F389651

General Info

Members Datasets Scaffolds Average Seq Length
290 197 282 251

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100069489|Ga0070665_1000694892
Length 265
Sequence MPIDLMPINPMLKCVIAEDEELLRNELSKLLAQAWPGLDIVAECEDGGAALEAIAEHQPEVAFLDIRMPGLTGLEVATAAAGASPRTQIVFVTAYDQYAIDAFDKGAVDYLLKPISAERLAATVQRLQARIAQGKPDADALAALIAQLGTRAQAPAVEPLVWITASAGKDTRLIMIDDVAYFQADHKYTVVMTAEGESLLRKPIRELLEVLDPGIFKQIHRSTIVNLKAIASIARDDTGKGTVRLKSRPETLTVSQPFMSLFRNM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2643221695 Lysobacter sp. Root494 Isolate Unclassified
7 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
8 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
9 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
67 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
139 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.28
Nodule 0.69
Rhizoplane 2.76
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2071660 2162886007 Bacteria 5658
2 JGI25151J46595_10000519 3300003187 Bacteria 35984
3 JGI25153J46596_10000203 3300003215 Bacteria 54460
4 Ga0055524_1000008 3300003775 Bacteria 297761
5 Ga0055531_10002315 3300003794 Bacteria 12863
6 Ga0065704_10070673 3300005289 Bacteria 17884
7 Ga0070658_10041776 3300005327 Bacteria 3700
8 Ga0070658_10060930 3300005327 Bacteria 3074
9 Ga0070670_100028040 3300005331 Bacteria 4845
10 Ga0070666_10001638 3300005335 Bacteria 13640
11 Ga0068868_100060603 3300005338 Bacteria 2997
12 Ga0070689_100080203 3300005340 Bacteria 2561
13 Ga0070689_100164150 3300005340 Bacteria 1797
14 Ga0070661_100419008 3300005344 Bacteria 1061
15 Ga0070668_100401564 3300005347 Bacteria 1170
16 Ga0070669_100109858 3300005353 Bacteria 2091
17 Ga0070671_100176496 3300005355 Bacteria 1808
18 Ga0070674_100103415 3300005356 Bacteria 2079
19 Ga0070674_100265611 3300005356 Bacteria 1354
20 Ga0070659_100138106 3300005366 Bacteria 1983
21 Ga0070667_100020579 3300005367 Bacteria 5476
22 Ga0070667_100119695 3300005367 Bacteria 2290
23 Ga0070709_10167439 3300005434 Bacteria 1533
24 Ga0070714_100122784 3300005435 Bacteria 2312
25 Ga0070694_100027879 3300005444 Bacteria 3671
26 Ga0070663_100017193 3300005455 Bacteria 4714
27 Ga0070662_100009908 3300005457 Bacteria 6242
28 Ga0068867_100229825 3300005459 Bacteria 1499
29 Ga0068867_100261589 3300005459 Bacteria 1411
30 Ga0068867_100664211 3300005459 Bacteria 916
31 Ga0070685_10000644 3300005466 Bacteria 19019
32 Ga0070698_100392889 3300005471 Bacteria 1320
33 Ga0070679_100004688 3300005530 Bacteria 12616
34 Ga0070696_100046755 3300005546 Bacteria 3002
35 Ga0070693_100003521 3300005547 Bacteria 7298
36 Ga0070693_100013805 3300005547 Bacteria 4122
37 Ga0070665_100006436 3300005548 Bacteria 11952
38 Ga0070665_100069489 3300005548 Bacteria 3530
39 Ga0070665_100771716 3300005548 Bacteria 974
40 Ga0070665_100821032 3300005548 Bacteria 943
41 Ga0068855_100010002 3300005563 Bacteria 11428
42 Ga0068855_100012578 3300005563 Bacteria 10214
43 Ga0068855_100030430 3300005563 Bacteria 6458
44 Ga0068855_100062839 3300005563 Bacteria 4334
45 Ga0068855_100899941 3300005563 Bacteria 935
46 Ga0068855_100900419 3300005563 Unclassified 935
47 Ga0070664_100229764 3300005564 Bacteria 1663
48 Ga0068854_100026190 3300005578 Bacteria 4005
49 Ga0068854_100520157 3300005578 Bacteria 1005
50 Ga0068856_100174029 3300005614 Bacteria 2165
51 Ga0068856_100261166 3300005614 Bacteria 1747
52 Ga0068852_100001973 3300005616 Bacteria 13986
53 Ga0068852_100002158 3300005616 Bacteria 13499
54 Ga0068852_100003959 3300005616 Bacteria 10408
55 Ga0068852_100453334 3300005616 Bacteria 1270
56 Ga0068861_100381445 3300005719 Bacteria 1245
57 Ga0068851_10000470 3300005834 Bacteria 17809
58 Ga0068851_10000705 3300005834 Bacteria 14267
59 Ga0068863_100610663 3300005841 Bacteria 1080
60 Ga0068858_100001081 3300005842 Bacteria 28201
61 Ga0068860_100200440 3300005843 Bacteria 1934
62 Ga0068862_100028944 3300005844 Bacteria 4666
63 Ga0081539_10033614 3300005985 Bacteria 3119
64 Ga0075363_100196345 3300006048 Bacteria 1152
65 Ga0075364_10017965 3300006051 Bacteria 4423
66 Ga0075366_10020441 3300006195 Bacteria 3842
67 Ga0075366_10052604 3300006195 Bacteria 2419
68 Ga0075366_10094440 3300006195 Bacteria 1793
