300025945 Bacteria 930
102 Ga0207679_11135785 3300025945 Bacteria 717
103 Ga0207679_11231874 3300025945 Unclassified 687
104 Ga0207651_10087883 3300025960 Bacteria 2264
105 Ga0207651_11179030 3300025960 Unclassified 687
106 Ga0207668_10045554 3300025972 Bacteria 2992
107 Ga0207640_10178545 3300025981 Unclassified 1590
108 Ga0207703_10174676 3300026035 Bacteria 1892
109 Ga0207648_10083160 3300026089 Bacteria 2792
110 Ga0207676_10413861 3300026095 Bacteria 1263
111 Ga0207675_100273484 3300026118 Bacteria 1640
112 Ga0207675_100552544 3300026118 Bacteria 1151
113 Ga0209588_1145947 3300027671 Bacteria 751
114 Ga0209974_10074097 3300027876 Bacteria 1164
115 Ga0209974_10164496 3300027876 Bacteria 806
116 Ga0268266_11141299 3300028379 Bacteria 754
117 Ga0307408_100006272 3300031548 Bacteria 7894
118 Ga0307408_100066524 3300031548 Unclassified 2647
119 Ga0307408_100083038 3300031548 Bacteria 2399
120 Ga0307408_100121475 3300031548 Unclassified 2024
121 Ga0307408_100261182 3300031548 Bacteria 1433
122 Ga0307408_100298528 3300031548 Unclassified 1348
123 Ga0307408_100649064 3300031548 Bacteria 943
124 Ga0307405_10029889 3300031731 Bacteria 3189
125 Ga0307405_10371330 3300031731 Unclassified 1110
126 Ga0307405_10453228 3300031731 Bacteria 1017
127 Ga0307413_10108265 3300031824 Bacteria 1854
128 Ga0307413_10144589 3300031824 Unclassified 1648
129 Ga0307413_10309109 3300031824 Bacteria 1202
130 Ga0307413_11494489 3300031824 Unclassified 597
131 Ga0307410_10000781 3300031852 Bacteria 13424
132 Ga0307410_10021825 3300031852 Bacteria 3944
133 Ga0307410_10091147 3300031852 Bacteria 2163
134 Ga0307410_10158712 3300031852 Unclassified 1692
135 Ga0307410_10203663 3300031852 Bacteria 1512
136 Ga0307410_10302058 3300031852 Bacteria 1263
137 Ga0307410_10523951 3300031852 Bacteria 978
138 Ga0307410_10546520 3300031852 Unclassified 959
139 Ga0307410_10602651 3300031852 Bacteria 916
140 Ga0307406_10022694 3300031901 Bacteria 3725
141 Ga0307406_10073614 3300031901 Bacteria 2247
142 Ga0307406_10097615 3300031901 Bacteria 1993
143 Ga0307406_10104997 3300031901 Unclassified 1932
144 Ga0307406_10598436 3300031901 Bacteria 909
145 Ga0307407_10006886 3300031903 Bacteria 5102
146 Ga0307407_10012117 3300031903 Unclassified 4134
147 Ga0307407_10016666 3300031903 Bacteria 3664
148 Ga0307407_10074040 3300031903 Bacteria 2037
149 Ga0307407_10133626 3300031903 Bacteria 1591
150 Ga0307412_10164301 3300031911 Bacteria 1653
151 Ga0307412_10185743 3300031911 Unclassified 1567
152 Ga0307412_10317095 3300031911 Bacteria 1239
153 Ga0307412_10681773 3300031911 Bacteria 880
154 Ga0307412_10736974 3300031911 Unclassified 849
155 Ga0307409_100000519 3300031995 Bacteria 16633
156 Ga0307409_100002553 3300031995 Bacteria 9555
157 Ga0307409_100052316 3300031995 Unclassified 3130
158 Ga0307409_100056689 3300031995 Bacteria 3031
159 Ga0307409_100059478 3300031995 Unclassified 2974