69 Ga0097621_100016344 3300006237 Bacteria 5607
70 Ga0097621_100228677 3300006237 Bacteria 1623
71 Ga0068871_100004031 3300006358 Bacteria 10145
72 Ga0068871_100029734 3300006358 Bacteria 4294
73 Ga0068871_100075059 3300006358 Bacteria 2790
74 Ga0068871_100162226 3300006358 Bacteria 1912
75 Ga0099826_10000001 3300006948 Bacteria 1155201
76 Ga0105240_10016752 3300009093 Bacteria 9912
77 Ga0105240_10025552 3300009093 Bacteria 7759
78 Ga0105240_10300740 3300009093 Bacteria 1836
79 Ga0105240_10311484 3300009093 Bacteria 1797
80 Ga0111539_10888850 3300009094 Bacteria 1036
81 Ga0105245_10044847 3300009098 Bacteria 3947
82 Ga0105245_10180584 3300009098 Bacteria 2016
83 Ga0105245_10266942 3300009098 Bacteria 1667
84 Ga0105241_10064293 3300009174 Bacteria 2832
85 Ga0105242_10041857 3300009176 Bacteria 3697
86 Ga0105242_10048577 3300009176 Bacteria 3449
87 Ga0105242_10417388 3300009176 Bacteria 1256
88 Ga0105248_10059518 3300009177 Bacteria 4291
89 Ga0105248_10103171 3300009177 Bacteria 3214
90 Ga0105248_10694220 3300009177 Bacteria 1148
91 Ga0105237_10004224 3300009545 Bacteria 16728
92 Ga0105237_10321387 3300009545 Bacteria 1551
93 Ga0105238_10000662 3300009551 Bacteria 36151
94 Ga0105238_10052734 3300009551 Bacteria 4088
95 Ga0105238_10053969 3300009551 Bacteria 4038
96 Ga0105249_10566293 3300009553 Bacteria 1188
97 Ga0105032_100745 3300009979 Bacteria 3105
98 Ga0105028_104776 3300009993 Bacteria 1413
99 Ga0105239_10150610 3300010375 Bacteria 2596
100 Ga0105239_10171655 3300010375 Bacteria 2425
101 Ga0157371_10000026 3300013102 Bacteria 274703
102 Ga0157371_10142081 3300013102 Bacteria 1710
103 Ga0157370_10018733 3300013104 Bacteria 6960
104 Ga0157369_10000338 3300013105 Bacteria 62072
105 Ga0157369_10052071 3300013105 Bacteria 4430
106 Ga0157374_10024739 3300013296 Bacteria 5383
107 Ga0157374_10127765 3300013296 Bacteria 2458
108 Ga0157378_10019868 3300013297 Bacteria 5905
109 Ga0163162_10000017 3300013306 Bacteria 233474
110 Ga0163162_10785746 3300013306 Bacteria 1070
111 Ga0157372_10005102 3300013307 Bacteria 13960
112 Ga0157372_10167708 3300013307 Bacteria 2539
113 Ga0157375_10039384 3300013308 Bacteria 4549
114 Ga0157375_10808096 3300013308 Bacteria 1086
115 Ga0157380_10083406 3300014326 Bacteria 2618
116 Ga0182008_10156679 3300014497 Bacteria 1144
117 Ga0157376_10125717 3300014969 Bacteria 2280
118 Ga0163161_10003757 3300017792 Bacteria 10632
119 Ga0163161_10043089 3300017792 Bacteria 3249
120 Ga0163161_10207007 3300017792 Bacteria 1514
121 Ga0163161_10572329 3300017792 Bacteria 928
122 Ga0213876_10031655 3300021384 Bacteria 2790
123 Ga0207425_1000155 3300025245 Bacteria 58218
124 Ga0209129_1000243 3300025258 Bacteria 58221
125 Ga0209233_1002864 3300025261 Bacteria 6177
126 Ga0209025_1000002 3300025294 Bacteria 1393142
127 Ga0209025_1007801 3300025294 Bacteria 7869
128 Ga0209758_1000003 3300025297 Bacteria 1398533
129 Ga0209256_1000005 3300025299 Bacteria 1315082
130 Ga0209257_1000046 3300025304 Bacteria 477765
131 Ga0209257_1000147 3300025304 Bacteria 194105
132 Ga0207656_10051625 3300025321 Bacteria 1778
133 Ga0207647_10000165 3300025904 Bacteria 52279
134 Ga0207699_10191867 3300025906 Bacteria 1379
135 Ga0207705_10018280 3300025909 Bacteria 5013
136 Ga0207705_10043019 3300025909 Bacteria 3244
137 Ga0207695_10000014 3300025913 Bacteria 812599
138 Ga0207695_10020047 3300025913 Bacteria 7674
139 Ga0207695_10020048 3300025913 Bacteria 7674
140 Ga0207695_10087350 3300025913 Bacteria 3141
141 Ga0207695_10224470 3300025913 Bacteria 1785
142 Ga0207671_10005338 3300025914 Bacteria 11894
143 Ga0207671_10053635 3300025914 Bacteria 2988
144 Ga0207671_10241577 3300025914 Bacteria 1418
145 Ga0207662_10269584 3300025918 Bacteria 1123
146 Ga0207649_10393349 3300025920 Bacteria 1036
147 Ga0207649_10446129 3300025920 Bacteria 976
148 Ga0207652_10121450 3300025921 Bacteria 2324
149 Ga0207681_10091664 3300025923 Bacteria 2171
150 Ga0207694_10000696 3300025924 Bacteria 30209
151 Ga0207694_10002916 3300025924 Bacteria 13765
152 Ga0207694_10020115 3300025924 Bacteria 5047
153 Ga0207650_10018551 3300025925 Bacteria 4882
154 Ga0207687_10043729 3300025927 Bacteria 3088
155 Ga0207687_10099299 3300025927 Bacteria 2139
156 Ga0207687_10166809 3300025927 Bacteria 1695
157 Ga0207664_10120667 3300025929 Bacteria 2193
158 Ga0207690_10216390 3300025932 Bacteria 1463
159 Ga0207706_10005130 3300025933 Bacteria 12224
160 Ga0207670_10074863 3300025936 Bacteria 2352
161 Ga0207670_10392280 3300025936 Bacteria 1108
162 Ga0207704_10050671 3300025938 Bacteria 2506
163 Ga0207661_10286961 3300025944 Bacteria 1472
164 Ga0207667_10038526 3300025949 Bacteria 5104
165 Ga0207667_10047910 3300025949 Bacteria 4521
166 Ga0207667_10258061 3300025949 Bacteria 1782
167 Ga0207667_10291936 3300025949 Bacteria 1666
168 Ga0207712_10000091 3300025961 Bacteria 103955
169 Ga0207640_10019173 3300025981 Bacteria 4036
170 Ga0207658_10083141 3300025986 Bacteria 2460
171 Ga0207677_10117287 3300026023 Bacteria 1995
172 Ga0207703_10001167 3300026035 Bacteria 24807
173 Ga0207639_10000431 3300026041 Bacteria 28957
174 Ga0207678_10008414 3300026067 Bacteria 9102
175 Ga0207702_10294364 3300026078 Bacteria 1539
176 Ga0207648_10379369 3300026089 Bacteria 1278
177 Ga0207648_10447240 3300026089 Bacteria 1176
178 Ga0207676_10571833 3300026095 Bacteria 1082
179 Ga0207674_10019940 3300026116 Bacteria 7256
180 Ga0207675_100315409 3300026118 Bacteria 1525
181 Ga0207698_10005447 3300026142 Bacteria 7869
182 Ga0207698_10201849 3300026142 Bacteria 1781
183 Ga0207698_10338850 3300026142 Bacteria 1415
184 Ga0209282_1000001 3300027666 Bacteria 2450367
185 Ga0268266_10000007 3300028379 Bacteria 1372921
186 Ga0268266_10716575 3300028379 Bacteria 965
187 Ga0307515_10347868 3300028794 Bacteria 1131
188 Ga0314311_1093761 3300030733 Bacteria 3043
189 Ga0307513_10002018 3300031456 Bacteria 28576
190 Ga0307412_10094565 3300031911 Bacteria 2099
191 Ga0307412_10543288 3300031911 Bacteria 975
192 Ga0307409_100667841 3300031995 Bacteria 1035
193 Ga0307416_100784272 3300032002 Bacteria 1048
194 Ga0307414_10007189 3300032004 Bacteria 6248
195 Ga0307414_10010323 3300032004 Bacteria 5411
196 Ga0307414_10022754 3300032004 Bacteria 3960
197 Ga0307414_10192828 3300032004 Bacteria 1650
198 Ga0373956_0051645 3300035119 Bacteria 1848
199 Ga0373933_0014298 3300035724 Bacteria 4413
200 Ga0373937_0109212 3300036401 Bacteria 2572
201 Ga0395899_0170848 3300037312 Bacteria 1531
202 Ga0395900_0059294 3300037418 Bacteria 3940
203 Ga0395905_0008018 3300037471 Bacteria 10435
204 Ga0395901_0140103 3300038443 Bacteria 2542
205 Ga0237819_00214 3300038705 Bacteria 21030
206 Ga0237816_00089 3300039145 Bacteria 6600
207 Ga0436365_0455094 3300039437 Bacteria 2785
208 Ga0436365_1834490 3300039437 Bacteria 2665
209 Ga0439439_0034885 3300041406 Bacteria 1291
210 Ga0439465_0006869 3300041413 Bacteria 3614
211 Ga0439465_0009011 3300041413 Bacteria 3144
212 Ga0451791_0715689 3300041451 Bacteria 2492
213 Ga0451797_0434367 3300041453 Bacteria 1357
214 Ga0451843_1275670 3300041509 Bacteria 2138
215 Ga0439431_0066494 3300041997 Bacteria 955
216 Ga0439445_0001511 3300042004 Bacteria 5055
217 Ga0439445_0032278 3300042004 Bacteria 1364
218 Ga0439449_0000181 3300042007 Bacteria 21923
219 Ga0439449_0007957 3300042007 Bacteria 4027
220 Ga0439449_0123971 3300042007 Bacteria 959
221 Ga0451577_0196118 3300042876 Bacteria 1823
222 Ga0495592_0071865 3300046454 Bacteria 2518
223 Ga0495638_0035923 3300046460 Bacteria 3157
224 Ga0495638_0049649 3300046460 Bacteria 2623
225 Ga0495651_0327042 3300046462 Bacteria 1020
226 Ga0495583_0000008 3300046506 Bacteria 411092
227 Ga0495583_0007713 3300046506 Bacteria 6703
228 Ga0495608_0012631 3300046511 Bacteria 5860
229 Ga0495610_0014617 3300046512 Bacteria 4603
230 Ga0495628_0138248 3300046516 Bacteria 1860
231 Ga0495631_0020048 3300046518 Bacteria 3128
232 Ga0495643_0052709 3300046522 Bacteria 2183
233 Ga0495663_0002187 3300046525 Bacteria 5958
234 Ga0495642_0028333 3300046528 Bacteria 2231
235 Ga0495587_0146888 3300046536 Bacteria 1344
236 Ga0495621_0001914 3300046539 Bacteria 5474
237 Ga0495645_0005384 3300046543 Bacteria 8777
238 Ga0495633_0000646 3300046558 Bacteria 32408
239 Ga0495633_0006549 3300046558 Bacteria 6882
240 Ga0495659_0009261 3300046664 Bacteria 3140
241 Ga0495599_0001738 3300046678 Bacteria 12600
242 Ga0495623_0119211 3300046679 Bacteria 1590
243 Ga0495671_0073219 3300046692 Bacteria 1681