160 Ga0307409_100189410 3300031995 Bacteria 1830
161 Ga0307409_100285160 3300031995 Bacteria 1529
162 Ga0307409_100299345 3300031995 Bacteria 1495
163 Ga0307409_100498395 3300031995 Bacteria 1185
164 Ga0307416_100000131 3300032002 Bacteria 45224
165 Ga0307416_100003647 3300032002 Bacteria 9102
166 Ga0307416_100053862 3300032002 Unclassified 3230
167 Ga0307416_100076305 3300032002 Bacteria 2809
168 Ga0307414_10022343 3300032004 Bacteria 3988
169 Ga0307414_10058240 3300032004 Unclassified 2721
170 Ga0307414_10070513 3300032004 Bacteria 2517
171 Ga0307414_10160388 3300032004 Bacteria 1785
172 Ga0307414_10992854 3300032004 Unclassified 772
173 Ga0307414_11220585 3300032004 Unclassified 696
174 Ga0307411_10000306 3300032005 Bacteria 16367
175 Ga0307411_10006632 3300032005 Bacteria 5811
176 Ga0307411_10039531 3300032005 Bacteria 2985
177 Ga0307411_10047710 3300032005 Bacteria 2770
178 Ga0307411_10086894 3300032005 Bacteria 2170
179 Ga0307411_10142470 3300032005 Unclassified 1769
180 Ga0307411_10710481 3300032005 Bacteria 876
181 Ga0307415_100000298 3300032126 Bacteria 21489
182 Ga0307415_100080299 3300032126 Bacteria 2326
183 Ga0307415_100088106 3300032126 Unclassified 2239
184 Ga0307415_100246614 3300032126 Unclassified 1448
185 Ga0307415_100349244 3300032126 Bacteria 1244
186 Ga0307415_100419025 3300032126 Bacteria 1148
187 Ga0373961_0111338 3300035241 Archaea 897
188 Ga0373931_0425242 3300035691 Bacteria 845
189 Ga0242420_092434 3300038996 Unclassified 636
190 Ga0451793_1537030 3300041452 Bacteria 1345
191 Ga0439431_0081220 3300041997 Bacteria 874
192 Ga0450898_012743 3300042134 Bacteria 1393
193 Ga0439435_0012905 3300042436 Bacteria 2035
194 Ga0453683_0144392 3300044673 Unclassified 1502
195 Ga0495585_0292432 3300046492 Bacteria 803
196 Ga0495630_0802387 3300046517 Unclassified 719
197 Ga0496102_0045996 3300048905 Unclassified 3963
198 Ga0496104_0237030 3300048907 Unclassified 1736
199 Ga0496104_1207005 3300048907 Bacteria 660
200 Ga0496105_0100776 3300048908 Unclassified 2385
201 Ga0496106_0259611 3300048909 Unclassified 1390
202 Ga0496108_0325753 3300048911 Bacteria 1339
203 Ga0496109_0134708 3300048912 Unclassified 2307
204 Ga0496110_0035799 3300048913 Unclassified 4309
205 Ga0496110_0051906 3300048913 Unclassified 3604
206 Ga0496110_0709234 3300048913 Bacteria 908
207 Ga0496111_0028772 3300048914 Unclassified 3939
208 Ga0496112_0049511 3300048915 Unclassified 4119
209 Ga0496113_0093461 3300048916 Bacteria 2321
210 Ga0501295_060931 3300049518 Bacteria 826
211 Ga0501031_0321089 3300049568 Unclassified 1003
212 Ga0501033_0367809 3300049570 Unclassified 1006
213 Ga0501034_0108383 3300049571 Bacteria 2769
214 Ga0501036_0186358 3300049572 Bacteria 1746
215 Ga0501036_0333816 3300049572 Bacteria 1266
216 Ga0501037_0449409 3300049573 Bacteria 879
217 Ga0501040_0021241 3300049576 Bacteria 4333
218 Ga0501040_0030711 3300049576 Unclassified 3630
219 Ga0501041_0121139 3300049577 Unclassified 1626
220 Ga0501046_0394384 3300049580 Bacteria 1000
221 Ga0501048_0029213 3300049582 Unclassified 4000
222 Ga0501048_0115118 3300049582 Bacteria 1900
223 Ga0501048_0321358 3300049582 Bacteria 1103
224 Ga0501067_0004214 3300049583 Bacteria 7934
225 Ga0501067_0214962 3300049583 Unclassified 1071
226 Ga0501068_0211642 3300049584 Unclassified 1231
227 Ga0501069_0020388 3300049585 Unclassified 3592
228 Ga0501069_0121495 3300049585 Bacteria 1492
229 Ga0501069_0233415 3300049585 Unclassified 1071
230 Ga0501070_0078254 3300049586 Bacteria 2737
231 Ga0501070_0226822 3300049586 Unclassified 1531
232 Ga0501070_0312784 3300049586 Bacteria 1278
233 Ga0501071_1032094 3300049587 Bacteria 635
234 Ga0501072_0139423 3300049588 Bacteria 1933
235 Ga0501074_0318157 3300049590 Unclassified 1105
236 Ga0501075_0038222 3300049591 Bacteria 3587
237 Ga0501075_0216968 3300049591 Unclassified 1459
238 Ga0501076_0047595 3300049592 Unclassified 3391
239 Ga0501076_0056994 3300049592 Bacteria 3102
240 Ga0501209_001955 3300049656 Bacteria 3055
241 Ga0501214_022263 3300049659 Unclassified 814
242 Ga0501227_081530 3300049665 Unclassified 848
243 Ga0501233_095371 3300049668 Bacteria 781
244 Ga0501235_075098 3300049669 Bacteria 803
245 Ga0501239_000786 3300049672 Bacteria 2555
246 Ga0501243_003519 3300049675 Bacteria 2323
247 Ga0501249_002416 3300049679 Bacteria 3772
248 Ga0501249_032200 3300049679 Bacteria 1172
249 Ga0501249_032554 3300049679 Bacteria 1166
250 Ga0501256_001958 3300049685 Bacteria 1594
251 Ga0501259_011540 3300049688 Bacteria 1463
252 Ga0501260_036508 3300049689 Bacteria 583
253 Ga0501221_008667 3300049704 Bacteria 1772
254 Ga0501225_0018080 3300049705 Bacteria 1956
255 Ga0501229_001080 3300049706 Bacteria 3140
256 Ga0501079_0011712 3300049741 Bacteria 6698
257 Ga0501079_0038817 3300049741 Bacteria 3672
258 Ga0501080_0068636 3300049742 Unclassified 3298
259 Ga0501080_0172826 3300049742 Bacteria 1992
260 Ga0501080_0727388 3300049742 Bacteria 874
261 Ga0501081_0016601 3300049743 Bacteria 4869
262 Ga0501081_0111094 3300049743 Unclassified 1945
263 Ga0501081_0292531 3300049743 Bacteria 1194
264 Ga0501081_1199843 3300049743 Unclassified 575
265 Ga0501262_005940 3300049759 Unclassified 1450
266 Ga0501263_001387 3300049760 Bacteria 2270
267 Ga0501271_003375 3300049768 Bacteria 1470
268 Ga0501272_000760 3300049769 Bacteria 2923
269 Ga0501283_005646 3300049779 Bacteria 1726
270 Ga0501035_0247105 3300049822 Unclassified 1516
271 Ga0501045_0393511 3300049824 Bacteria 1031
272 nmdc:mga05p37_133421_c1 3300050507 Unclassified 3046
273 nmdc:mga05p37_15879_c1 3300050507 Bacteria 7261
274 nmdc:mga05p37_2229100_c1 3300050507 Unclassified 507
275 nmdc:mga09592_310055_c1 3300050508 Bacteria 1368
276 nmdc:mga0qj67_132085_c1 3300050509 Bacteria 2022