244 Ga0495636_0027810 3300047318 Bacteria 2303
245 Ga0495636_0072559 3300047318 Bacteria 1471
246 Ga0495684_0069103 3300047471 Bacteria 2686
247 Ga0496102_0000071 3300048905 Bacteria 154320
248 Ga0496102_0634418 3300048905 Bacteria 992
249 Ga0496103_0028907 3300048906 Bacteria 3367
250 Ga0496104_0032487 3300048907 Bacteria 4858
251 Ga0496110_0165355 3300048913 Bacteria 2006
252 Ga0496114_0001458 3300048917 Bacteria 17963
253 Ga0496121_0027610 3300048924 Bacteria 5307
254 Ga0496122_0018615 3300048925 Bacteria 6401
255 Ga0496123_0010001 3300048926 Bacteria 8452
256 Ga0496123_0038141 3300048926 Bacteria 3382
257 Ga0496124_0006784 3300048927 Bacteria 12364
258 Ga0496124_0109953 3300048927 Bacteria 2220
259 Ga0496126_0074091 3300048929 Bacteria 3024
260 Ga0501034_0001335 3300049571 Bacteria 33318
261 Ga0501047_0009440 3300049581 Bacteria 9215
262 Ga0501047_0067580 3300049581 Bacteria 3444
263 Ga0501069_0002077 3300049585 Bacteria 10077
264 Ga0501070_0027593 3300049586 Bacteria 4762
265 Ga0501070_0195404 3300049586 Bacteria 1662
266 Ga0501070_0276301 3300049586 Bacteria 1371
267 Ga0501073_0004904 3300049589 Bacteria 10045
268 Ga0501074_0006298 3300049590 Bacteria 8570
269 Ga0501225_0003905 3300049705 Bacteria 4463
270 Ga0501079_0167680 3300049741 Bacteria 1712
271 Ga0501080_0040404 3300049742 Bacteria 4350
272 Ga0501083_0016881 3300049744 Bacteria 5099
273 Ga0501044_0165445 3300049823 Bacteria 2186
274 nmdc:mga03n38_156107_c1 3300050490 Bacteria 1152
275 nmdc:mga0k408_129063_c1 3300050493 Bacteria 1500
276 nmdc:mga0k408_200269_c1 3300050493 Bacteria 1192
277 nmdc:mga0k408_47883_c1 3300050493 Bacteria 2471
278 nmdc:mga0k408_54338_c1 3300050493 Bacteria 2321
279 Ga0495601_0012763 3300053077 Bacteria 5042
280 Ga0495595_0024499 3300053084 Bacteria 2666
281 Ga0500634_0004994 3300053161 Bacteria 6237
282 Ga0501082_0075750 3300060353 Bacteria 2899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0012763 Ga0495601_0012763_2896_3579 225
2 3300005459 Ga0068867_100664211 Ga0068867_1006642111 227
3 3300046558 Ga0495633_0000646 Ga0495633_0000646_4736_5515 227
4 3300005344 Ga0070661_100419008 Ga0070661_1004190082 228
5 3300025920 Ga0207649_10393349 Ga0207649_103933492 228
6 3300013306 Ga0163162_10785746 Ga0163162_107857461 229
7 3300005347 Ga0070668_100401564 Ga0070668_1004015642 230
8 3300005367 Ga0070667_100119695 Ga0070667_1001196952 230
9 3300005444 Ga0070694_100027879 Ga0070694_1000278794 230
10 3300009098 Ga0105245_10180584 Ga0105245_101805842 230
11 3300025918 Ga0207662_10269584 Ga0207662_102695841 230
12 3300025927 Ga0207687_10166809 Ga0207687_101668092 230
13 3300025986 Ga0207658_10083141 Ga0207658_100831412 230
14 3300046539 Ga0495621_0001914 Ga0495621_0001914_3272_4039 230
15 3300025304 Ga0209257_1000147 Ga0209257_100014771 232
16 3300005434 Ga0070709_10167439 Ga0070709_101674391 233
17 3300006358 Ga0068871_100162226 Ga0068871_1001622262 233
18 3300009177 Ga0105248_10103171 Ga0105248_101031712 233
19 3300025906 Ga0207699_10191867 Ga0207699_101918671 233
20 3300048925 Ga0496122_0018615 Ga0496122_0018615_2473_3237 234
21 3300048926 Ga0496123_0010001 Ga0496123_0010001_1416_2180 234
22 3300048929 Ga0496126_0074091 Ga0496126_0074091_1153_1917 234
23 3300005563 Ga0068855_100030430 Ga0068855_1000304309 236
24 3300013104 Ga0157370_10018733 Ga0157370_100187334 236
25 3300025949 Ga0207667_10047910 Ga0207667_100479103 236
26 3300032004 Ga0307414_10010323 Ga0307414_100103233 236
27 3300009979 Ga0105032_100745 Ga0105032_1007452 237
28 3300017792 Ga0163161_10572329 Ga0163161_105723291 238
29 3300032004 Ga0307414_10007189 Ga0307414_100071891 238
30 3300046460 Ga0495638_0049649 Ga0495638_0049649_33_800 238
31 3300046528 Ga0495642_0028333 Ga0495642_0028333_1155_1931 238
32 3300047318 Ga0495636_0072559 Ga0495636_0072559_565_1341 238
33 3300005616 Ga0068852_100453334 Ga0068852_1004533341 239
34 3300026142 Ga0207698_10338850 Ga0207698_103388502 239
35 3300049581 Ga0501047_0009440 Ga0501047_0009440_5305_6078 239
36 3300049585 Ga0501069_0002077 Ga0501069_0002077_8378_9151 239
37 3300049586 Ga0501070_0027593 Ga0501070_0027593_1257_2030 239
38 3300049589 Ga0501073_0004904 Ga0501073_0004904_2631_3404 239