277 nmdc:mga06r32_35488_c2 3300050510 Bacteria 2341
278 nmdc:mga0n895_14850_c1 3300050512 Bacteria 7087
279 nmdc:mga0n895_201_c1 3300050512 Bacteria 37245
280 nmdc:mga08x19_129434_c1 3300050514 Bacteria 1697
281 nmdc:mga0a205_3162_c1 3300050515 Bacteria 14617
282 nmdc:mga0a205_641_c1 3300050515 Bacteria 27693
283 Ga0495655_0150514 3300053083 Unclassified 731
284 Ga0501084_0016049 3300054114 Bacteria 6217
285 Ga0501084_0059106 3300054114 Bacteria 3208
286 Ga0590071_021122 3300059421 Bacteria 1534
287 Ga0501082_0037113 3300060353 Bacteria 4199
288 Ga0501082_0049196 3300060353 Bacteria 3635
289 Ga0530510_0121825 3300061734 Bacteria 1915
290 Ga0530510_0144412 3300061734 Unclassified 1755
291 Ga0163163_10690393
292 rootH1_10114471
293 rootL2_10059286
294 rootL2_10248080
295 Ga0065715_10304290
296 Ga0070676_10096671
297 Ga0070677_10085911
298 Ga0070691_10339862
299 Ga0070661_101258107
300 Ga0070668_100018459
301 Ga0070669_100328646
302 Ga0070675_100134678
303 Ga0070671_100010635
304 Ga0070674_100407674
305 Ga0070673_100123784
306 Ga0070673_101540902
307 Ga0070703_10144800
308 Ga0070711_100001164
309 Ga0070700_100538278
310 Ga0070694_100049441
311 Ga0070708_100090191
312 Ga0070708_100290546
313 Ga0070662_100196215
314 Ga0068867_100158664
315 Ga0070698_100551942
316 Ga0070699_100009241
317 Ga0070699_100030732
318 Ga0070699_101036292
319 Ga0070684_100883384
320 Ga0070697_100008858
321 Ga0070697_100039101
322 Ga0070672_100048631
323 Ga0070672_100074477
324 Ga0070695_100062330
325 Ga0070696_100000463
326 Ga0070696_100171921
327 Ga0070696_100176021
328 Ga0070693_100134326
329 Ga0070665_100515035
330 Ga0070704_100018540
331 Ga0070704_100206051
332 Ga0070704_100395930
333 Ga0070664_100030527
334 Ga0070664_100724041
335 Ga0068854_100444295
336 Ga0068861_100493764
337 Ga0068863_100214102
338 Ga0068858_100195033
339 Ga0068860_101160888
340 Ga0081455_10095636
341 Ga0070716_100001273
342 Ga0070712_100165407
343 Ga0097621_100269012
344 Ga0075430_100147857
345 Ga0075430_101061532
346 Ga0075431_100004058
347 Ga0075431_100149579
348 Ga0075433_10009053
349 Ga0075433_10028826
350 Ga0075433_10029097
351 Ga0075434_100000281
352 Ga0075434_100013844
353 Ga0075434_100272678
354 Ga0068865_100881291
355 Ga0075436_100023251
356 Ga0099794_10006761
357 Ga0114129_10054037
358 Ga0114129_10156080
359 Ga0105241_10400795
360 Ga0105248_10029500
361 Ga0105248_10121393
362 Ga0105239_10720965
363 Ga0157371_10273763
364 Ga0157375_11348213
365 Ga0157380_10055447
366 Ga0157380_11119921
367 Ga0182008_10297192
368 Ga0157379_10013011
369 Ga0157376_10282705
370 Ga0207653_10042970
371 Ga0207682_10079833
372 Ga0207684_10186566
373 Ga0207654_10506028
374 Ga0207707_10012198
375 Ga0207693_10136997
376 Ga0207663_10244734
377 Ga0207660_10649277
378 Ga0207649_11012426
379 Ga0207652_10010930
380 Ga0207646_10113578
381 Ga0207646_10206059
382 Ga0207644_10135754
383 Ga0207690_10186369