39 3300049590 Ga0501074_0006298 Ga0501074_0006298_3341_4114 239
40 3300049741 Ga0501079_0167680 Ga0501079_0167680_851_1624 239
41 3300049742 Ga0501080_0040404 Ga0501080_0040404_362_1135 239
42 3300049744 Ga0501083_0016881 Ga0501083_0016881_643_1416 239
43 3300049823 Ga0501044_0165445 Ga0501044_0165445_385_1158 239
44 3300060353 Ga0501082_0075750 Ga0501082_0075750_1842_2615 239
45 3300048905 Ga0496102_0000071 Ga0496102_0000071_104912_105676 240
46 3300048905 Ga0496102_0634418 Ga0496102_0634418_110_877 240
47 3300048906 Ga0496103_0028907 Ga0496103_0028907_1551_2315 240
48 3300006195 Ga0075366_10052604 Ga0075366_100526043 241
49 3300049581 Ga0501047_0067580 Ga0501047_0067580_837_1610 241
50 3300049586 Ga0501070_0276301 Ga0501070_0276301_359_1132 241
51 3300046506 Ga0495583_0000008 Ga0495583_0000008_360736_361506 244
52 3300005353 Ga0070669_100109858 Ga0070669_1001098581 245
53 3300025923 Ga0207681_10091664 Ga0207681_100916642 245
54 3300005843 Ga0068860_100200440 Ga0068860_1002004402 248
55 3300005844 Ga0068862_100028944 Ga0068862_1000289444 248
56 3300013308 Ga0157375_10808096 Ga0157375_108080961 248
57 3300017792 Ga0163161_10003757 Ga0163161_100037573 248
58 3300026095 Ga0207676_10571833 Ga0207676_105718332 248
59 3300046506 Ga0495583_0007713 Ga0495583_0007713_5191_5961 248
60 3300046522 Ga0495643_0052709 Ga0495643_0052709_36_806 248
61 3300046664 Ga0495659_0009261 Ga0495659_0009261_474_1244 248
62 3300047318 Ga0495636_0027810 Ga0495636_0027810_431_1201 248
63 iso_pu_bacteria 2894414249 2894416951 249
64 3300005331 Ga0070670_100028040 Ga0070670_1000280403 251
65 3300005335 Ga0070666_10001638 Ga0070666_1000163811 251
66 3300005355 Ga0070671_100176496 Ga0070671_1001764962 251
67 3300005367 Ga0070667_100020579 Ga0070667_1000205793 251
68 3300005455 Ga0070663_100017193 Ga0070663_1000171934 251
69 3300005457 Ga0070662_100009908 Ga0070662_1000099086 251
70 3300005459 Ga0068867_100261589 Ga0068867_1002615891 251
71 3300005466 Ga0070685_10000644 Ga0070685_1000064414 251
72 3300005548 Ga0070665_100006436 Ga0070665_1000064368 251
73 3300005563 Ga0068855_100062839 Ga0068855_1000628393 251
74 3300005563 Ga0068855_100899941 Ga0068855_1008999411 251
75 3300005564 Ga0070664_100229764 Ga0070664_1002297643 251
76 3300005578 Ga0068854_100026190 Ga0068854_1000261903 251
77 3300005614 Ga0068856_100174029 Ga0068856_1001740293 251
78 3300005616 Ga0068852_100003959 Ga0068852_1000039597 251
79 3300005834 Ga0068851_10000470 Ga0068851_1000047010 251
80 3300005842 Ga0068858_100001081 Ga0068858_1000010817 251
81 3300006237 Ga0097621_100228677 Ga0097621_1002286772 251
82 3300009093 Ga0105240_10300740 Ga0105240_103007402 251
83 3300009174 Ga0105241_10064293 Ga0105241_100642933 251
84 3300009176 Ga0105242_10417388 Ga0105242_104173882 251
85 3300009177 Ga0105248_10694220 Ga0105248_106942202 251
86 3300009545 Ga0105237_10321387 Ga0105237_103213873 251
87 3300009551 Ga0105238_10052734 Ga0105238_100527344 251
88 3300009553 Ga0105249_10566293 Ga0105249_105662932 251
89 3300010375 Ga0105239_10150610 Ga0105239_101506102 251
90 3300010375 Ga0105239_10171655 Ga0105239_101716552 251
91 3300013105 Ga0157369_10052071 Ga0157369_100520713 251
92 3300013296 Ga0157374_10024739 Ga0157374_100247394 251
93 3300013307 Ga0157372_10167708 Ga0157372_101677083 251
94 3300025261 Ga0209233_1002864 Ga0209233_10028645 251
95 3300025321 Ga0207656_10051625 Ga0207656_100516252 251
96 3300025904 Ga0207647_10000165 Ga0207647_1000016530 251
97 3300025913 Ga0207695_10000014 Ga0207695_10000014138 251
98 3300025913 Ga0207695_10020047 Ga0207695_100200475 251
99 3300025913 Ga0207695_10020048 Ga0207695_100200485 251
100 3300025914 Ga0207671_10005338 Ga0207671_100053389 251
101 3300025914 Ga0207671_10053635 Ga0207671_100536352 251
102 3300025914 Ga0207671_10241577 Ga0207671_102415772 251
103 3300025924 Ga0207694_10000696 Ga0207694_100006965 251
104 3300025924 Ga0207694_10002916 Ga0207694_100029163 251
105 3300025925 Ga0207650_10018551 Ga0207650_100185514 251
106 3300025933 Ga0207706_10005130 Ga0207706_100051304 251
107 3300025938 Ga0207704_10050671 Ga0207704_100506712 251
108 3300025949 Ga0207667_10258061 Ga0207667_102580612 251
109 3300025961 Ga0207712_10000091 Ga0207712_1000009117 251