384 Ga0207706_10186675
385 Ga0207704_10829974
386 Ga0207665_10000846
387 Ga0207691_10035495
388 Ga0207691_11515062
389 Ga0207711_10537115
390 Ga0207679_10106752
391 Ga0207679_10684360
392 Ga0207679_11135785
393 Ga0207679_11231874
394 Ga0207651_10087883
395 Ga0207651_11179030
396 Ga0207668_10045554
397 Ga0207640_10178545
398 Ga0207703_10174676
399 Ga0207648_10083160
400 Ga0207676_10413861
401 Ga0207675_100273484
402 Ga0207675_100552544
403 Ga0209588_1145947
404 Ga0209974_10074097
405 Ga0209974_10164496
406 Ga0268266_11141299
407 Ga0307408_100006272
408 Ga0307408_100066524
409 Ga0307408_100083038
410 Ga0307408_100121475
411 Ga0307408_100261182
412 Ga0307408_100298528
413 Ga0307408_100649064
414 Ga0307405_10029889
415 Ga0307405_10371330
416 Ga0307405_10453228
417 Ga0307413_10108265
418 Ga0307413_10144589
419 Ga0307413_10309109
420 Ga0307413_11494489
421 Ga0307410_10000781
422 Ga0307410_10021825
423 Ga0307410_10091147
424 Ga0307410_10158712
425 Ga0307410_10203663
426 Ga0307410_10302058
427 Ga0307410_10523951
428 Ga0307410_10546520
429 Ga0307410_10602651
430 Ga0307406_10022694
431 Ga0307406_10073614
432 Ga0307406_10097615
433 Ga0307406_10104997
434 Ga0307406_10598436
435 Ga0307407_10006886
436 Ga0307407_10012117
437 Ga0307407_10016666
438 Ga0307407_10074040
439 Ga0307407_10133626
440 Ga0307412_10164301
441 Ga0307412_10185743
442 Ga0307412_10317095
443 Ga0307412_10681773
444 Ga0307412_10736974
445 Ga0307409_100000519
446 Ga0307409_100002553
447 Ga0307409_100052316
448 Ga0307409_100056689
449 Ga0307409_100059478
450 Ga0307409_100189410
451 Ga0307409_100285160
452 Ga0307409_100299345
453 Ga0307409_100498395
454 Ga0307416_100000131
455 Ga0307416_100003647
456 Ga0307416_100053862
457 Ga0307416_100076305
458 Ga0307414_10022343
459 Ga0307414_10058240
460 Ga0307414_10070513
461 Ga0307414_10160388
462 Ga0307414_10992854
463 Ga0307414_11220585
464 Ga0307411_10000306
465 Ga0307411_10006632
466 Ga0307411_10039531
467 Ga0307411_10047710
468 Ga0307411_10086894
469 Ga0307411_10142470
470 Ga0307411_10710481
471 Ga0307415_100000298
472 Ga0307415_100080299
473 Ga0307415_100088106
474 Ga0307415_100246614
475 Ga0307415_100349244
476 Ga0307415_100419025
477 Ga0373961_0111338
478 Ga0373931_0425242
479 Ga0242420_092434
480 Ga0451793_1537030
481 Ga0439431_0081220
482 Ga0450898_012743
483 Ga0439435_0012905
484 Ga0453683_0144392
485 Ga0495585_0292432
486 Ga0495630_0802387
487 Ga0496102_0045996
488 Ga0496104_0237030
489 Ga0496104_1207005
490 Ga0496105_0100776
491 Ga0496106_0259611
492 Ga0496108_0325753
493 Ga0496109_0134708
494 Ga0496110_0035799
495 Ga0496110_0051906
496 Ga0496110_0709234
497 Ga0496111_0028772
498 Ga0496112_0049511
499 Ga0496113_0093461
500 Ga0501295_060931
501 Ga0501031_0321089
502 Ga0501033_0367809
503 Ga0501034_0108383
504 Ga0501036_0186358
505 Ga0501036_0333816
506 Ga0501037_0449409
507 Ga0501040_0021241