110 3300025981 Ga0207640_10019173 Ga0207640_100191733 251
111 3300026035 Ga0207703_10001167 Ga0207703_1000116720 251
112 3300026041 Ga0207639_10000431 Ga0207639_100004318 251
113 3300026067 Ga0207678_10008414 Ga0207678_100084144 251
114 3300026089 Ga0207648_10447240 Ga0207648_104472401 251
115 3300026116 Ga0207674_10019940 Ga0207674_100199405 251
116 3300026142 Ga0207698_10201849 Ga0207698_102018492 251
117 3300028379 Ga0268266_10000007 Ga0268266_10000007418 251
118 3300041453 Ga0451797_0434367 Ga0451797_0434367_143_898 251
119 3300041509 Ga0451843_1275670 Ga0451843_1275670_1303_2058 251
120 iso_pu_bacteria 2524614729 2525555669 251
121 iso_pu_bacteria 2627854209 2630650683 251
122 3300005985 Ga0081539_10033614 Ga0081539_100336143 252
123 3300009093 Ga0105240_10016752 Ga0105240_100167528 252
124 3300009176 Ga0105242_10041857 Ga0105242_100418574 252
125 3300009545 Ga0105237_10004224 Ga0105237_100042249 252
126 3300009551 Ga0105238_10000662 Ga0105238_1000066220 252
127 iso_pu_bacteria 2643221579 2643905284 252
128 iso_pu_bacteria 2643221581 2643914966 252
129 iso_pu_bacteria 2923516293 2923517394 252
130 3300005327 Ga0070658_10041776 Ga0070658_100417762 253
131 3300005327 Ga0070658_10060930 Ga0070658_100609302 253
132 3300005340 Ga0070689_100164150 Ga0070689_1001641502 253
133 3300005366 Ga0070659_100138106 Ga0070659_1001381062 253
134 3300005435 Ga0070714_100122784 Ga0070714_1001227842 253
135 3300005530 Ga0070679_100004688 Ga0070679_1000046882 253
136 3300005563 Ga0068855_100012578 Ga0068855_1000125782 253
137 3300005563 Ga0068855_100900419 Ga0068855_1009004191 253
138 3300005614 Ga0068856_100261166 Ga0068856_1002611661 253
139 3300005616 Ga0068852_100001973 Ga0068852_1000019734 253
140 3300005616 Ga0068852_100002158 Ga0068852_1000021583 253
141 3300005719 Ga0068861_100381445 Ga0068861_1003814452 253
142 3300005834 Ga0068851_10000705 Ga0068851_100007054 253
143 3300006358 Ga0068871_100029734 Ga0068871_1000297343 253
144 3300009093 Ga0105240_10025552 Ga0105240_100255529 253
145 3300009093 Ga0105240_10311484 Ga0105240_103114842 253
146 3300009551 Ga0105238_10053969 Ga0105238_100539693 253
147 3300013102 Ga0157371_10142081 Ga0157371_101420812 253
148 3300013105 Ga0157369_10000338 Ga0157369_1000033842 253
149 3300013307 Ga0157372_10005102 Ga0157372_100051023 253
150 3300025909 Ga0207705_10018280 Ga0207705_100182802 253
151 3300025909 Ga0207705_10043019 Ga0207705_100430193 253
152 3300025913 Ga0207695_10087350 Ga0207695_100873501 253
153 3300025920 Ga0207649_10446129 Ga0207649_104461291 253
154 3300025921 Ga0207652_10121450 Ga0207652_101214503 253
155 3300025924 Ga0207694_10020115 Ga0207694_100201154 253
156 3300025929 Ga0207664_10120667 Ga0207664_101206674 253
157 3300025936 Ga0207670_10392280 Ga0207670_103922802 253
158 3300025944 Ga0207661_10286961 Ga0207661_102869612 253
159 3300025949 Ga0207667_10038526 Ga0207667_100385267 253
160 3300025949 Ga0207667_10291936 Ga0207667_102919362 253
161 3300026078 Ga0207702_10294364 Ga0207702_102943641 253
162 3300026142 Ga0207698_10005447 Ga0207698_100054472 253
163 3300032002 Ga0307416_100784272 Ga0307416_1007842721 253
164 3300037312 Ga0395899_0170848 Ga0395899_0170848_72_836 253
165 3300037418 Ga0395900_0059294 Ga0395900_0059294_2478_3242 253
166 3300037471 Ga0395905_0008018 Ga0395905_0008018_5712_6476 253
167 3300038443 Ga0395901_0140103 Ga0395901_0140103_1196_1960 253
168 3300046460 Ga0495638_0035923 Ga0495638_0035923_38_799 253
169 3300048907 Ga0496104_0032487 Ga0496104_0032487_3953_4717 253
170 3300048913 Ga0496110_0165355 Ga0496110_0165355_1221_1985 253
171 3300006195 Ga0075366_10020441 Ga0075366_100204414 254
172 3300009993 Ga0105028_104776 Ga0105028_1047762 254
173 3300021384 Ga0213876_10031655 Ga0213876_100316552 254
174 3300025932 Ga0207690_10216390 Ga0207690_102163901 254
175 3300031911 Ga0307412_10094565 Ga0307412_100945652 254
176 3300031911 Ga0307412_10543288 Ga0307412_105432881 254
177 3300031995 Ga0307409_100667841 Ga0307409_1006678412 254
178 3300039145 Ga0237816_00089 Ga0237816_00089_292_1056 254
179 3300039437 Ga0436365_0455094 Ga0436365_0455094_716_1483 254
180 3300039437 Ga0436365_1834490 Ga0436365_1834490_1719_2486 254