508 Ga0501040_0030711
509 Ga0501041_0121139
510 Ga0501046_0394384
511 Ga0501048_0029213
512 Ga0501048_0115118
513 Ga0501048_0321358
514 Ga0501067_0004214
515 Ga0501067_0214962
516 Ga0501068_0211642
517 Ga0501069_0020388
518 Ga0501069_0121495
519 Ga0501069_0233415
520 Ga0501070_0078254
521 Ga0501070_0226822
522 Ga0501070_0312784
523 Ga0501071_1032094
524 Ga0501072_0139423
525 Ga0501074_0318157
526 Ga0501075_0038222
527 Ga0501075_0216968
528 Ga0501076_0047595
529 Ga0501076_0056994
530 Ga0501209_001955
531 Ga0501214_022263
532 Ga0501227_081530
533 Ga0501233_095371
534 Ga0501235_075098
535 Ga0501239_000786
536 Ga0501243_003519
537 Ga0501249_002416
538 Ga0501249_032200
539 Ga0501249_032554
540 Ga0501256_001958
541 Ga0501259_011540
542 Ga0501260_036508
543 Ga0501221_008667
544 Ga0501225_0018080
545 Ga0501229_001080
546 Ga0501079_0011712
547 Ga0501079_0038817
548 Ga0501080_0068636
549 Ga0501080_0172826
550 Ga0501080_0727388
551 Ga0501081_0016601
552 Ga0501081_0111094
553 Ga0501081_0292531
554 Ga0501081_1199843
555 Ga0501262_005940
556 Ga0501263_001387
557 Ga0501271_003375
558 Ga0501272_000760
559 Ga0501283_005646
560 Ga0501035_0247105
561 Ga0501045_0393511
562 nmdc:mga05p37_133421_c1
563 nmdc:mga05p37_15879_c1
564 nmdc:mga05p37_2229100_c1
565 nmdc:mga09592_310055_c1
566 nmdc:mga0qj67_132085_c1
567 nmdc:mga06r32_35488_c2
568 nmdc:mga0n895_14850_c1
569 nmdc:mga0n895_201_c1
570 nmdc:mga08x19_129434_c1
571 nmdc:mga0a205_3162_c1
572 nmdc:mga0a205_641_c1
573 Ga0495655_0150514
574 Ga0501084_0016049
575 Ga0501084_0059106
576 Ga0590071_021122
577 Ga0501082_0037113
578 Ga0501082_0049196
579 Ga0530510_0121825
580 Ga0530510_0144412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8733 1 145
5w8m-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8728 1 145
5w8m-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8357 2 145
5w8m-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8298 1 155
5w8m-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8294 2 155
ID Description Score Start End Superfamily
5w8mB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8728 1 145 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8657 1 156 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8604 1 156 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8589 1 156 3.60.21.10
af_Q86D99_1_187_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8397 1 145 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V7G369-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9977 1 116 GO:0016787
GO:0046872
AF-A0A2V7QF86-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9962 1 156 GO:0016787
GO:0046872
AF-A0A432UDC1-F1-model_v4 YfcE family phosphodiesterase 0.9929 1 65
AF-A0A2V7GYG5-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.992 1 61
AF-A0A2V7G369-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9892 1 116 GO:0016787
GO:0046872

Map