181 3300048924 Ga0496121_0027610 Ga0496121_0027610_2894_3661 254
182 3300050493 nmdc:mga0k408_200269_c1 nmdc:mga0k408_200269_c1_185_949 254
183 3300050493 nmdc:mga0k408_47883_c1 nmdc:mga0k408_47883_c1_1007_1771 254
184 iso_pu_bacteria 2643221695 2644528573 254
185 3300003794 Ga0055531_10002315 Ga0055531_100023158 255
186 3300005338 Ga0068868_100060603 Ga0068868_1000606033 255
187 3300005340 Ga0070689_100080203 Ga0070689_1000802032 255
188 3300005356 Ga0070674_100103415 Ga0070674_1001034152 255
189 3300005356 Ga0070674_100265611 Ga0070674_1002656112 255
190 3300005459 Ga0068867_100229825 Ga0068867_1002298252 255
191 3300005471 Ga0070698_100392889 Ga0070698_1003928892 255
192 3300005546 Ga0070696_100046755 Ga0070696_1000467552 255
193 3300005547 Ga0070693_100003521 Ga0070693_1000035216 255
194 3300005547 Ga0070693_100013805 Ga0070693_1000138054 255
195 3300005548 Ga0070665_100771716 Ga0070665_1007717162 255
196 3300005548 Ga0070665_100821032 Ga0070665_1008210322 255
197 3300005563 Ga0068855_100010002 Ga0068855_1000100022 255
198 3300005841 Ga0068863_100610663 Ga0068863_1006106632 255
199 3300006048 Ga0075363_100196345 Ga0075363_1001963452 255
200 3300006051 Ga0075364_10017965 Ga0075364_100179651 255
201 3300006195 Ga0075366_10094440 Ga0075366_100944402 255
202 3300006237 Ga0097621_100016344 Ga0097621_1000163444 255
203 3300006358 Ga0068871_100004031 Ga0068871_1000040317 255
204 3300006358 Ga0068871_100075059 Ga0068871_1000750592 255
205 3300009094 Ga0111539_10888850 Ga0111539_108888502 255
206 3300009098 Ga0105245_10044847 Ga0105245_100448472 255
207 3300009098 Ga0105245_10266942 Ga0105245_102669422 255
208 3300009176 Ga0105242_10048577 Ga0105242_100485773 255
209 3300009177 Ga0105248_10059518 Ga0105248_100595183 255
210 3300013102 Ga0157371_10000026 Ga0157371_10000026169 255
211 3300013296 Ga0157374_10127765 Ga0157374_101277652 255
212 3300013297 Ga0157378_10019868 Ga0157378_100198685 255
213 3300013306 Ga0163162_10000017 Ga0163162_1000001745 255
214 3300013308 Ga0157375_10039384 Ga0157375_100393843 255
215 3300014326 Ga0157380_10083406 Ga0157380_100834062 255
216 3300014969 Ga0157376_10125717 Ga0157376_101257171 255
217 3300017792 Ga0163161_10043089 Ga0163161_100430892 255
218 3300025294 Ga0209025_1007801 Ga0209025_10078012 255
219 3300025304 Ga0209257_1000046 Ga0209257_1000046260 255
220 3300025913 Ga0207695_10224470 Ga0207695_102244702 255
221 3300025927 Ga0207687_10043729 Ga0207687_100437292 255
222 3300025927 Ga0207687_10099299 Ga0207687_100992992 255
223 3300025936 Ga0207670_10074863 Ga0207670_100748632 255
224 3300026023 Ga0207677_10117287 Ga0207677_101172872 255
225 3300026089 Ga0207648_10379369 Ga0207648_103793692 255
226 3300026118 Ga0207675_100315409 Ga0207675_1003154092 255
227 3300028379 Ga0268266_10716575 Ga0268266_107165752 255
228 3300028794 Ga0307515_10347868 Ga0307515_103478682 255
229 3300031456 Ga0307513_10002018 Ga0307513_100020186 255
230 3300032004 Ga0307414_10022754 Ga0307414_100227543 255
231 3300035119 Ga0373956_0051645 Ga0373956_0051645_189_962 255
232 3300035724 Ga0373933_0014298 Ga0373933_0014298_142_915 255
233 3300036401 Ga0373937_0109212 Ga0373937_0109212_246_1019 255
234 3300041406 Ga0439439_0034885 Ga0439439_0034885_342_1109 255
235 3300041413 Ga0439465_0006869 Ga0439465_0006869_356_1123 255
236 3300041451 Ga0451791_0715689 Ga0451791_0715689_1042_1809 255
237 3300041997 Ga0439431_0066494 Ga0439431_0066494_164_931 255
238 3300042007 Ga0439449_0123971 Ga0439449_0123971_166_933 255
239 3300042876 Ga0451577_0196118 Ga0451577_0196118_126_896 255
240 3300046454 Ga0495592_0071865 Ga0495592_0071865_1683_2456 255
241 3300046462 Ga0495651_0327042 Ga0495651_0327042_113_886 255
242 3300046511 Ga0495608_0012631 Ga0495608_0012631_1942_2715 255
243 3300046516 Ga0495628_0138248 Ga0495628_0138248_243_1016 255
244 3300046525 Ga0495663_0002187 Ga0495663_0002187_984_1751 255
245 3300046536 Ga0495587_0146888 Ga0495587_0146888_68_841 255
246 3300046543 Ga0495645_0005384 Ga0495645_0005384_7003_7776 255
247 3300046678 Ga0495599_0001738 Ga0495599_0001738_7681_8454 255
248 3300046679 Ga0495623_0119211 Ga0495623_0119211_250_1023 255
249 3300046692 Ga0495671_0073219 Ga0495671_0073219_207_974 255
250 3300047471 Ga0495684_0069103 Ga0495684_0069103_760_1533 255
251 3300048926 Ga0496123_0038141 Ga0496123_0038141_1768_2535 255
252 3300048927 Ga0496124_0109953 Ga0496124_0109953_905_1672 255
253 3300049586 Ga0501070_0195404 Ga0501070_0195404_375_1145 255
254 3300050490 nmdc:mga03n38_156107_c1 nmdc:mga03n38_156107_c1_13_780 255
255 3300050493 nmdc:mga0k408_129063_c1 nmdc:mga0k408_129063_c1_417_1193 255
256 3300050493 nmdc:mga0k408_54338_c1 nmdc:mga0k408_54338_c1_22_792 255
257 3300053084 Ga0495595_0024499 Ga0495595_0024499_253_1026 255
258 iso_pu_bacteria 2885080285 2885080393 255
259 2162886007 SwRhRL2b_contig_2071660 SwRhRL2b_0043.00005460 256
260 3300003187 JGI25151J46595_10000519 JGI25151J46595_1000051925 256
261 3300003215 JGI25153J46596_10000203 JGI25153J46596_1000020325 256
262 3300003775 Ga0055524_1000008 Ga0055524_1000008216 256
263 3300005289 Ga0065704_10070673 Ga0065704_1007067312 256
264 3300005548 Ga0070665_100069489 Ga0070665_1000694892 256
265 3300005578 Ga0068854_100520157 Ga0068854_1005201572 256
266 3300006948 Ga0099826_10000001 Ga0099826_10000001388 256
267 3300014497 Ga0182008_10156679 Ga0182008_101566791 256
268 3300017792 Ga0163161_10207007 Ga0163161_102070072 256
269 3300025245 Ga0207425_1000155 Ga0207425_100015531 256
270 3300025258 Ga0209129_1000243 Ga0209129_100024331 256
271 3300025294 Ga0209025_1000002 Ga0209025_1000002804 256
272 3300025297 Ga0209758_1000003 Ga0209758_1000003811 256
273 3300025299 Ga0209256_1000005 Ga0209256_10000051162 256
274 3300027666 Ga0209282_1000001 Ga0209282_10000011526 256
275 3300030733 Ga0314311_1093761 Ga0314311_10937612 256
276 3300032004 Ga0307414_10192828 Ga0307414_101928283 256
277 3300038705 Ga0237819_00214 Ga0237819_00214_20236_21018 256
278 3300041413 Ga0439465_0009011 Ga0439465_0009011_390_1160 256
279 3300042004 Ga0439445_0001511 Ga0439445_0001511_1919_2689 256
280 3300042004 Ga0439445_0032278 Ga0439445_0032278_423_1193 256
281 3300042007 Ga0439449_0000181 Ga0439449_0000181_17241_18011 256
282 3300042007 Ga0439449_0007957 Ga0439449_0007957_3049_3819 256
283 3300046512 Ga0495610_0014617 Ga0495610_0014617_2143_2919 256
284 3300046518 Ga0495631_0020048 Ga0495631_0020048_2177_2953 256
285 3300046558 Ga0495633_0006549 Ga0495633_0006549_5125_5904 256
286 3300048917 Ga0496114_0001458 Ga0496114_0001458_11142_11912 256
287 3300048927 Ga0496124_0006784 Ga0496124_0006784_9531_10313 256
288 3300049571 Ga0501034_0001335 Ga0501034_0001335_21824_22594 256
289 3300049705 Ga0501225_0003905 Ga0501225_0003905_1114_1884 256
290 3300053161 Ga0500634_0004994 Ga0500634_0004994_2642_3421 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

169

265

0.97

PF00072

Response_reg

Response regulator receiver domain

14

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6w-assembly1.cif.gz_A lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. 0.8986 151 254
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.877 3 118
6swf-assembly1.cif.gz_A selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus 0.8765 1 124
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.876 1 118
3q15-assembly2.cif.gz_D-3 crystal structure of raph complexed with spo0f 0.8741 4 117
ID Description Score Start End Superfamily
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9386 151 219 2.40.50.40
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9133 151 219 2.40.50.40
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9121 3 85 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9114 1 85 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9072 3 85 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C7WMN0-F1-model_v4 LytTR family transcriptional regulator 0.9435 165 251 GO:0000156
GO:0003677
AF-A0A1M3M8J3-F1-model_v4 HTH LytTR-type domain-containing protein 0.9237 144 254 GO:0000156
GO:0003677
GO:0016020
AF-A0A836RQV5-F1-model_v4 LytTR family transcriptional regulator 0.9152 165 254 GO:0000156
GO:0003677
AF-A0A7X8X120-F1-model_v4 LytTR family transcriptional regulator 0.8987 167 254 GO:0000156
GO:0003677
AF-A0A3D4TPM5-F1-model_v4 DNA-binding response regulator 0.8936 1 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
85.49 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map